Патентная документация ЕАПВ

 
Запрос :  ea201691548a*\id

больше ...
Термины запроса в документе


Полный текст патента

(57) Реферат / Формула:

Настоящее изобретение относится к экспрессирующей конструкции для экспрессии растворимых полипептидов в клетках-хозяевах и для экспрессии полипептидов на поверхности клеток-хозяев с применением альтернативного сплайсинга. Количество экспрессии полипептидов, таких как антитела, фрагменты антитела и биспецифичные антитела, на мембране клетки может непосредственно коррелировать с количеством экспрессируемого растворимого полипептида. В случае биспецифичных антител экспрессия на клеточной мембране гетеродимерных и гомодимерных продуктов может непосредственно коррелировать с экспрессией данных растворимых продуктов, что облегчает отбор желаемого клона продуцента.


Евразийское (21) 201691548 (13) A1
патентное
ведомство
(12) ОПИСАНИЕ ИЗОБРЕТЕНИЯ К ЕВРАЗИЙСКОЙ ЗАЯВКЕ
(43) Дата публикации заявки 2017.02.28
(22) Дата подачи заявки 2015.03.02
(51) Int. Cl. C12N15/09 (2006.01)
(54) ЭКСПРЕССИРУЮЩИЕ КОНСТРУКЦИИ И СПОСОБЫ ДЛЯ ОТБОРА КЛЕТОК-ХОЗЯЕВ, ЭКСПРЕССИРУЮЩИХ ПОЛИПЕПТИДЫ
(31) 14157324.6
(32) 2014.02.28
(33) EP
(86) PCT/EP2015/054331
(87) WO 2015/128509 2015.09.03
(71) Заявитель:
ГЛЕНМАРК ФАРМАСЬЮТИКАЛС С.А. (CH)
(72) Изобретатель:
Эбишер-Гуми Кристель, Моретти Пьер, Бертшингер Мартин (CH)
(74) Представитель:
Нилова М.И. (RU) (57) Настоящее изобретение относится к экспрес-сирующей конструкции для экспрессии растворимых полипептидов в клетках-хозяевах и для экспрессии полипептидов на поверхности клеток-хозяев с применением альтернативного сплайсинга. Количество экспрессии полипептидов, таких как антитела, фрагменты антитела и биспецифичные антитела, на мембране клетки может непосредственно коррелировать с количеством экспресси-руемого растворимого полипептида. В случае би-специфичных антител экспрессия на клеточной мембране гетеродимерных и гомодимерных продуктов может непосредственно коррелировать с экспрессией данных растворимых продуктов, что облегчает отбор желаемого клона продуцента.
ЭКСПРЕССИРУЮЩИЕ КОНСТРУКЦИИ И СПОСОБЫ ДЛЯ ОТБОРА КЛЕТОК-ХОЗЯЕВ, ЭКСПРЕССИРУЮЩИХ ПОЛИПЕПТИДЫ
Область техники
5 Настоящее изобретение относится к экспрессирующим конструкциям и способам для экспрессии фракции секретируемого белка, представляющего интерес, на поверхности эукариотических клеток с применением альтернативного сплайсинга. Настоящее изобретение также относится к способам отбора клетки или клеток, которые экспрессируют секретируемый белок, представляющий интерес, на желаемом уровне, 10 посредством обнаружения уровня мембранной экспрессии белка, представляющего интерес. Настоящее изобретение также относится к отбору клетки или клеток, которые экспрессируют секретируемые гетеромультимерные белки, представляющие интерес, посредством обнаружения уровня мембранной экспрессии гетеромультимерного белка, представляющего интерес.
Уровень техники
Для наработки белка в эукариотической клетке ДНК, кодирующая данный белок, должна быть транскрибирована в матричную РНК (мРНК), которая, в свою очередь, будет транслирована в белок. Сначала мРНК транскрибируется в ядре в виде пре-мРНК,
20 содержащей интроны и экзоны. В процессе созревания пре-мРНК в зрелую мРНК интроны вырезаются ("сплайсируются") аппаратом клетки, который называют сплайсосомой. Экзоны сливаются вместе, и мРНК модифицируется посредством добавления так называемого "кэпа" на 5'-конец и хвоста полиаденилирования (поли(А)) на 3'-конец. Зрелая мРНК экспортируется в цитоплазму и выступает в качестве матрицы
25 для трансляции белков.
Альтернативный сплайсинг представляет собой термин, описывающий, что один и тот же транскрипт может быть сплайсирован различным образом, что приводит к появлению различных зрелых мРНК, а в некоторых случаях - различных белков. Данный механизм 30 используется в природе для изменения уровня экспрессии белков или в процессе разработки для модификации активности определенных белков (Cooper ТА & Ordahl CP (1985), J Biol Chem, 260(20): 11140-8). Альтернативный сплайсинг обычно контролируется посредством сложных взаимодействий многих факторов (Orengo JP et al, (2006) Nucleic Acids Res, 34(22): el48).
Альтернативный сплайсинг делает возможным образование двух (или более) различных РНК-транскриптов с той же матрицы ДНК. Данное свойство можно использовать для получения двух (или более) изоформ одного и того же белка или полипептида. По всей настоящей спецификации термины "белок" и "полипептид" используются 5 взаимозаменяемо.
В природе альтернативный сплайсинг представляет собой в высшей степени контролируемый процесс, используемый, например, в процессе продукции антител активированными В-клетками в иммунной системе человека. Большинство антител 10 секретируется во внеклеточное пространство, но фракция продуцированного антитела перенаправляется с секреторного пути на внешнюю мембрану клетки в форме мембраносвязанных изоформ.
Мембраносвязанные изоформы содержат ту же аминокислотную последовательность и 15 структуру, что и антитело, секретируемое во внеклеточное пространство. Различие заключается в С-концевом удлинении тяжелой цепи секретируемого антитела трансмембранной областью, содержащей трансмембранный домен. В В-клетках длина данного домена может составлять приблизительно от 40 до 75 аминокислот (Major JG et al, (1996) Mol. Immunol. 33: 179-87).
Экспрессирующие системы для продукции рекомбинантных полипептидов хорошо известны в данной области техники. Для продукции полипептидов и белков, используемых в фармацевтических препаратах, обычно применяют клетки-хозяева млекопитающих, такие как СНО, ВНК, NSO, Sp2/0, COS, НЕК и PER.Сб. Для
25 крупномасштабной продукции терапевтических белков должна быть создана высокопродуктивная клеточная линия. После трансфекции клеточной линии-хозяина геном, кодирующим полипептид, представляющий интерес, получают множество клонов с различными характеристиками и проводят отбор. Отбор проводят общепринятым способом с применением, например, селектируемого маркера,
30 амплификации генов и/или репортерных молекул. Отбор соответствующего клона с желаемыми свойствами, например, высокопродуктивного клона, занимает много времени, часто является нестандартным и вследствие этого дорогим процессом.
В случае экспрессии гетеромультимерных белков, таких как биспецифичные антитела, получение подходящей клеточной линии-хозяина становится еще более сложным. Субъединицы белка, которые составляют мультимер, могут экспрессироваться в отдельных клеточных линиях, а затем быть сведены воедино для ассоциации в 5 мультимерный белок, либо, в качестве альтернативы, различные субъединицы можно экспрессировать в одной клеточной линии. Экспрессия субъединиц в одной клеточной линии сопряжена с недостатками, заключающимися в том, что не все субъединицы белка будут ассоциировать в правильной форме, что приводит к получению смеси различных форм. При получении биспецифичных антител вместо желаемого гетеродимера часто
10 образуются значительные уровни гомодимеров, что в значительной степени влияет на выход продукции биспецифичного антитела. И хотя нежелательные гомодимеры можно удалить посредством различных методик очистки, предпочтительно наличие клеточной линии-хозяина, в которой гетеродимеры экспрессируются на более высоких уровнях, чем гомодимеры, для сокращения напрасной траты времени и средств при последующем
15 процессинге.
Таким образом, существует потребность в системе экспрессии, которую можно использовать для отбора клона или клонов клеток, экспрессирующих продукт, представляющий интерес, на высоком уровне, т.е. для количественного отбора. Также 20 существует потребность в способности отобрать клон или клоны клеток, которые экспрессируют продукт, представляющий интерес, желаемого качества, т.е. потребность в качественном отборе, например, на основании экспрессии гетеромультимерного белка, представляющего интерес.
25 Краткое описание изобретения
Настоящее изобретение относится к экспрессирующей конструкции или совокупности конструкций, предназначенных для экспрессии растворимого полипептида, представляющего интерес, посредством альтернативного сплайсинга, причем часть 30 растворимого пептида секретируется во внеклеточное пространство, а часть экспонируется на внешней мембране клетки или клеток.
Настоящее изобретение также включает способы отбора клеток-хозяев, содержащих одну или более конструкций согласно настоящему изобретению, которые на желаемом уровне экспонируют полипептид, представляющий интерес, на внешней мембране.
5 Настоящее изобретение также относится к отбору клетки или клеток, которые экспрессируют секретируемые гетеродимерные белки, представляющие интерес, посредством обнаружения экспонирования гетеродимерного белка, представляющего интерес, на мембране клетки или клеток, содержащих одну или более конструкций согласно настоящему изобретению.
Согласно первому аспекту в настоящем изобретении предложена экспрессирующая
конструкция, содержащая в направлении от 5' к 3':
промотор;
первый экзон, кодирующий полипептид, представляющий интерес; 15 донорный сайт сплайсинга, интрон и акцепторный сайт сплайсинга, причем первый стоп-кодон расположен между донорным сайтом сплайсинга и акцепторным сайтом сплайсинга в пределах указанного интрона;
второй экзон, кодирующий трансмембранную область, которая представляет собой модифицированную трансмембранную область иммуноглобулина или 20 трансмембранную область, отличную от трансмембранной области иммуноглобулина; второй стоп-кодон; и сайт полиаденилирования;
причем после поступления в клетку-хозяин транскрипция первого и второго экзонов приводит к экспрессии полипептида, представляющего интерес, и экспонированию 25 части полипептида, представляющего интерес, на внешней мембране клетки-хозяина.
Согласно другому аспекту настоящего изобретения трансмембранная область, кодируемая вторым экзоном конструкции, содержит по меньшей мере 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21 или 22 остатков аминокислот.
30 Согласно другому аспекту настоящего изобретения транс мембранная область, кодируемая вторым экзоном конструкции, содержит не более 48, 47, 46, 45, 44, 43, 42, 41, 40, 39, 38, 37, 36, 35, 34, 33, 32, 31, 30, 29, 28, 27, 26 остатков аминокислот.
В частности, трансмембранная область может содержать от 17 до 29 остатков, от 19 до 26 остатков или от 21 до 24 остатков.
Согласно настоящему изобретению модифицированная трансмембранная область 5 иммуноглобулина или модифицированная трансмембранная область, отличная от трансмембранной области иммуноглобулина, может представлять собой любой модифицированный вариант существующей в природе трансмембранной области иммуноглобулина или трансмембранной области, отличной от трансмембранной области иммуноглобулина.
Авторы настоящего изобретения модифицировали разнообразную группу трансмембранных областей для того, чтобы изменить свойства последних и, в частности, модулировать интеграцию в мембрану клетки и вследствие этого - экспонирование полипептида, представляющего интерес. В частности, аминокислотный состав 15 трансмембранной области можно изменить для того, чтобы уменьшить или увеличить количество негидрофобных остатков в данной области на один или более остатков, а также увеличить или уменьшить размер трансмембранной области.
Авторы настоящего изобретения неожиданно обнаружили, что применение 20 трансмембранной области, отличной от трансмембранной области иммуноглобулина, например, трансмембранной области В7-1 мыши (SEQ Ш N0: 173), приводит к высокому уровню экспрессии на мембране клетки по сравнению с уровнями, наблюдаемыми при применении трансмембранной области IgGl.
25 Авторы настоящего изобретения также исследовали трансмембранные области из ACLV1 (NP_001070869.1) SEQ Ш NO: 174, ANTR2 (NP_477520.2) SEQ Ш NO: 175, CD4 (NP 000607.1) SEQ Ш NO: 176, PTPRM (NP 002836.3) SEQ Ш NO: 177, TNR5 (NP 001241.1) SEQ Ш NO: 178, ITB1 (NP 596867.1) SEQ Ш NO: 179, IGF1R (NP_000866.1) SEQ Ш NO: 181, 1B07 (NP_005505.2) SEQ Ш NO: 180, TRMB
30 (NP_000352.1) SEQ ID NO: 182, IL4RA (NP_000409.1) SEQ Ш NO: 183, LRP6 (NP_002327.2) SEQ ID NO: 184, GpA (NP_002090) SEQ Ш NO: 185, PTCRA (NP_001230097.1) SEQ ID NO: 186, а также модифицированные варианты данных трансмембранных областей, и продемонстрировали, что данные трансмембранные
области являются подходящими для применения в конструкции или конструкциях согласно настоящему изобретению.
Согласно другому аспекту настоящего изобретения первый стоп-код он расположен с 3' -5 конца от донорного сайта сплайсинга интрона.
Согласно одному варианту реализации в настоящем изобретении также предложены способы изменения соотношения сплайсинга, наблюдаемого для данной конструкции, для того, чтобы на мембране клетки экспонировалось достаточное количество 10 полипептида, которое позволит проводить отбор клеток, в то время как большая часть полипептида экспрессируется в растворимой форме.
Авторы настоящего изобретения исследовали различные компоненты заявленных экспрессирующих конструкций, которые позволяли модулировать экспонирование 15 белка, представляющего интерес, на мембране.
Согласно настоящему изобретению уровень экспрессии растворимого полипептида можно увеличить посредством добавления сайта поли(А) в интрон экспрессирующей конструкции, описанной в настоящей заявке.
Согласно аспекту настоящего изобретения конструкция может содержать конститутивный интрон, расположенный между промотором и первым экзоном.
Согласно настоящему изобретению силу акцептора сплайсинга и донора сплайсинга 25 можно модифицировать для того, чтобы увеличить или уменьшить количество белка, представляющего интерес, экспонированного на мембране клетки.
В частности, консенсусную последовательность донорного сайта сплайсинга можно модифицировать посредством уменьшения или увеличения % идентичности или 30 подобия последовательности донорного сайта сплайсинга, присутствующего в конструкции, консенсусной последовательности донорного сайта сплайсинга (С/A)AGGT(А/G)AGT (SEQ ID N0: 345).
Согласно следующему варианту реализации настоящего изобретения консенсусную последовательность донорного сайта сплайсинга модифицируют с целью уменьшения силы донора сплайсинга. Консенсусную последовательность донорного сайта сплайсинга можно модифицировать посредством применения альтернативного кодона, 5 например, посредством замены AAA, кодирующего лизин, на AAG, кодирующий лизин. Такая замена уменьшит уровень мембранной экспрессии. И наоборот, увеличение % идентичности или подобия донорного сайта сплайсинга консенсусной последовательности донорного сайта сплайсинга (C/A)AGGT(A/G)AGT (SEQ Ш NO: 345) увеличит силу донорного сайта сплайсинга в конструкции и увеличит уровень 10 мембранной экспрессии.
Согласно аспекту настоящего изобретения донорный сайт сплайсинга перекрывает 3'-конец первого экзона и 5'-конец интрона, и акцепторный сайт сплайсинга интрона расположен на 3'-конце интрона.
Согласно аспекту настоящего изобретения первый стоп-код он расположен с 3' -конца от донорного сайта сплайсинга.
Согласно интрон экспрессирующей конструкции необязательно содержит поли(У)-20 участок, включенный в акцепторный сайт сплайсинга. Содержание Y в поли(У)-участке, включенном в акцепторный сайт сплайсинга интрона экспрессирующей конструкции, можно модифицировать. Изменение количества пиримидиновых оснований (Y) в поли(У)-участке можно использовать для уменьшения или увеличения экспрессии полипептида, представляющего интерес, на клеточной мембране. В случае полипептида, 25 представляющего интерес, с высоким уровнем мембранной экспрессии клеткой уменьшение количества Y в поли(У)-участке уменьшит уровень мембранной экспрессии. В случае полипептида с низким уровнем мембранной экспрессии клеткой увеличение количества Y в поли(У)-участке увеличит уровень мембранной экспрессии.
30 В частности, содержание поли(У) в акцепторе сплайсинга можно понизить для уменьшения силы акцепторного сайта сплайсинга посредством изменения содержания поли(У) в акцепторном сайте сплайсинга, что уменьшит экспонирование на мембране полипептида, представляющего интерес.
В качестве альтернативы, содержание поли(У) в акцепторе сплайсинга можно повысить для увеличения силы акцепторного сайта сплайсинга посредством изменения содержания поли(У) в акцепторном сайте сплайсинга, тем самым увеличивая экспонирование полипептида, представляющего интерес, на мембране.
Помимо модификаций, описанных выше, на событие альтернативного сплайсинга, которое приводит к экспонированию полипептида на мембране, можно также повлиять посредством модификации последовательности ДНК (и, вследствие этого, РНК) области точки разветвления. Нуклеотид области точки разветвления инициирует событие
10 сплайсинга посредством атаки на первый нуклеотид интрона на 5'-сайте сплайсинга, тем самым образуя промежуточную структуру типа "лассо". Изменение последовательности области точки разветвления относительно консенсусной последовательности (CTRAYY SEQ Ш N0: 347) может оказывать влияние на эффективность инициации события сплайсинга и, вследствие этого, на соотношение секретируемого полипептида и
15 полипептида, экспонированного на мембране.
Также на соотношение сплайсинга может повлиять длина интрона. Было продемонстрировано, что вероятность включения альтернативного экзона в CD44 возрастает, когда интрон, расположенный непосредственно "выше по течению" от 20 экзона, является укороченным (Bell, М., Cowper, A., Lefranc, М., Bell, J. and Screaton, G. (1998). Influence of Intron Length on Alternative Splicing of CD44 Mol Cell Biol. 18(10): 5930-5941.). В связи с этим следующим способом модификации конструкций является укорачивание длины интрона в конструкциях на основе альтернативного сплайсинга для увеличения фракции экспонированного на мембране полипептида, или наоборот.
Дополнительный механизм влияния на событие сплайсинга заключается в коэкспрессии РНК-связывающих белков, которая приводит к включению или пропуску экзона. Например, было показано, что белки CUG-BP (учетный № Uniprot: Q5F3T7) и muscleblind-подобный белок 3 (muscle-blind like 3, MBNL) (учетный № Uniprot: 30 Q5ZKW9) оказывают влияние на соотношение сплайсинга в конструкции, экспрессирующей EGFP и dsRED (Orengo et al., 2006).
Вследствие этого в настоящем изобретении также предложена дополнительно модифицированная конструкция, содержащая экспрессируемые ОРС (открытые рамки
считывания), кодирующие РНК-связывающие белки, которые вызывают включение или пропуск экзона, а также способы, включающие котрансфекцию конструкциями согласно настоящему изобретению, содержащими экспрессируемые ОРС, кодирующие РНК-связывающие белки, которые вызывают включение или пропуск экзона, и/или отдельные 5 конструкции, содержащие такие ОРС.
Кроме того, большинство мембранных белков проходят через эндоплазматический ретикулум (ЭР) и комплекс Гольджи, прежде чем достигнут поверхности клетки. Экспорт из ЭР представляет собой селективный процесс, опосредуемый транспортными
10 пузырьками комплекса коатомера II (СОРИ), которые отделяются от участков выхода из ЭР. Взаимодействия между компонентами транспортных пузырьков СОРИ и короткими аминокислотными последовательностями с линейными двукислотными гидрофобными и ароматическими мотивами или структурными мотивами в цитоплазматическом домене белков, заякоренных в мембрану, концентрируют транспортные белки в участках выхода
15 из ЭР и усиливают поступление транспортируемых веществ в пузырьки СОРИ. Данные короткие линейные или структурные мотивы аминокислотной последовательности называют сигналами экспорта из ЭР.
Вследствие этого другой подход для корректировки экспонирования белка, 20 представляющего интерес, на мембране заключается во введении либо отсутствии введения сигнала экспорта из ЭР для модификации прохождения полипептида, представляющего интерес, слитого с трансмембранной областью, через ЭР. Модификацию сигнала экспорта из ЭР, содержащегося в конструкции, для увеличения экспорта из ЭР используют с целью увеличения экспонирования белков, 25 характеризующихся коротким периодом полужизни либо другими ограничениями стабильности или деградации, на мембране, и наоборот.
Авторы настоящего изобретения обнаружили, что количество полипептида, представляющего интерес, экспонированного на мембране клетки, прямо 30 пропорционально уровню экспрессии растворимого полипептида. Вследствие этого клетки-хозяева, экспрессирующие полипептид, представляющий интерес, с высоким титром, экспонируют больше полипептида на мембране, чем клетки-хозяева, экспрессирующие полипептид с низким титром. Данный факт делает возможным
непосредственное обнаружение и выделение высокопродуктивных рекомбинантных клеток-хозяев.
Согласно аспекту настоящего изобретения полипептид, кодируемый экспрессирующей 5 конструкцией, может представлять собой часть белка-мультимера, например, гетеромультимерного полипептида, такого как рекомбинантное антитело или фрагменты рекомбинантного антитела. Фрагменты антитела могут быть выбраны из перечня, включающего: Fab, Fd, Fv, dAb, F(ab')2 и scFv. Согласно предпочтительному варианту реализации настоящего изобретения полипептид, который экспрессирует 10 экспрессирующая конструкция, может представлять собой тяжелую цепь антитела или фрагменты тяжелой цепи антитела.
Согласно следующему аспекту настоящего изобретения экспрессирующую конструкцию можно использовать для экспрессии биспецифичного антитела в клетке-
15 хозяине. Согласно одному варианту реализации настоящего изобретения экспрессируемый полипептид представляет собой тяжелую цепь антитела. В качестве альтернативы, экспрессируемый полипептид представляет собой фрагмент антитела, присоединенный к Fc-области антитела. Фрагмент антитела может быть выбран из перечня, включающего: Fab, Fd, Fv, dAb, F(ab')2 и scFv. Предпочтительно фрагмент
20 антитела представляет собой Fab или scFv. Более предпочтительно, фрагмент антитела представляет собой scFv. С целью эффективной экспрессии биспецифичного антитела также может быть обеспечена отдельная экспрессирующая конструкция для экспрессии легкой цепи антитела. Коэкспрессия экспрессирующих конструкций, кодирующих тяжелую цепь антитела и фрагмент антитела-Fc, с экспрессирующей конструкцией,
25 кодирующей легкую цепь антитела, в клетках-хозяевах, приводит к экспрессии биспецифичного антитела. Как обсуждается выше, экспрессия биспецифичного антитела в клетках-хозяевах приводит к образованию множества нежелательных гомодимерных видов помимо желаемого гетеродимера. Согласно предпочтительному варианту реализации настоящего изобретения экспонирование компонентов данного
30 биспецифичного антитела на мембране клетки делает возможным проведение непосредственного отбора клетки-хозяина, экспрессирующей преимущественно гетеродимерные антитела.
В настоящем изобретении также предложен способ изменения соотношения сплайсинга для экспонирования достаточного количества полипептида на мембране клетки, что сделает возможным проведение отбора клеток, в то время как большая часть полипептида экспрессируется в растворимой форме.
Согласно данному аспекту настоящего изобретения способ включает измерение экспонирования полипептида, представляющего интерес, на мембране, а затем модификацию компонентов конструкции на основании наблюдаемого экспонирования полипептида, представляющего интерес, на мембране для увеличения или уменьшения 10 экспонирования на мембране с целью обеспечения лучшего отбора клетки или клеток, которые экспрессируют полипептид, представляющий интерес.
В настоящем изобретении также предложен способ отбора клетки или клеток, содержащих по меньшей мере одну конструкцию согласно настоящему изобретению, 15 включающий отбор клетки или клеток посредством обнаружения уровня мембранной экспрессии белка, представляющего интерес, или гетеромультимерного белка, содержащего белок, представляющий интерес.
Краткое описание фигур
20 Фигура 1: Схематический чертеж конструкции на основе альтернативного сплайсинга согласно настоящему изобретению. В результате альтернативного сплайсинга полипептида образуются два продукта сплайсинга. В случае продукта сплайсинга 1 кодоны, кодирующие две последние аминокислоты глицин (G) и лизин (К), включены в мРНК, и полипептид секретируется из клетки. В случае продукта сплайсинга 2
25 полипептид не содержит две аминокислоты G и К, но удлинен на трансмембранную область, которая содержит необязательную соединительную область, трансмембранный домен и необязательный небольшой внутриклеточный домен, и полученный в результате полипептид не секретируется, но презентируется на внешней мембране клетки.
30 Фигура 2: Профили окрашивания клеток CHO-S, трансфицированных конструкциями на основе альтернативного сплайсинга для экспонирования и секреции антитела IgGl с применением различных трансмембранных областей. Анализ проводили через день после трансфекции. В качестве отрицательного контроля клетки CHO-S трансфицировали несплайсируемыми конструкциями, кодирующими секретируемое
антитело IgGl (ктрл). Окрашивание, которое проводили для клеток, трансфицированных различными конструкциями на основе альтернативного сплайсинга, представлено в виде закрашенной гистограммы, и окрашивание контрольных клеток, трансфицированных несплайсируемыми конструкциями, кодирующими секретируемое антитело IgGl, 5 представлено в виде наложенной черной линии (А - D). Гистограммы использовали для определения процента окрашенных клеток (Е) и средней флуоресценции окрашивания (G) конструкций на основе альтернативного сплайсинга и контроля. Титры секретируемого антитела определяли через 4 дня после трансфекции с применением прибора Octet (Н).
Фигура 3: Профили окрашивания клеток CHO-S, трансфицированных конструкциями на основе альтернативного сплайсинга для экспонирования и секреции антитела IgG4. Анализ проводили через день после трансфекции. В качестве отрицательного контроля клетки CHO-S трансфицировали несплайсируемыми конструкциями, кодирующими
15 секретируемое антитело IgG4 (IgG4). Окрашивание, которое проводили для клеток, трансфицированных конструкциями на основе альтернативного сплайсинга, представлено в виде закрашенной гистограммы, и окрашивание контрольных клеток, трансфицированных несплайсируемой конструкцией, кодирующей секретируемое антитело IgG4, представлено в виде наложенной черной линии (А). Гистограммы
20 использовали для определения процента окрашенных клеток (В) и средней флуоресценции окрашивания (D) конструкции на основе альтернативного сплайсинга и контроля. Титры секретируемого антитела определяли через 4 дня после трансфекции с применением прибора Octet (С).
25 Фигура 4: Специфичное обнаружение биспецифичного антитела, экспонированного на мембране клетки с применением технологии альтернативного сплайсинга. Клетки окрашивали через 1 день после трансфекции. Fc-фрагменты (scFv-Fc и НС, тяжелая цепь) обнаруживали с применением антитела козы, специфичного к Fc-гамма человека, конъюгированного с ФЭ (фикоэритрином) (А - С, J - L). Легкие цепи каппа
30 обнаруживали с применением антитела мыши против LC (легкой цепи) каппа человека, меченного АФЦ (аллофикоцианином) (D - F, М - О). Окрашивание scFv-Fc проводили с применением белка А, меченного ФИТЦ (флуоресцеинизотиоцианатом). Окрашивание, которое проводили для трансфицированных клеток, представлено в виде закрашенной гистограммы. В случае первого коктейля для трансфекции (A, D, G) профиль,
полученный для нетрансфицированных клеток, представлен в виде наложения (черная линия). Для всех других экспериментов (В, С, Е, F и Н - R) отрицательные контроли (профили, полученные для трансфицированных клеток без трансмембранного домена) представлены в виде наложения (пунктирные линии).
Фигура 5: Титры секретируемой гомодимерной молекулы BEAT(r) и scFv-Fc через 6 дней после временной трансфекции.
Фигура 6: Профили окрашивания клеток CHO-S, трансфицированных конструкциями 10 на основе альтернативного сплайсинга для экспонирования и секреции антитела IgGl, содержащими различные трансмембранные области и различные модификации экспрессирующей конструкции. Анализ проводили через день после трансфекции. В качестве отрицательного контроля клетки CHO-S трансфицировали несплайсируемыми конструкциями, кодирующими секретируемое антитело IgGl (контроль).
Фигура 7: Нормированные уровни экспрессии различных конструкций на основе альтернативного сплайсинга для экспонирования и секреции антитела IgGl, которыми трансфицировали клетки CHO-S. Супернатант анализировали с применением прибора Octet QK и биозондов на основе белка А ("Стандартная НС": контроль без 20 альтернативного сплайсинга).
Фигура 8: Профили окрашивания клеток CHO-S, трансфицированных конструкциями на основе альтернативного сплайсинга для экспонирования и секреции антитела IgGl с применением трансмембранной области В7-1 и различного содержания Y в поли(У)-
25 участке акцептора сплайсинга. Анализ проводили через день после трансфекции. В качестве отрицательного контроля клетки CHO-S трансфицировали несплайсируемыми конструкциями, кодирующими секретируемое антитело IgGl (ктрл). Окрашивание, которое проводили для клеток, трансфицированных различными конструкциями на основе альтернативного сплайсинга, представлено в виде закрашенной гистограммы;
30 окрашивание клеток, трансфицированных несплайсируемой конструкцией, кодирующей секретируемое антитело IgGl, представлено в виде наложенной черной линии (А - G). Гистограммы использовали для определения процента окрашенных клеток (Н) и средней флуоресценции окрашивания (J) конструкций на основе альтернативного сплайсинга и
контроля. Титры секретируемого антитела определяли через 4 дня после трансфекции с применением прибора Octet (I).
Фигура 9: Профили окрашивания клеток CHO-S, трансфицированных конструкциями 5 на основе альтернативного сплайсинга для экспонирования и секреции антитела IgGl с применением трансмембранной области В7-1 и модификации консенсусной последовательности донора сплайсинга. Анализ проводили через день после трансфекции. В качестве отрицательного контроля клетки CHO-S трансфицировали несплайсируемыми конструкциями, кодирующими секретируемый IgGl (ктрл).
10 Окрашивание, которое проводили для клеток, трансфицированных различными конструкциями на основе альтернативного сплайсинга, представлено в виде закрашенной гистограммы; окрашивание клеток, трансфицированных несплайсируемыми конструкциями, кодирующими секретируемое антитело IgGl, представлено в виде наложенной черной линии (А - С). Гистограммы использовали для
15 определения процента окрашенных клеток (D) и средней флуоресценции окрашивания (F) конструкций на основе альтернативного сплайсинга и контроля. Титры секретируемого антитела определяли через 4 дня после трансфекции с применением прибора Octet (Е).
20 Фигура 10: Профили окрашивания клеток CHO-S, трансфицированных конструкциями на основе альтернативного сплайсинга для экспонирования и секреции антитела IgGl с применением трансмембранной области В7-1 с различными трансмембранными доменами, состоящими из 22 - 23 гидрофобных аминокислот. Анализ проводили через день после трансфекции. В качестве положительного контроля проводили трансфекцию
25 конструкцией на основе альтернативного сплайсинга, кодирующей секретируемый и экспонированный на мембране IgGl с трансмембранной областью В7-1, содержащей трансмембранный домен В7-1 (заполненная гистограмма на (А)), и в качестве отрицательного контроля клетки CHO-S трансфицировали несплайсируемыми конструкциями, кодирующими секретируемое антитело IgGl (наложенная черная линия
30 на (А)). Окрашивание, которое проводили для клеток, трансфицированных конструкциями, кодирующими секретируемый и экспонированный на мембране IgGl, с применением различных трансмембранных доменов, представлено в виде закрашенной гистограммы; окрашивание клеток, трансфицированных конструкцией с применением трансмембранной области В7-1, содержащей трансмембранный домен В7-1,
представлено в виде наложенной черной линии (В - G). Гистограммы использовали для определения процента окрашенных клеток (Н) и средней флуоресценции окрашивания (I) конструкций на основе альтернативного сплайсинга и контроля. Титры секретируемого антитела определяли через 4 дня после трансфекции с применением 5 прибора Octet (G).
Фигура 11: Профили окрашивания клеток CHO-S, трансфицированных конструкциями на основе альтернативного сплайсинга для экспонирования и секреции антитела IgGl с применением трансмембранной области В7-1 с различными трансмембранными
10 доменами, состоящими из 21 - 24 гидрофобных аминокислот и содержащими гидрофобные, полярные и заряженные остатки. Анализ проводили через день после трансфекции. В качестве положительного контроля клетки трансфицировали конструкцией на основе альтернативного сплайсинга, кодирующей секретируемый и экспонированный на мембране IgGl с трансмембранной областью В7-1, содержащей
15 трансмембранный домен В7-1 (заполненные гистограммы на (А)), и в качестве отрицательного контроля клетки CHO-S трансфицировали несплайсируемыми конструкциями, кодирующими секретируемое антитело IgGl (наложенная черная линия на (А)). Окрашивание, которое проводили для клеток, трансфицированных конструкциями, кодирующими секретируемый и экспонированный на мембране IgGl, с
20 применением различных трансмембранных доменов, представлено в виде закрашенной гистограммы; окрашивание клеток, трансфицированных конструкцией с применением трансмембранной области В7-1, содержащей трансмембранный домен В7-1, представлено в виде наложенной черной линии (В - Н). Окрашивание, которое проводили для клеток, трансфицированных конструкциями, кодирующими
25 секретируемый и экспонированный на мембране IgGl, с применением трансмембранных доменов PTCRA, представлено в виде закрашенной гистограммы; окрашивание клеток, трансфицированных несплайсируемыми конструкциями, кодирующими секретируемое антитело IgGl, представлено в виде наложенной черной линии (I). Гистограммы использовали для определения процента окрашенных клеток (J) и средней
30 флуоресценции окрашивания (L) конструкций на основе альтернативного сплайсинга и контроля. Титры секретируемого антитела определяли через 4 дня после трансфекции с применением прибора Octet (К).
Фигура 12: Профили окрашивания клеток CHO-S, трансфицированных конструкциями на основе альтернативного сплайсинга для экспонирования и секреции антитела IgGl с применением трансмембранной области В7-1, содержащей трансмембранный домен PTCRA, с вариацией количества гидрофобных остатков в трансмембранном домене 5 PTCRA. Анализ проводили через день после трансфекции. В качестве положительного контроля клетки трансфицировали конструкцией на основе альтернативного сплайсинга, кодирующей секретируемый и экспонированный на мембране IgGl с трансмембранной областью В7-1 и трансмембранным доменом PTCRA дикого типа (заполненные гистограммы на (А)), и в качестве отрицательного контроля клетки CHO-S
10 трансфицировали несплайсируемыми конструкциями, кодирующими секретируемое антитело IgGl (наложенная черная линия на (А)). Окрашивание, которое проводили для клеток, трансфицированных конструкциями, кодирующими секретируемый и экспонированный на мембране IgGl, с применением различных модификаций трансмембранных доменов PTCRA, представлено в виде закрашенной гистограммы;
15 окрашивание клеток, трансфицированных конструкцией с применением трансмембранной области В7-1 с трансмембранным доменом PTCRA дикого типа, представлено в виде наложенной черной линии (В - Н). Гистограммы использовали для определения процента окрашенных клеток (I) и средней флуоресценции окрашивания (К) конструкций на основе альтернативного сплайсинга и контроля. Титры
20 секретируемого антитела определяли через 4 дня после трансфекции с применением прибора Octet (J).
Фигура 13: Профили окрашивания клеток CHO-S, трансфицированных конструкциями на основе альтернативного сплайсинга для экспонирования и секреции антитела IgGl с
25 применением трансмембранной области В7-1 с различными трансмембранными доменами, состоящими из 17 - 19 гидрофобных аминокислот и содержащими гидрофобные, полярные и заряженные остатки. Анализ проводили через день после трансфекции. В качестве положительного контроля клетки трансфицировали конструкцией на основе альтернативного сплайсинга, кодирующей секретируемый и
30 экспонированный на мембране IgGl с трансмембранной областью В7-1, содержащей трансмембранный домен В7-1 (заполненные гистограммы на (А)), и в качестве отрицательного контроля клетки CHO-S трансфицировали несплайсируемыми конструкциями, кодирующими секретируемое антитело IgGl (наложенная черная линия на (А)). Окрашивание, которое проводили для клеток, трансфицированных
конструкциями, кодирующими секретируемый и экспонированный на мембране IgGl, с применением различных трансмембранных доменов, представлено в виде закрашенной гистограммы; окрашивание клеток, трансфицированных конструкцией с применением трансмембранной области В7-1, содержащей трансмембранный домен В7-1, 5 представлено в виде наложенной черной линии (В - D). Гистограммы использовали для определения процента окрашенных клеток (Е) и средней флуоресценции окрашивания
(G) конструкций на основе альтернативного сплайсинга и контроля. Титры
секретируемого антитела определяли через 4 дня после трансфекции с применением
прибора Octet (F).
Фигура 14: Профили окрашивания клеток CHO-S, трансфицированных конструкциями на основе альтернативного сплайсинга для экспонирования и секреции антитела IgGl с применением трансмембранной области В7-1 с различными трансмембранными доменами, состоящими из 26 - 27 гидрофобных аминокислот и содержащими
15 гидрофобные, полярные и заряженные остатки. Анализ проводили через день после трансфекции. В качестве положительного контроля клетки трансфицировали конструкцией на основе альтернативного сплайсинга, кодирующей секретируемый и экспонированный на мембране IgGl с трансмембранной областью В7-1, содержащей трансмембранный домен В7-1 (заполненные гистограммы на (А)), и в качестве
20 отрицательного контроля клетки CHO-S трансфицировали несплайсируемыми конструкциями, кодирующими секретируемое антитело IgGl (наложенная черная линия на (А)). Окрашивание, которое проводили для клеток, трансфицированных конструкциями, кодирующими секретируемый и экспонированный на мембране IgGl, с применением различных трансмембранных доменов, представлено в виде закрашенной
25 гистограммы; окрашивание клеток, трансфицированных конструкцией с применением трансмембранной области В7-1, содержащей трансмембранный домен В7-1, представлено в виде наложенной черной линии (В - Е). Гистограммы использовали для определения процента окрашенных клеток (F) и средней флуоресценции окрашивания
(H) конструкций на основе альтернативного сплайсинга и контроля. Титры
30 секретируемого антитела определяли через 4 дня после трансфекции с применением
прибора Octet (G).
Фигура 15: Профили окрашивания клеток CHO-S, трансфицированных конструкциями на основе альтернативного сплайсинга для экспонирования и секреции антитела IgGl с
применением трансмембранной области В7-1 с укороченными или удлиненными трансмембранными доменами В7-1. Анализ проводили через день после трансфекции. В качестве положительного контроля клетки трансфицировали конструкцией на основе альтернативного сплайсинга, кодирующей секретируемый и экспонированный на 5 мембране IgGl с трансмембранной областью В7-1, содержащей трансмембранный домен В7-1 дикого типа (заполненные гистограммы на (А)), и в качестве отрицательного контроля клетки CHO-S трансфицировали несплайсируемыми конструкциями, кодирующими секретируемое антитело IgGl (наложенная черная линия на (А)). Окрашивание, которое проводили для клеток, трансфицированных конструкциями,
10 кодирующими секретируемый и экспонированный на мембране IgGl, с применением различных трансмембранных доменов, представлено в виде закрашенной гистограммы; окрашивание клеток, трансфицированных конструкцией с применением трансмембранной области В7-1, содержащей трансмембранный домен В7-1 дикого типа, представлено в виде наложенной черной линии (В - Е). Гистограммы использовали для
15 определения процента окрашенных клеток (F) и средней флуоресценции окрашивания (Н) конструкций на основе альтернативного сплайсинга и контроля. Титры секретируемого антитела определяли через 4 дня после временной экспрессии с применением прибора Octet (G).
20 Фигура 16: Профили окрашивания клеток CHO-S, трансфицированных конструкциями на основе альтернативного сплайсинга для экспонирования и секреции антитела IgGl с применением трансмембранной области В7-1 с различными цитозольными хвостами. Анализ проводили через день после трансфекции. В качестве положительного контроля клетки трансфицировали конструкцией на основе альтернативного сплайсинга,
25 кодирующей секретируемый и экспонированный на мембране IgGl с трансмембранной областью В7-1, содержащей цитозольный хвост В7-1 (заполненные гистограммы на (А)), и в качестве отрицательного контроля клетки CHO-S трансфицировали несплайсируемыми конструкциями, кодирующими секретируемое антитело IgGl (наложенная черная линия на (А)). Окрашивание, которое проводили для клеток,
30 трансфицированных конструкциями, кодирующими секретируемый и экспонированный на мембране IgGl, с применением различных цитозольных хвостов, представлено в виде закрашенной гистограммы; окрашивание клеток, трансфицированных конструкцией с применением трансмембранной области В7-1, содержащей цитозольный хвост В7-1, представлено в виде наложенной черной линии (В - N). Гистограммы использовали для
определения процента окрашенных клеток (О) и средней флуоресценции окрашивания (Q) конструкций на основе альтернативного сплайсинга и контроля. Титры секретируемого антитела определяли через 4 дня после трансфекции с применением прибора Octet (Р).
Фигура 17:
Профили окрашивания клеток CHO-S, трансфицированных конструкциями на основе альтернативного сплайсинга для экспонирования и секреции антитела IgGl с применением трансмембранной области М1М2 с различными цитозольными хвостами.
10 Анализ проводили через день после трансфекции. В качестве положительного контроля клетки трансфицировали конструкцией на основе альтернативного сплайсинга, кодирующей секретируемый и экспонированный на мембране IgGl с трансмембранной областью М1М2, содержащей цитозольный хвост М1М2 (заполненные гистограммы на (А)), и в качестве отрицательного контроля клетки CHO-S трансфицировали
15 несплайсируемыми конструкциями, кодирующими секретируемое антитело IgGl (наложенная черная линия на (А)). Окрашивание, которое проводили для клеток, трансфицированных конструкциями, кодирующими секретируемый и экспонированный на мембране IgGl, с применением трансмембранной области М1М2 с цитозольным хвостом В7-1, представлено в виде закрашенной гистограммы; окрашивание клеток,
20 трансфицированных конструкцией с применением транс мембранной области М1М2, включая цитозольный хвост М1М2, представлено в виде наложенной черной линии (В). Гистограммы использовали для определения процента окрашенных клеток (С) и средней флуоресценции окрашивания (Е) конструкций на основе альтернативного сплайсинга и контроля. Титры секретируемого антитела определяли через 4 дня после трансфекции с
25 применением прибора Octet (D).
Фигура 18: Варианты сборки трех субъединиц биспецифичного антитела BEAT.
Фигура 19: Пример точечной диаграммы, полученной после двойного окрашивания 30 легкой цепи (LC) каппа и Fc-фрагмента отобранного стабильного пула клеток. Потенциальные молекулы, обнаруженные на мембране клетки посредством окрашивания, представлены справа. Fc-фрагмент был обнаружен с применением специфичного антитела козы против Fc-гамма человека, конъюгированного с ФЭ.
Легкие цепи каппа обнаруживали с применением антитела мыши против LC каппа человека, меченного АФЦ.
Фигура 20: Корреляция между поверхностным окрашиванием и профилями секреции 5 стабильных пулов, трансфицированных векторами на основе альтернативного сплайсинга. Отложенный на графике процент Q6* и Q7* составляет 100%, что представляет собой полную продуцирующую популяцию клеток (за исключением Q8).
Фигура 21: Точечная диаграмма, полученная после поверхностного окрашивания 10 стабильного пула клеток перед сортировкой клеток. Для окрашивания использовали растворимые Мишень 1 и 2 с целью обнаружения связывающих сайтов, экспонированных на поверхности клеток. Потенциальные молекулы, обнаруженные на мембране клетки посредством окрашивания, показаны в соответствующих квадрантах.
15 Фигура 22: Корреляция между фракцией молекулы BEAT(r), обнаруженной в супернатантах подпитываемой культуры в период времени 14 дней, и фракцией клеток, экспонирующих фенотип BEAT(r) на поверхности клетки.
Фигура 23: Пример измеренного профиля поверхности Fc, полученного для выбранного 20 стабильного пула клеток, трансфицированных конструкциями на основе альтернативного сплайсинга. IgG, презентированные на мембране клетки, обнаруживали с применением специфичного антитела козы против Fc-гамма человека, конъюгированного с ФЭ. Данные о живых клетках наносили на точечную диаграмму с осями FSC (forward side scatter, прямое рассеивание) и SSC (side scatter, боковое 25 рассеивание) (gl в А), чтобы продемонстрировать распределение флуоресценции исследованных пулов на основе альтернативного сплайсинга (заполненные гистограммы, В). Окрашивание клона, секретирующего IgG, в котором отсутствовала конструкция на основе альтернативного сплайсинга, использовали в качестве отрицательного контроля и представляли в виде наложения (пунктирная линия).
Фигура 24: Корреляция между интенсивностью поверхностного окрашивания и уровнем экспрессии секретирующих клеток, проанализированных в течение периодического процесса культивирования: корреляция между поверхностной интенсивностью и титром IgG в день 1 культивирования серии с добавками (А) и
корреляция между поверхностной интенсивностью в день 1 и qP (удельной продуктивностью), измеренной в течение экспоненциальной фазы (день 1-3) (В)
Фигура 25: Интенсивность поверхностного окрашивания в день 1 позволяет 5 прогнозировать аккумулированный секретируемый IgG в день 7.
Фигура 26: Отбор высокопродуктивных клеток на основании экспонирования IgG на поверхности. Клетки, демонстрирующие "низкую", "среднюю" и "высокую" плотность IgG на мембране, отбирали посредством сортировки клеток методом проточной 10 цитометрии (А). Распределение поверхностной флуоресценции определяли через две недели после сортировки (В), и удельную продуктивность отсортированных клонов оценивали в серии, культивируемой с добавками (С).
Подробное описание изобретения
15 В настоящем изобретении предложены экспрессирующие конструкции и способы для экспрессии полипептидов, в особенности, гетеромультимерных полипептидов, на мембране клетки. В частности, белок, представляющий интерес, может представлять собой рекомбинантные антитела или фрагменты рекомбинантных антител или биспецифичные антитела, в клетках-хозяевах с применением альтернативного
20 сплайсинга. Уровень экспонирования на мембране клетки свидетельствует об уровне секреции полипептида в рекомбинантных клетках-хозяевах, а в случае гетеродимерных антител, экспонированных на мембране клетки, также свидетельствует о профиле секреции, т.е. экспрессии гетеродимера или гомодимера.
25 Термины "экспрессирующая конструкция" или "конструкция", которые используются в настоящей заявке взаимозаменяемо, включают полинуклеотидную последовательность, кодирующую полипептид, который будет экспрессирован, и последовательность, контролирующую экспрессию указанной последовательности, такую как последовательность промотора и необязательно энхансера, включая любую комбинацию
30 действующих в цис-положении контрольных элементов транскрипции. Последовательность, контролирующую экспрессию гена, т.е. транскрипцию гена и трансляцию продукта транскрипции, обычно называют регуляторной единицей. Большинство частей регуляторной единицы расположены "выше по течению" от кодирующей последовательности гена и функционально связаны с последней.
Экспрессирующая конструкция, расположенная "ниже по течению", может также содержать З'-нетранслируемую область, содержащую поли(А)-сайт.
Регуляторная единица согласно настоящему изобретению функционально связана с 5 геном, который будет экспрессирован, т.е. с единицей транскрипции, или отделена от гена промежуточной ДНК, такой как, например, 5'-нетранслируемая область (5'UTR) гетерологичного гена. Предпочтительно экспрессирующая конструкция фланкирована одним или более подходящими сайтами рестрикции для обеспечения возможности встраивания экспрессирующей конструкции в вектор и/или вырезания экспрессирующей 10 конструкции из вектора. Таким образом, экспрессирующую конструкцию согласно настоящему изобретению можно использовать для конструирования вектора экспрессии, в частности, вектора экспрессии млекопитающего.
Термин "полинуклеотидная последовательность, кодирующая полипептид", в 15 настоящей заявке включает ДНК, кодирующую ген, предпочтительно, гетерологичный ген, экспрессирующий полипептид.
Термины "гетерологичная кодирующая последовательность", "гетерологичная последовательность гена", "гетерологичный ген", "рекомбинантный ген" или "ген"
20 используются взаимозаменяемо. Данные термины означают последовательность ДНК, кодирующую рекомбинантный полипептид, в частности, искомый рекомбинантный гетерологичный белковый продукт, который будет экспрессирован в клетке-хозяине, предпочтительно, в клетке млекопитающего, и собран для последующего применения. Продукт гена может представлять собой полипептид, гликопептид или
25 липогликопептиды. Гетерологичная последовательность гена может не присутствовать в клетке-хозяине в природе и может быть получена из организма того же или другого вида, а также может являться генетически модифицированной. В качестве альтернативы, гетерологичная последовательность гена присутствует в клетке-хозяине в природе.
30 Термины "белок" и "полипептид" используются взаимозаменяемо и включают совокупность остатков аминокислот, соединенных друг с другом пептидными связями, образованными между альфа-аминогруппой и карбоксильной группой соседних остатков.
Термин "промотор" в настоящей заявке означает регуляторную последовательность ДНК, которая, как правило, расположена "выше по течению" от гена и которая опосредует инициацию транскрипции посредством направления РНК-полимеразы к связыванию с ДНК и инициации синтеза РНК. Промоторы для применения в настоящем 5 изобретении включают, например, промоторы вирусов, млекопитающих, насекомых и дрожжей, которые обеспечивают высокие уровни экспрессии, например, промотор цитомегаловируса млекопитающих или CMV, промотор SV40 или любой промотор, известный в данной области техники, подходящий для экспрессии в эукариотических клетках. Промоторы, в особенности подходящие для применения в экспрессирующей
10 конструкции согласно настоящему изобретению, можно выбрать из перечня, включающего: промотор SV40, промотор tk человека, промотор MPSV, CMV мыши, CMV человека, CMV крысы, EF1 альфа человека, EF1 альфа китайского хомячка, GAPDH человека, гибридные промоторы, включая промотор MYC, HYK и СХ, синтетические промоторы на основе реаранжировки сайтов связывания фактора
15 транскрипции. В особенности предпочтительным промотором согласно настоящему изобретению является промотор CMV мыши.
Термин "5'-нетранслируемая область (5'UTR)" относится к нетранслируемому участку на 5'-конце пре-мРНК или зрелой мРНК. На зрелой мРНК 5'UTR, как правило, несет на 20 своем 5'-конце "кэп" 7-метилгуанозина и участвует во многих процессах, таких как сплайсинг, полиаденилирование, экспорт мРНК в цитоплазму, идентификация 5'-конца аппаратом трансляции мРНК и защита мРНК от деградации (Cowling VH (2010) Biochem J, 425: 295-302).
25 Термин "интрон" означает участок некодирующей последовательности нуклеиновой кислоты, который транскрибируется и присутствует в пре-мРНК, но вырезается аппаратом сплайсинга на основании последовательностей донорного сайта сплайсинга и акцепторного сайта сплайсинга, соответственно, на 5'- и З'-концах интрона, и вследствие этого не присутствует в транскрипте зрелой мРНК.
Как правило, интроны содержат внутренний сайт, называемый точкой разветвления, расположенный на 20 - 50 нуклеотидов "выше по течению" от 3'-сайта сплайсинга. Длина интрона, используемого в настоящем изобретении, может составлять от 50 до 10000 нуклеотидов. Более короткий интрон может содержать 50 или более нуклеотидов.
Полноразмерный интрон может содержать более 10000 нуклеотидов. Интроны, подходящие для применения в экспрессирующей конструкции согласно настоящему изобретению, можно выбрать из перечня, включающего: синтетические или искусственные интроны; или существующие в природе интроны, такие как химерный 5 интрон Р-глобина/IgG, интрон Р-глобина, интрон IgG, первый интрон CMV мыши, первый интрон CMV крысы, первый интрон CMV человека, интрон вариабельной области Ig и акцепторного сайта сплайсинга (Bothwell et al., (1981) Cell, 24: 625-637; US5,024,939), интроны гена TNT курицы и первый интрон EF1 альфа или модифицированные варианты указанных интронов.
Интрон, используемый в настоящем изобретении, может содержать акцепторные и донорные сайты сплайсинга из различных интронов, например, интрон может содержать донорный сайт сплайсинга из интрона IgG человека, например, донорный сайт сплайсинга гена ighg], и акцепторный сайт сплайсинга из интрона 4 cTNT курицы.
Согласно предпочтительному варианту реализации настоящего изобретения интрон содержит донорный сайт сплайсинга из интрона IgG человека и акцепторный сайт сплайсинга из интрона 4 cTNT курицы. Более предпочтительными являются интроны, содержащие донорный сайт сплайсинга из интрона IgG человека и акцепторный сайт 20 сплайсинга, который выбран из группы, включающей интрон 4 TNT курицы (SEQ Ш NO: 69) и конструкции, полученные из интрона 4 TNT курицы (SEQ ID NO: 70-78).
Термин "экзон" означает участок последовательности нуклеиновой кислоты, который транскрибируется в мРНК и сохраняется в зрелой мРНК после сплайсинга.
Термин "сайт сплайсинга" означает специфичные последовательности нуклеиновой кислоты, способные распознаваться аппаратом сплайсинга эукариотической клетки как подходящие для вырезания и/или лигирования с соответствующим сайтом сплайсинга. Сайты сплайсинга позволяют проводить вырезание интронов, присутствующих в 30 транскрипте пре-мРНК. Как правило, 5'-участок сайта сплайсинга называют донорным сайтом сплайсинга, а соответствующий 3'-конец сайта сплайсинга называют акцепторным сайтом сплайсинга. Термин "сайт сплайсинга" включает, например, существующие в природе сайты сплайсинга, сконструированные сайты сплайсинга, например, синтетические сайты сплайсинга, канонические или консенсусные сайты
сплайсинга и/или неканонические сайты сплайсинга, например, скрытые сайты сплайсинга. Донорные или акцепторные сайты сплайсинга, подходящие для применения в экспрессирующей конструкции согласно настоящему изобретению, можно выбрать из перечня, включающего: донор и акцептор сплайсинга химерного интрона Р-глобина/IgG, 5 донор и акцептор сплайсинга интрона Р-глобина, донор и акцептор сплайсинга интрона IgG, донор и акцептор сплайсинга первого интрона мыши CMV, донор и акцептор сплайсинга первого интрона крысы CMV, донор и акцептор сплайсинга первого интрона человека CMV, донор и акцептор сплайсинга интрона вариабельной области Ig и последовательность акцептора сплайсинга (Bothwell et al., (1981) Cell, 24: 625-637;
10 US5,024,939), донор и акцептор сплайсинга интронов гена TNT курицы и донор и акцептор сплайсинга первого интрона гена EF1 альфа или слитые конструкции указанных белков. Согласно предпочтительному варианту реализации настоящего изобретения донорный сайт сплайсинга получен из интрона IgG человека, и акцепторный сайт сплайсинга выбран из группы, включающей интрон 4 TNT курицы
15 (SEQ Ш N0: 69) и конструкции, полученные из интрона 4 TNT курицы (SEQ Ш N0: 7078).
Термин "консенсусная последовательность области донора сплайсинга" в настоящей заявке означает последовательность (С/A) AGGUT A/G) AGU (подчеркнутые
20 последовательности являются частью интрона) SEQ Ш NO: 345, как описано в книге "Molecular Biology of the Cell" (Alberts et al., Garland Publishing, New York 1995). Термин "консенсусная последовательность области акцептора сплайсинга" в настоящей заявке означает последовательность CTRAYY- - - поли(У)-участок- - - NCAGG (подчеркнутые последовательности являются частью интрона; курсив: области точки
25 разветвления) SEQ Ш NO: 346, как описано в книге "Molecular Biology of the Cell" (Alberts et al., Garland Science, New York 2002).
Термин "стоп-кодон" означает любой из трех стоп-кодонов, которые являются сигналами окончания синтеза белка (ТАА (РНК: UAA), TAG (РНК: UAG) и TGA (РНК: 30 UGA). Во избежание неполной эффективности терминации или "утечки" стоп-кодона в качестве сигнала терминации синтеза белка можно использовать 2, 3 или несколько стоп-кодонов.
Термин "трансмембранная область" означает полипептид или белок, который кодируется последовательностью нуклеиновой кислоты и который содержит необязательную внеклеточную часть, трансмембранный домен и необязательный цитозольный хвост. Трансмембранный домен представляет собой любую трехмерную 5 белковую структуру, которая является термодинамически стабильной в мембране и обычно содержит одну трансмембранную альфа-спираль трансмембранного белка, преимущественно состоящую из гидрофобных аминокислот. Длина трансмембранного домена составляет, в среднем, 21 аминокислоту, но может варьировать от 4 до 48 аминокислот (Baeza-Delgado et al., 2012). Трансмембранная область содержит
10 необязательное N-концевое внеклеточное соединительное удлинение аминокислот и трансмембранный домен. Согласно некоторым вариантам реализации настоящего изобретения трансмембранная область может дополнительно содержать С-концевое цитоплазматическое удлинение аминокислот или внутриклеточный домен. Трансмембранная область, обнаруженная, например, в гене ighgl человека, содержит
15 соединительное удлинение аминокислот, за которым следуют два домена Ml и М2 (данную трансмембранную область называют трансмембранной областью "М1М2" или "IgGl"). Трансмембранные области для применения в настоящем изобретении включают, но не ограничены указанными, трансмембранную область гена рецептора фактора роста тромбоцитов человека (platelet-derived growth factor receptor, PDGFR)
20 (запись в Swissprot P16234), асиалогликопротеинового рецептора человека (запись в Swissprot Р07306), В7-1 человека и мыши (человека: запись в Swissprot Р33681 и мыши: запись в Swissprot Q00609), ICAM-1 человека (запись в SwissprotР05362), erbbl человека (запись в Swissprot Р00533), erbb2 человека (запись в Swissprot Р04626), егЬЬЗ человека (запись в Swissprot Р21860), erbb4 человека (запись в Swissprot Q15303), рецепторов
25 фактора роста фибробластов человека, таких как FGFR1 (запись в Swissprot PI 1362), FGFR2 (запись в Swissprot Р21802), FGFR3 (запись в Swissprot Р22607), FGFR4 (запись в Swissprot Р22455), VEGFR-1 человека (запись в Swissprot Р17948), VEGFR-2 человека (запись в Swissprot Р35968), рецептора эритропоэтина человека (запись в Swissprot Р19235), PRL-R человека, рецептора пролактина (запись в Swissprot Р16471), EphAl
30 человека, рецептора 1 эфрина типа А (запись в Swissprot Р21709), инсулина человека (запись в Swissprot Р06213), рецептора инсулиноподобного фактора роста (IGFR1, запись в Swissprot Р08069, SEQ Ш NO: 181), рецептороподобных тирозинфосфатаз белков человека (записи в Swissprot Q12913, Р23471, Р23467, Р18433, Р23470, Р23469, Р23468), нейропилина человека (запись в Swissprot Р014786), главного комплекса
гистосовместимости класса II человека (цепи альфа и бета), интегринов человека (семейства альфа и бета), синдеканов человека, белка миелина человека, кадгеринов человека, синаптобревина-2 человека (запись в Swissprot Р63027), гликофорина-А человека (GpA, запись в Swissprot Р02724, SEQ Ш NO: 185), Bnip3 человека (запись в 5 Swissprot Q12983), АРР человека (запись в Swissprot Р05067), белка-предшественника амилоида (запись в Swissprot P0DJI8), гена рецептора Т-клеток альфа (PTCRA, запись в Swissprot PQ6ISU1, SEQ Ш NO: 186) и рецептора Т-клеток бета человека, CD3 гамма (запись в Swissprot Р09693), CD3 дельта (запись в Swissprot Р04234), CD3 дзета (запись в Swissprot Р20963) и CD3 эпсилон (CD3E, запись в Swissprot Р07766, SEQ Ш NO: 197),
10 рецептора R3 сериновой/треониновой протеинкиназы человека (ACVL1, запись в Swissprot Р37023, SEQ Ш NO: 174), рецептора сибиреязвенного токсина 2 человека (ANTR2, запись в Swissprot Р58335, SEQ Ш NO: 175), поверхностного гликопротеина CD4 Т-клеток человека (CD4, запись в Swissprot Р01730, SEQ Ш NO: 176), фосфатазы белка тирозина типа рецептора mu человека (PTPRM, запись в Swissprot Р28827, SEQ Ш
15 NO: 177), члена 5 суперсемейства рецептора фактора некроза опухоли человека (TNR5, запись в Swissprot Р25942, SEQ Ш NO: 178), интегрина бета-1 человека (ITB1, запись в Swissprot Р05556, SEQ Ш NO: 179), антигена гистосовместимости HLA класса I человека, альфа-цепи В-7 (запись в Swissprot Р01889, SEQ Ш NO: 180), тромбомодулина человека (TRBM, запись в Swissprot Р07204, SEQ Ш NO: 182), альфа-субъединицы
20 рецептора интерлейкина-4 человека (IL4RA, запись в Swissprot Р24394, SEQ Ш NO: 183), белка человека, родственного рецептору липопротеинов низкой плотности 6 (LRP6, запись в Swissprot 075581, SEQ Ш NO: 184), альфа-субъединицы высокоаффинного рецептора иммуноглобулина эпсилон человека (FCERA, запись в Swissprot Р12319, SEQ Ш NO: 194), иммуноглобулиноподобного рецептора 2DL2 клеток-киллеров человека
25 (KI2L2, запись в Swissprot Р43627, SEQ Ш NO: 195), общей субъединицы бета цитокинового рецептора человека (IL3RB, запись в Swissprot Р32927, SEQ Ш NO: 196), интегрина альфа-IIb человека (ITA2B, запись в Swissprot Р08514, SEQ Ш NO: 198), Т-клетка-специфичного поверхностного гликопротеина человека CD28 (CD28, запись в Swissprot Р10747, SEQ Ш NO: 199).
Согласно предпочтительному варианту реализации настоящего изобретения трансмембранную область, используемую в настоящем изобретении, выбирают из группы, включающей трансмембранную область В7-1 человека, трансмембранную область В7-1 мыши, трансмембранную область PDGFR, трансмембранную область
асиалогликопротеинового рецептора человека и трансмембранную область erbb-2. Более предпочтительной является трансмембранная область В7-1 мыши, наиболее предпочтительной является трансмембранная область В7-1 мыши, представленная в SEQ IDNO: 66.
Трансмембранная область иммуноглобулина включает трансмембранную область генов иммуноглобулина человека IGHA1 (код доступа NCBI: М60193), IGHA2 (код доступа NCBI: М60194), IGHD (код доступа NCBI: К02881), IGHE (код доступа NCBI: Х63693), IGHG1 (код доступа NCBI: Х52847), IGHG2 (код доступа NCBI: АВ006775), IGHG3 (код
10 доступа NCBI: D78345), IGHG4 (код доступа NCBI: AL928742), IGHGP (код доступа NCBI: Х52849), IGHM (код доступа NCBI: XI4940), а также трансмембранные области генов иммуноглобулина IGHA1 мыши (код доступа NCBLK00691), IGHD (код доступа NCBI: J00450), IGHE (код доступа NCBI: Х03624, U08933), IGHG1 (код доступа NCBLJ00454, J00455), IGHG2A (код доступа NCBI: J00471), IGHG2B (код доступа NCBI:
15 J00462, D78344), IGHG3 (код доступа NCBI: Х00915, V01526), IGHM (код доступа NCBI: J00444).
Согласно одному варианту реализации настоящего изобретения используемая трансмембранная область представляет собой трансмембранную область, отличную от
20 трансмембранной области иммуноглобулина, которая не содержит трансмембранных областей, кодируемых генами иммуноглобулина, в частности, трансмембранную область, отличную от трансмембранной области иммуноглобулина, которая не содержит транс мембранных областей, кодируемых генами иммуноглобулина человека IGHA1 (код доступа NCBI: М60193), IGHA2 (код доступа NCBI: М60194), IGHD (код доступа
25 NCBI: К02881), IGHE (код доступа NCBI: Х63693), IGHG1 (код доступа NCBI: Х52847), IGHG2 (код доступа NCBI: АВ006775), IGHG3 (код доступа NCBI: D78345), IGHG4 (код доступа NCBI: AL928742), IGHGP (код доступа NCBI: Х52849), IGHM (код доступа NCBI: Х14940), и не содержит трансмембранных областей, кодирующих гены иммуноглобулина мыши IGHA1 (код доступа NCBLK00691), IGHD (код доступа NCBI:
30 J00450), IGHE (код доступа NCBI: Х03624, U08933), IGHG1 (код доступа NCBLJ00454, J00455), IGHG2A (код доступа NCBI: J00471), IGHG2B (код доступа NCBI: J00462, D78344), IGHG3 (код доступа NCBI: Х00915, V01526), IGHM (код доступа NCBI: J00444).
Термин "поли(У)-участок" означает протяженность нуклеиновых кислот, обнаруженную между точкой разветвления интрона и границей интрон-экзон. Данная протяженность нуклеиновых кислот содержит избыток пиримидинов (Y), означающий избыток пиримидиновых оснований С или Т.
Термин "З'-нетранслируемая область (3'UTR)" означает нетранслируемый участок на 3'-конце пре-мРНК или зрелой мРНК. На зрелой мРНК данная область несет поли(А)-хвост и, как известно, играет множество ролей в стабилизации мРНК, инициации трансляции и экспорте мРНК (Лa J et al, (2013) Curr Opin Genet Dev, 23(1): 29-34).
Термин "энхансер" в настоящей заявке означает нуклеотидную последовательность, действие которой направлено на потенцирование транскрипции генов вне зависимости от характеристик гена, положения последовательности относительно гена или ориентации последовательности. Векторы согласно настоящему изобретению 15 необязательно содержат энхансеры.
Термин "сигнал полиаденилирования" или "поли(А)-сигнал", или "поли(А)", или "поли(А)-сайт" означает последовательность нуклеиновой кислоты, присутствующую в транскриптах мРНК, которая в присутствии поли(А)-полимеразы позволяет
20 осуществлять полиаденилирование транскриптов в сайте полиаденилирования, расположенном на 10-30 оснований "ниже по течению" от поли(А)-сигнала. В данной области техники известно множество поли(А)-сигналов, которые могут быть пригодными в настоящем изобретении. Примеры включают вариант поли(А)-сигнала гормона роста человека, поздний поли(А)-сигнал SV40 и поли(А)-сигнал гормона роста
25 крупного рогатого скота.
Термины "функционально связанный" и "операционно связанный" используются взаимозаменяемо и означают функциональную связь между двумя или более участками ДНК, в частности, последовательностями гена, который будет экспрессирован, и 30 последовательностями, контролирующими экспрессию указанных последовательностей. Например, последовательность промотора и/или энхансера, включая любую комбинацию действующих в цис-положении контрольных элементов транскрипции, функционально связана с кодирующей последовательностью, если указанная последовательность стимулирует или модулирует транскрипцию кодирующей
последовательности в соответствующей клетке-хозяине или в другой экспрессионной системе. Регуляторные последовательности промотора, которые функционально связаны с транскрибируемой последовательностью гена, являются физически прилежащими к транскрибируемой последовательности.
"Ориентация" означает порядок нуклеотидов в данной последовательности ДНК. Например, ориентация последовательности ДНК в обратном направлении относительно другой последовательности ДНК является таковой, в которой 5' - 3' направление последовательности относительно другой последовательности является обратным по 10 сравнению с исходной точкой в ДНК, из которой была получена последовательность. Такие исходные точки могут включать направление транскрипции других специфичных последовательностей ДНК в исходной ДНК и/или точку начала репликации реплицируемых векторов, содержащих последовательность.
15 Термин "гомология последовательности нуклеиновой кислоты" или "гомология нуклеотидной последовательности" в настоящей заявке включает процент нуклеотидов в последовательности-кандидате, которые являются идентичными последовательности нуклеотидов в последовательности сравнения после выравнивания последовательностей и, при необходимости, введения разрывов для достижения максимального процента
20 идентичности последовательности. Таким образом, идентичность последовательности можно определить стандартными способами, которые общепринято используют для сравнения подобия положения нуклеотидов двух нуклеотидных последовательностей.
Термин "вектор экспрессии" в настоящей заявке включает выделенную и очищенную 25 молекулу ДНК, которая после трансфекции в соответствующую клетку-хозяин обеспечивает соответствующий уровень экспрессии рекомбинантного продукта гена в клетке-хозяине. Помимо последовательности ДНК, кодирующей рекомбинантный продукт или продукт гена, вектор экспрессии содержит регуляторные последовательности ДНК, необходимые для эффективной транскрипции кодирующей 30 последовательности ДНК в мРНК и для эффективной трансляции мРНК в белки в клеточной линии-хозяине.
Термины "клетка-хозяин" или "клеточная линия-хозяин" в настоящей заявке включают любые клетки, в частности, клетки млекопитающих, способные расти в культуре и экспрессировать желаемый рекомбинантный продукт - белок.
5 Рекомбинантные полипептиды и белки можно продуцировать в различных экспрессирующих системах, таких как прокариотические (например, Е. coli), эукариотические системы (например, на основе дрожжей, насекомых, позвоночных, млекопитающих) и экспрессирующие системы in vitro. Наиболее широко используемые способы крупномасштабной продукции белковых биологических препаратов основаны
10 на введении генетического материала в клетки-хозяева посредством трансфекции векторами ДНК. Временной экспрессии полипептидов можно достичь благодаря временной трансфекции клеток-хозяев. Встраивание ДНК вектора в геном клетки-хозяина приводит к получению клеточной линии, которая является стабильно трансфицированной, и размножение такой стабильной клеточной линии можно
15 использовать для крупномасштабной продукции полипептидов и белков.
Способы продукции нескольких полипептидов в эукариотической клетке посредством альтернативного сплайсинга описаны в международной заявке WO2005/089285. Две различные экспрессионные кассеты находятся под контролем одного промотора, причем 20 экспрессионные кассеты содержат сайты сплайсинга, которые позволяют проводить альтернативный сплайсинг и экспрессию указанных экспрессионных кассет в виде двух или более независимых продуктов гена в желаемом соотношении.
Однако авторы настоящего изобретения обнаружили, что данный подход является 25 ограниченным в случае экспрессии растворимого варианта полипептида и варианта, связанного с плазматической мембраной, поскольку будут продуцироваться два полностью независимых белка и, следовательно, вариант, связанный с плазматической мембраной, не будет представлять желаемое качество продукта растворимого варианта полипептида.
Способы отбора эукариотических клеток, экспрессирующих гетерологичный белок, а также экспрессия растворимого варианта полипептида и варианта, связанного с плазматической мембраной, из альтернативно сплайсируемой нуклеиновой кислоты описаны в международной заявке WO2007/131774. Вариант, который связан с
плазматической мембраной и присоединен к клетке, экспрессирующей указанный вариант, можно использовать в качестве маркера для выделения успешно трансфицированных клеток.
5 Однако авторы настоящего изобретения обнаружили, что данный подход является ограниченным, поскольку способы контроля соотношения экспрессии растворимого полипептида и полипептида, экспонированного на мембране, отсутствуют. Альтернативный сплайсинг, как отмечено выше, представляет собой процесс, посредством которого могут быть экспрессированы различные варианты полипептида, 10 но, поскольку механизмы альтернативного сплайсинга являются в высшей степени вариабельными и не предполагают какой-либо возможности контролировать соотношение сплайсинга, количества экспрессируемых вариантов полипептида будут варьировать.
15 Вследствие этого система клеточной экспрессии, посредством которой часть экспрессируемого полипептида перенаправляется для экспрессии на мембране клетки, будет характеризоваться уменьшенными титрами растворимого полипептида. Несмотря на то, что экспрессия полипептидов на мембране клетки является ценным маркером для выделения высокоэкспрессирующих клонов, при отсутствии какой-либо формы
20 контроля количества полипептида, экспрессированного на мембране клетки, титры растворимого полипептида могут значительно уменьшиться. Более того, невозможно найти два полипептида, экспрессируемые на одинаковом уровне в одинаковых условиях культивирования; вследствие этого маловероятно, что способ, разработанный для экспрессии одного полипептида в растворимой форме и в форме, экспонированной на
25 мембране клетки, будет подходящим для всех полипептидов.
В отличие от подходов на основе альтернативного сплайсинга, описанных ранее, авторы настоящего изобретения разработали подход на основе альтернативного сплайсинга для экспрессии как растворимого, так и экспонированного на мембране клетки полипептида, 30 в котором компоненты экспрессирующей конструкции можно модифицировать для оптимизации количества экспрессируемого растворимого полипептида, и при этом обеспечивать экспрессию полипептида на мембране клетки в количестве, достаточном для проведения отбора клонов клеток.
В иллюстративной экспрессирующей конструкции согласно настоящему изобретению для экспрессии тяжелой цепи антитела константная область тяжелой цепи IgGl содержит слабый донор сплайсинга "выше по течению" от стоп-кодона, завершающего открытую рамку считывания секретируемой тяжелой цепи. Акцепторный сайт 5 сплайсинга и последовательность ДНК, кодирующая трансмембранную область, за которой следуют стоп-код он и поли(А)-сайт, расположены с 3' -конца от стоп-кодона, в результате чего после сплайсинга трансмембранная область находится в рамке с открытой рамкой считывания тяжелой цепи IgGl. Полученные в результате альтернативные открытые рамки считывания завершаются стоп-кодоном и поли(А)-10 сайтом, соответственно. Авторы настоящего изобретения обнаружили, что посредством модификации данной экспрессирующей конструкции можно изменять соотношение сплайсинга и, вследствие этого, количество растворимого полипептида по сравнению с полипептидом, экспонированным на мембране.
15 Данные модификации могут включать, например, применение гетерологичной трансмембранной области. Существующие в природе трансмембранные области IgGl содержат соединительное удлинение аминокислот и домены Ml и М2. Посредством замены трансмембранной области IgGl трансмембранной областью, которая представляет собой трансмембранную область, отличную от трансмембранной области
20 иммуноглобулина, например, посредством замены трансмембранной областью В7-1 мыши, количество экспонированного на мембране полипептида можно увеличить. Как представлено на фигуре 2 примера 2, практически 40% временно трансфицированных клеток были положительными в отношении экспонированного на мембране IgGl, что представляет собой значительное увеличение относительно процента клеток,
25 трансфицированных конструкцией, содержащей трансмембранную область IgGl (до 20%). Данный результат является неожиданным, поскольку, как можно было ожидать, применение природной трансмембранной области IgGl, а не гетерологичной трансмембранной области, должно было являться наиболее эффективным для экспонирования IgGl на мембране клетки. Предпочтительно, трансмембранная область,
30 применяемая в экспрессирующей конструкции согласно настоящему изобретению, содержит трансмембранную область, которая выбрана из группы, включающей трансмембранную область гена рецептора фактора роста тромбоцитов человека (PDGFR), асиалогликопротеинового рецептора человека, В7-1 человека и мыши, ICAM-1 человека, erbbl человека, erbb2 человека, егЬЬЗ человека, erbb4 человека, рецепторов
фактора роста фибробластов человека, таких как FGFR1, FGFR2, FGFR3, FGFR4, VEGFR-1 человека, VEGFR-2 человека, рецептора эритропоэтина человека, PRL-R человека, рецептора пролактина, EphAl человека, рецептора 1 эфрина типа А, инсулина человека, рецепторов IGF-1, рецептороподобных тирозинфосфатаз белков человека, 5 нейропилина человека, главного комплекса гистосовместимости класса II человека (альфа и бета цепи), интегринов человека (семейства альфа и бета), синдеканов человека, белка миелина человека, кадгеринов человека, синаптобревина-2 человека, гликофорина-А человека, Bnip3 человека, АРР человека, белка-предшественника амилоида, рецептора Т-клеток альфа (PTCRA) и рецептора Т-клеток бета человека, CD3
10 гамма, CD3 дельта, CD3 дзета и CD3 эпсилон. Согласно предпочтительному варианту реализации настоящего изобретения трансмембранная область, используемая в настоящем изобретении, выбрана из группы, включающей трансмембранную область В7-1 человека, трансмембранную область В7-1 мыши, трансмембранную область PDGFR, трансмембранную область асиалогликопротеинового рецептора человека и
15 трансмембранную область erbb-2. Более предпочтительной является трансмембранная область В7-1 мыши, наиболее предпочтительной является трансмембранная область В7-1 мыши, представленная в SEQ Ш N0: 66.
Дополнительные модификации для изменения соотношения сплайсинга количества 20 секретируемого полипептида по сравнению с полипептидом, экспонированным на мембране, включают изменение количества пиримидиновых оснований в полипиримидиновом (поли(У)) участке "выше по течению" от экзона, кодирующего трансмембранную область, и/или модификацию консенсусных последовательностей донора и акцептора сплайсинга. Уменьшение количества пиримидиновых оснований 25 (У), как было продемонстрировано в примере 3, вызывает смещение соотношения сплайсинга в сторону секретируемого белка. Если в конструкцию не включены пиримидиновые основания, поверхностная экспрессия белка, представляющего интерес, отсутствует. Такой механизм для смещения соотношения сплайсинга от экспрессии на мембране клетки может быть полезным для белка, который экспрессируется строго на 30 мембране клетки, но демонстрирует более слабую экспрессию растворимой формы. Количество пиримидиновых оснований в поли(У)-участке может составлять от 0 до 30 оснований. Предпочтительно, поли(У)-участок содержит 20 пиримидиновых оснований или менее, более предпочтительно, 15 оснований или менее, еще более предпочтительно, 10 оснований или менее.
Поскольку увеличение количества экспонированного на мембране белка может оказывать отрицательное влияние на титры растворимого полипептида, авторы настоящего изобретения разработали модификации в экспрессирующей конструкции, 5 способные увеличить экспрессию растворимого полипептида в клетке-хозяине без влияния на количество экспонированного на мембране полипептида. Было обнаружено, что добавление поли(А)-сайта в интрон увеличивает титр растворимого полипептида максимум на 50 % (для транс мембранной области М1М2), и при этом поддерживает достаточный уровень экспонирования на мембране клетки. Согласно следующему 10 варианту реализации настоящего изобретения поли(А)-сайт расположен в интроне экспрессирующей конструкции.
Согласно аспекту настоящего изобретения экспрессирующая конструкция является подходящей для мультимеров полипептидов и белков, например, антител или 15 фрагментов антител, либо биспецифичных антител или фрагментов биспецифичных антител.
Термин "антитело" в настоящей заявке включает целые антитела и любые антиген-связывающие фрагменты или отдельные цепи антител. "Антитело" означает
20 гликопротеин, содержащий по меньшей мере две тяжелые (Н) цепи и две легкие (L) цепи, связанные дисульфидными связями, или антиген-связывающий фрагмент указанного гликопротеина. Каждая тяжелая цепь содержит вариабельную область тяжелой цепи (сокращенно обозначаемую в настоящей заявке VH) и константную область тяжелой цепи. Константная область тяжелой цепи состоит из трех доменов, CHI, СН2 и СНЗ.
25 Каждая легкая цепь содержит вариабельную область легкой цепи (сокращенно обозначаемую в настоящей заявке VL) и константную область легкой цепи. Константная область легкой цепи состоит из одного домена, CL. Области VH и VL можно далее разделить на области гипервариабельности, называемые областями, определяющими комплементарность (complementarity determining regions, CDR), последовательность
30 которых является гипервариабельной и/или которые вовлечены в распознавание антигена и/или обычно образуют структурно определенные петли, разделенные областями, которые являются более консервативными, называемыми каркасными областями (framework regions, FR или FW). Каждая VH и VL содержит три CDR и четыре FW, расположенные от амино-конца к карбокси-концу в следующем порядке: FW1,
CDR1, FW2, CDR2, FW3, CDR3, FW4. В настоящей заявке аминокислотные последовательности FW1, FW2, FW3 и FW4 все вместе образуют "область, отличную от CDR", или "область, отличную от протяженной CDR", VH или VL.
5 Вариабельные области тяжелой и легкой цепей содержат связывающий домен, который взаимодействует с антигеном. Константные области антитела могут опосредовать связывание иммуноглобулина с тканями или факторами хозяина, включая различные клетки иммунной системы (например, эффекторные клетки) и первый компонент (Clq) классической системы комплемента.
Антитела разделяют на классы, также называемые изотипами, которые определяются генетическим образом константной областью. Константные области легких цепей человека подразделяют на легкие цепи каппа (Ск) и лямбда (СХ). Тяжелые цепи, которые подразделяют на мю (и), дельта (8), гамма (у), альфа (а) ИЛИ ЭПСИЛОН (S), определяют 15 ИЗОТИП антитела как IgM, IgD, IgG, IgA и IgE, соответственно. В терапевтических целях наиболее широко используют класс IgG. У людей данный класс содержит подклассы IgGl, IgG2, IgG3 и IgG4.
Термин "Fab" или "область Fab" в настоящей заявке включает полипептиды, которые 20 содержат домены иммуноглобулина VH, CHI, VL и CL. Fab может означать данную область саму по себе или данную область в контексте полноразмерного антитела либо фрагмента антитела.
Термин "Fc" или "Fc-область" в настоящей заявке включает полипептид, содержащий 25 константную область антитела, за исключением первого домена константной области иммуноглобулина. Таким образом, Fc означает последние два домена константной области иммуноглобулина IgA, IgD и IgG и последние три домена константной области иммуноглобулина IgE и IgM, а также подвижный шарнир, расположенный с N-конца относительно данных доменов. В случае IgA и IgM Fc может содержать цепь J. В случае 30 IgG Fc содержит домены иммуноглобулина С гамма 2 и С гамма 3 (Су2 и СуЗ) и шарнир между С гамма 1 (Cyl) и С гамма 2 (Су2). Несмотря на то, что границы Fc-области могут варьировать, Fc-область тяжелой цепи IgG человека обычно определяют в промежутке от остатка С226 или Р230 до карбоксильного конца, где нумерация приведена в соответствии с системой нумерации EU. В случае IgGl человека Fc-области определены
в настоящей заявке в промежутке от остатка Р232 до карбоксильного конца, где нумерация приведена в соответствии с системой нумерации EU (Edelman GM et al, (1969) Proc Natl Acad Sci США, 63(1): 78-85). Fc может означать данную область саму по себе или данную область в контексте Fc полипептида, например, антитела.
Термин "полноразмерное антитело" в настоящей заявке включает структуру, которая образует природную биологическую форму антитела, включая вариабельную и константную области. Например, у большинства млекопитающих, в том числе человека и мышей, полноразмерное антитело класса IgG представляет собой тетрамер и состоит
10 из двух идентичных пар двух цепей иммуноглобулина, причем каждая пара содержит одну легкую и одну тяжелую цепи, и каждая легкая цепь содержит домены иммуноглобулина VL и CL, а каждая тяжелая цепь содержит домены иммуноглобулина VH, CHI (CI), СН2 (С2) и СНЗ (СЗ). У некоторых млекопитающих, например, у верблюдов и лам, антитела IgG могут состоять лишь из двух тяжелых цепей, причем
15 каждая тяжелая цепь содержит вариабельный домен, присоединенный к Fc-области.
Фрагменты антитела включают, но не ограничены указанными, (i) Fab-фрагмент, содержащий домены VL, VH, CL и СН1, включая Fab' и Fab'-SH, (ii) Fd-фрагмент, содержащий домены VH и СН1, (ш) Fv-фрагмент, содержащий домены VL и VH
20 отдельного антитела; (iv) dAb-фрагмент (Ward ES et al, (1989) Nature, 341: 544-546), который содержит один вариабельный домен; (v) Р(аЬ')2-фрагменты, бивалентный фрагмент, содержащий два связанных Fab-фрагмента; (vi) одноцепочечные молекулы Fv (scFv), в которых домен VH и домен VL связаны пептидным линкером, позволяющим двум доменам объединяться с образованием антиген-связывающего сайта (Bird RE et al,
25 (1988) Science 242: 423-426; Huston JS et al, (1988) Proc. Natl. Acad. Sci. США, 85: 587983); (vii) биспецифичные одноцепочечные Fv-димеры (PCT/US92/09965); (viii) "диатела" или "триатела", мультивалентные или мультиспецифичные фрагменты, сконструированные в результате слияния генов (Tomlinson I & Hollinger Р (2000) Methods Enzymol. 326: 461-79; WO94/13804; Holliger P et al, (1993) Proc Natl Acad Sci USA, 90:
30 6444-48); и (ix) scFv, слитый генетическим способом с тем же или отличным антителом (Coloma MJ & Morrison SL (1997) Nature Biotech, 15(2): 159-163).
Антитела и фрагменты антител, которые можно экспрессировать посредством экспрессирующей конструкции, описанной в настоящей заявке, могут связываться с
антигеном, который выбран из группы, включающей: AXL, Вс12, HER2, HER3, EGF, EGFR, VEGF, VEGFR, IGFR, PD-1, PD-1L, BTLA, CTLA-4, GITR, mTOR, CS1, CD3, CD16, CD16a, CD19, CD20, CD22, CD25, CD27, CD28, CD30, CD32b, CD33, CD38, CD40, CD52, CD64, CD79, CD89, CD137, CD138, СА125, cMet, CCR6, MUCI, антиген РЕМ, Ep-5 CAM, EphA2, 17-la, CEA, AFP, HLA класса II, HLA-DR, HSG, IgE, ИЛ-12, ИЛ-17а, ИЛ-18, ИЛ-23, ИЛ-1 альфа, ИЛ-1 бета, ОБ2-ганглиозид, MCSP, NG2, антиген SK-I, Lag3, PAR2, PDGFR, PSMA, Tim3, TF, CTLA4, ТЫ A, TIGIT, SIRPa, ICOS, Treml2, NCR3, HVEM, OX40, VLA-2 и 4-1BB.
10 Биспецифичные или гетеродимерные антитела уже в течение многих лет являются доступными в данной области техники. Однако получение таких антител часто сопряжено с присутствием неправильно спаренных побочных продуктов, которые значительно уменьшают выход продукции желаемого биспецифичного антитела и требуют сложных процедур очистки для обеспечения гомогенности продукта.
15 Нарушение спаривания тяжелых цепей иммуноглобулина можно уменьшить посредством применения нескольких стратегий конструктивной разработки, в ходе большинства из которых конструируют тяжелые цепи антитела для гетеродимеризации посредством разработки созданных человеком комплементарных гетеродимерных поверхностей контакта между двумя субъединицами гомодимера домена СНЗ. Первое
20 сообщение о сконструированной паре гетеродимерного домена СНЗ было обнародовано Carter с соавт, которые описали подход "протуберанец-в-полость" ("protuberance-into-cavity") для получения гетеродимерной группы Fc (US5,807,706; "выступы-во-впадины" ("knobs-into-holes"); Merchant AM et al, (1998) Nat Biotechnol, 16(7):677-81). Недавно были разработаны альтернативные конструкции, которые включали конструирование
25 новой пары модулей СНЗ посредством модификации базовой структуры модулей, как описано в международной заявке WO2007110205, или конструирование комплементарных солевых мостиков между модулями, как описано в международных заявках WO2007147901 или WO2009089004. Недостаток стратегий конструирования СНЗ заключается в том, что данные методики все еще приводят к образованию
30 значительного количества нежелательных гомодимеров. Более предпочтительная методика получения биспецифичных антител, в которой получают преимущественно гетеродимеры, описана в публикации РСТ № WO2012/131555. Биспецифичные антитела можно наработать против множества мишеней, например, мишени, расположенной на опухолевых клетках, и/или мишени, расположенной на эффекторных клетках.
Предпочтительно, биспецифичное антитело может связываться с двумя мишенями, которые выбраны из группы, включающей: AXL, Вс12, HER2, HER3, EGF, EGFR, VEGF, VEGFR, IGFR, PD-1, PD-1L, BTLA, CTLA-4, GITR, mTOR, CS1, CD3, CD16, CD16a, CD19, CD20, CD22, CD25, CD27, CD28, CD30, CD32b, CD33, CD38, CD40, CD52, CD64, 5 CD79, CD89, CD137, CD138, СА125, cMet, CCR6, MUCI, антиген РЕМ, Ep-CAM, EphA2, 17-la, CEA, AFP, HLA класса II, HLA-DR, HSG, IgE, ИЛ-12, ИЛ-17а, ИЛ-18, ИЛ-23, ИЛ-1 альфа, ИЛ-1 бета, ОБ2-ганглиозид, MCSP, NG2, антиген SK-I, Lag3, PAR2, PDGFR, PSMA, Tim3, TF, CTLA4, ТЫ A, TIGIT, SIRPa, ICOS, Treml2, NCR3, HVEM, OX40, VLA-2и4-1ВВ.
Согласно следующему аспекту в настоящем изобретении предложена клетка-хозяин, содержащая экспрессирующую конструкцию или вектор экспрессии, описанные выше. Клетка-хозяин может представлять собой клетку человека или клетку, отличную от клетки человека. Обычно клетка-хозяин выбрана из группы, включающей клетку
15 млекопитающих, клетку насекомых и клетку дрожжей. Предпочтительные клетки-хозяева представляют собой клетки млекопитающих. Предпочтительные примеры клеток-хозяев млекопитающих включают, без ограничения, эмбриональные клетки почек человека (Graham FL et al., (1977) J. Gen. Virol. 36: 59-74), фибробласты MRC5 человека, клетки меланомы человека 983М, клетки почек собаки MDCK,
20 культивируемые фибробласты легких крысы RF, выделенные из крыс Спрэг-Доули, клетки меланомы мыши B16BL6, клетки мастоцитомы мыши Р815, клетки аденокарциномы молочной железы МТ1 А2 мыши, клетки PER:C6 (Leiden, Нидерланды) и клетки или клеточные линии яичников китайского хомячка (СНО) (Puck ТТ et al., (1958), J. Exp. Med. 108: 945-955).
25 Согласно в особенности предпочтительному варианту реализации настоящего изобретения клетка-хозяин представляет собой клетку или клеточную линию яичников китайского хомячка (СНО). Подходящие клеточные линии СНО включают, например, CHO-S (Invitrogen, Карлсбад, Калифорния, США), СНО Kl (АТСС CCL-61), СНО ргоЗ-, СНО DG44, СНО Р12 или клеточную линию СНО DUK-BII dhfr- (Urlaub G & Chasin LA
30 (1980) PNAS 77(7): 4216-4220), DUXBI1 (Simonsen CC & Levinson AD (1983) PNAS 80(9): 2495-2499) или CHO-K1SV (Lonza, Базель, Швейцария).
Согласно следующему аспекту в настоящем изобретении предложен способ отбора клетки-хозяина, экспрессирующей полипептид, представляющий интерес, причем
указанный способ включает трансфекцию клетки-хозяина экспрессирующей конструкцией или вектором экспрессии, описанными выше, культивирование клетки-хозяина, обнаружение экспрессии полипептида, представляющего интерес, на мембране клетки, и отбор клона клетки-хозяина с желаемой экспрессией на мембране клетки. На 5 следующем этапе полипептид, представляющий интерес, можно восстановить из клетки-хозяина. Полипептид представляет собой предпочтительно гетерологичный полипептид, более предпочтительно, полипептид человека. Как показано в примерах, уровень экспрессии полипептида, представляющего интерес, на мембране клетки прямо пропорционален уровню экспрессии растворимого полипептида. Вследствие этого 10 данный подход делает возможным проведение количественного отбора клона клетки-хозяина, экспрессирующего высокие уровни полипептида, представляющего интерес.
Согласно предпочтительному варианту реализации в настоящем изобретении предложен способ in vitro для отбора клетки-хозяина, экспрессирующей мультимерный белок,
15 предпочтительно гетеродимерное антитело, посредством трансфекции клетки-хозяина экспрессирующими конструкциями или векторами экспрессии, описанными выше, культивирования клетки-хозяина, обнаружения экспрессии мультимерного белка, представляющего интерес, на мембране клетки, и отбора клона клетки-хозяина с желаемой экспрессией на мембране клетки. На следующем этапе мультимерный белок,
20 представляющий интерес, например, гетеродимерное антитело, можно восстановить из клетки-хозяина. Как показано в примерах, можно легко отобрать клетку-хозяина, которая демонстрирует больше гетеродимерного антитела по сравнению с нежелательными формами гомодимерного антитела, т.е. обеспечить качественный отбор клона клетки-хозяина.
Для трансфекции клетки-хозяина экспрессирующей конструкцией или вектором экспрессии согласно настоящему изобретению можно применять любую методику трансфекции, такую как методики, хорошо известные в данной области техники для данного типа клетки-хозяина, например, электропорацию, копреципитацию с фосфатом 30 кальция, трансфекцию, опосредованную катионным полимером, липофекцию, при необходимости. Следует отметить, что клетку-хозяин, трансфицированную экспрессирующей конструкцией или вектором экспрессии согласно настоящему изобретению, конструируют в форме временно или стабильно трансфицированной клеточной линии. Таким образом, согласно настоящему изобретению экспрессирующая
конструкция или вектор экспрессии согласно настоящему изобретению могут поддерживаться эписомально, т.е. являться временно трансфицированными, либо могут быть стабильно интегрированными в геном клетки-хозяина, т.е. являться стабильно трансфицированными.
Временная трансфекция характеризуется неприменимостью любого давления отбора для вектора, несущего селективный маркер. В экспериментах по временной экспрессии, которые обычно длятся от двух до десяти дней после трансфекции, трансфицированная экспрессирующая конструкция или вектор экспрессии поддерживаются в форме
10 эписомальных элементов и уже не являются интегрированными в геном. Иными словами, трансфицирующая ДНК обычно не интегрируется в геном клетки-хозяина. Клетки-хозяева имеют тенденцию утрачивать трансфицирующую ДНК, и клетки, утратившие трансфицирующую ДНК, склонны расти быстрее трансфицированных клеток в популяции после культивирования пула временно трансфицированных клеток.
15 Вследствие этого экспрессия является наибольшей в период сразу после трансфекции и уменьшается со временем. Предпочтительно, временный трансфектант согласно настоящему изобретению означает клетку, которая поддерживается в культуре клеток при отсутствии давления отбора в течение периода времени от двух до десяти дней после трансфекции.
Согласно предпочтительному варианту реализации настоящего изобретения клетка-хозяин, например, клетка-хозяин СНО, стабильно трансфицирована экспрессирующей конструкцией или вектором экспрессии согласно настоящему изобретению. Стабильная трансфекция означает, что вновь введенная чужеродная ДНК, такая как вектор ДНК,
25 становится встроенной в геномную ДНК, обычно в результате случайных событий негомологичной рекомбинации. Количество копий вектора ДНК и сопутствующее количество продукта гена можно увеличить посредством отбора клеточных линий, в которых последовательности вектора были амплифицированы после встраивания в ДНК клетки-хозяина. Вследствие этого, возможно, что такое стабильное встраивание после
30 воздействия последующего увеличения давления отбора для амплификации гена является причиной появления в клетках СНО двойных микрохромосом. Более того, стабильная трансфекция может привести к утрате частей последовательности вектора, непосредственно не связанных с экспрессией рекомбинантного продукта гена, таких как, например, бактериальные области контроля количества копий, которые становятся
излишними после встраивания в геном. Следовательно, трансфицированная клетка-хозяин интегрировала по меньшей мере часть или различные части экспрессирующей конструкции или вектора экспрессии в геном.
Согласно следующему аспекту в настоящем изобретении предложено применение экспрессирующей конструкции или вектора экспрессии, описанных выше, для экспрессии гетерологичного полипептида в клетке-хозяине млекопитающих, в частности, применение экспрессирующей конструкции или вектора экспрессии, описанных выше, для экспрессии гетерологичного полипептида in vitro в клетке-хозяине млекопитающих. Согласно предпочтительному варианту реализации настоящего изобретения экспрессирующие конструкции или векторы экспрессии, описанные выше, используют для экспрессии гетеродимерного антитела in vitro в клетке-хозяине млекопитающих.
Экспрессирующую конструкцию, описанную в настоящем изобретении, можно использовать в способе для отбора рекомбинантной клетки-хозяина, экспрессирующей полипептид или белок, представляющий интерес. Предпочтительно, белок, представляющий интерес, представляет собой антитело. Указанный способ включает:
(i) котрансфекцию клетки-хозяина:
(a) экспрессирующей конструкцией, содержащей в направлении от 5' к 3': промотор;
экзон, кодирующий тяжелую цепь антитела;
донорный сайт сплайсинга, интрон и акцепторный сайт сплайсинга, причем
первый стоп-кодон расположен между донорным сайтом сплайсинга и
акцепторным сайтом сплайсинга в пределах указанного интрона;
второй экзон, кодирующий трансмембранную область, которая выбрана из
модифицированной трансмембранной области иммуноглобулина или
модифицированной или немодифицированной трансмембранной области,
отличной от трансмембранной области иммуноглобулина;
второй стоп-кодон; и
поли(А)-сайт,
(b) экспрессирующей конструкцией, кодирующей легкую цепь антитела,
(ii) культивирование трансфицированной клетки-хозяина в условиях, подходящих для экспрессии антитела;
(ii)
(iii) обнаружение экспрессии антитела на клеточной мембране; и
(iv) отбор клетки-хозяина, экспонирующей антитело на поверхности мембраны клетки.
5 Более того, подробно описанный способ можно использовать для отбора рекомбинантной клетки-хозяина, экспрессирующей биспецифичное антитело, причем клетку-хозяина котрансфицируют третьей экспрессирующей конструкцией, кодирующей scFv-Fc, или третьей экспрессирующей конструкцией, кодирующей scFv-Fc, со сплайсингом трансмембранной области, отличной от трансмембранной области 10 иммуноглобулина, такой как трансмембранная область В7-1 мыши.
Отбор желаемой клетки-хозяина можно проводить согласно способам, известным в данной области техники. Такие способы включают флуоресценцию, ELISA, вестернблоттинг, электрофорез в полиакриламидном геле с ДСН (додецилсульфатом
15 натрия), радиоиммуноанализ или применение антител или специфичных молекул, таких как аптамеры, которые распознают белок, представляющий интерес, и связываются с ним. Предпочтительно, белок, представляющий интерес, экспонированный на мембране клетки-хозяина, обнаруживают с применением флуоресцентного зонда или присоединяют к флуоресцентной метке, что позволяет проводить отбор с применением
20 метода сортировки флуоресцентно-активированных клеток (fluorescence activated cell sorting, FACS).
Экспрессию и восстановление белка можно проводить согласно способам, известным специалисту в данной области техники.
Согласно следующему аспекту в настоящем изобретении предложено применение экспрессирующей конструкции или вектора экспрессии, описанных выше, для получения лекарственного препарата для лечения нарушения.
30 Согласно следующему аспекту в настоящем изобретении предложена экспрессирующая конструкция или вектор экспрессии, описанные выше, для применения в качестве лекарственного препарата для лечения нарушения.
Согласно следующему аспекту в настоящем изобретении предложена экспрессирующая конструкция или вектор экспрессии, описанные выше, для применения в генной терапии.
Примеры
Пример 1: Клонирование векторов
Введение
10 Конструкции на основе альтернативного сплайсинга, которые были получены, содержали последовательность донора сплайсинга гена ighgl человека. Интроны (содержащие акцепторный сайт сплайсинга) были получены из интрона 4 cTNT курицы, тогда как экзон был получен из трансмембранной области гена ighgl (далее обозначается М1М2), трансмембранной области рецептора Т-клеток альфа (PTCRA) или гена В7-1
15 мыши. В нескольких конструкциях трансмембранный домен В7-1 мыши заменяли другими трансмембранными доменами, в том числе существующими в природе трансмембранными доменами и их модификациями. Более того, цитозольный хвост В7-1 в трансмембранной области В7-1 заменяли несколькими другими цитозольными хвостами с сигналом экспорта из ЭР или без такового.
Для экспрессии полноразмерного антитела формата IgGl или IgG4 была необходима одновременная экспрессия тяжелой и легкой цепей. Все субъединицы экспрессировали с применением отдельных плазмид с помощью стратегии котрансфекции. Конструкцию на основе альтернативного сплайсинга использовали для экспрессии тяжелой цепи IgGl 25 или IgG4. Легкую цепь IgGl или IgG4 клонировали в тот же скелет вектора экспрессии, но без альтернативного сплайсинга.
Для экспрессии форматов биспецифичного антитела собственной разработки (технология BEAT(r); описана в международной заявке WO2012/131555) клетки 30 следовало трансфицировать тремя различными субъединицами: тяжелой цепью, легкой цепью и scFv-Fc. С целью оценки наилучшей стратегии для экспонирования на мембране формата биспецифичного антитела сплайсированные и альтернативно сплайсированные конструкции клонировали для экспрессии тяжелой цепи и scFv-Fc. Легкую цепь
клонировали в тот же скелет вектора экспрессии, но без альтернативного сплайсинга. Таблица 1 обобщены все конструкции, полученные в данном примере.
pGLEX41_HC-I4(5Y)-I4-B7-B7-B7
GSC9763
293
pGLEX41HC-SDCCC-I4-B7-B7-B7
GSC9764
293
pGLEX41HC-SDGGC-I4-B7-B7-B7
GSC9765
293
pGLEX4 l_HC-I4(5Y-5)-I4-B7-B7-B7
GSC9768
293
pGLEX41_HC-I4(3 Y)-I4-B7-B7-B7
GSC9770
293
pGLEX41_HC-I4(9Y)-I4-B7-B7-B7
GSC9949
293
pGLEX4 l_HC-I4(15Y-3 ')-I4-B7-B7-B7
GSC9950
293
pGLEX4 l_scFv-Fc-I4-B7-B7-B7
GSC10487
323
324
pGLEX41BEAT-HC-I4-B7-B7-B7
GSC10488
321
322
pGLEX41HC-I4-B7-PTCRAK13 V-B7
GSC11203
142
pGLEX41HC-I4-B7-PTCRA-B7
GSC11204
140
pGLEX41HC-I4-B7-PTPMR-B7
GSC11205
131
pGLEX41HC-I4-M1M2-PTCRA-M1M2 version 1
GSC11206
284
285
pGLEX4 l_HC-I4-B7-B7-6His
GSC11207
112
159
pGLEX41 HC-I4-B7-PTCRA K13V D18V-B7
GSC11208
146
pGLEX41HC-I4-B7-B7-KCFCK
GSC11209
113
160
pGLEX41HC-I4-B7-CD4-B7
GSC11210
130
pGLEX41_HC-I4-B7-PTCRA_D18V-B7
GSC11211
143
pGLEX41_HC-I4-B7-PTCRA_R8V_K13V-B7
GSC11212
144
pGLEX41HC-I4-B7-ACVL1-B7
GSC11213
128
pGLEX41HC-I4-B7-ANTR2-B7
GSC11214
129
pGLEX41HC-I4-B7-PTCRAR8V-B7
GSC11216
141
pGLEX41HC-I4-B7-TNR5-B7
GSC11217
132
pGLEX4 l_IgG4-HC-B7-B7-B7
GSC11218
127
pGLEX41 HC-I4-B7-PTCRA R8V K13V D18V-B7
GSC11291
100
147
pGLEX41_HC-I4-B7-B7(26)-B7
GSC11292
111
158
pGLEX41HC-I4-B7-IGF1R-B7
GSC11295
135
pGLEX41HC-I4-B7-1B07-B7
GSC11296
134
pGLEX41HC-I4-B7-FCERA-B7
GSC11297
101
148
pGLEX41HC-I4-B7-KI2L2-B7
GSC11298
102
149
pGLEX41HC-I4-B7-M1M2-B7
GSC11389
107
154
pGLEX41HC-I4-B7-TRBM-B7
GSC11390
136
pGLEX41HC-I4-B7-IL4RA-B7
GSC11391
137
pGLEX41HC-I4-B7-LRP6-B7
GSC11392
138
pGLEX41HC-I4-B7-IL3RB-B7
GSC11393
103
150
pGLEX41HC-I4-B7-CD3E-B7
GSC11394
104
151
pGLEX41HC-I4-B7-ITA2B-B7
GSC11395
105
152
pGLEX41HC-I4-B7-CD28-B7
GSC11396
106
153
pGLEX4 l_HC-I4-B7-GpA-B7
GSC11397
139
pGLEX41_HC-I4-B7-PTCRA_R8V_D18V-B7
GSC11398
145
pGLEX4 l_HC-I4-B7-B7-GATlnoER
GSC11483
118
165
pGLEX41_HC-I4-B7-B7(24)-B7
GSC11484
110
157
pGLEX41_HC-I4-B7-B7(18)-B7
GSC11677
108
155
pGLEX41_HC-I4-B7-B7-ERGIC53_noER
GSC11678
116
163
pGLEX41_HC-I4-B7-B7(20)-B7
GSC11679
109
156
pGLEX41HC-I4-B7-ITB1-B7
GSC11756
133
pGLEX41HC-I4-B7-B7-M1M2
GSC11758
114
161
pGLEX41HC-I4-B7-B7-GAT1
GSC11759
117
164
pGLEX41HC-I4-B7-B7-AGTR2
GSC11760
119
166
pGLEX4 l_HC-I4-B7-B7-AGTR2_noER
GSC11761
120
167
pGLEX41HC-I4-B7-B7-V1BR
GSC11762
121
168
pGLEX4 l_HC-I4-B7-B7-VGLG_noER
GSC11763
124
171
pGLEX41HC-I4-B7-B7-ERGIC53
GSC11764
115
162
pGLEX4 l_HC-I4-B7-B7-VlBR_noER
GSC11765
122
169
pGLEX41HC-I4-B7-B7-VGLG
GSC11766
123
170
pGLEX41HC-I4-M1M2-M1M2-B7
GSC11294
125
172
*B последовательности приведены протяженности от последних 5 аминокислот несплайсируемой ОРС до конца экспрессирующей конструкции для последовательностей ДНК и от тех же аминокислот до конца слитой трансмембранной области для последовательностей белка, за исключением GSC314 (SEQ Ш NO: 48),
5 GSC315 (SEQ Ш NO: 294), GSC5607 (SEQ Ш NO: 296), GSC5644 (SEQ Ш NO: 49), GSC5608 (SEQ Ш NO: 51), GSC5540 (SEQ Ш NO: 302), GSB59 (SEQ Ш NO: 79) (полная последовательность ОРС).
Материалы и методы
10 Культуральные планшеты LB
500 мл воды перемешивали и кипятили с 16 г агара LB (Invitrogen, Карлсбад, Калифорния, США) (1 литр LB содержит 10 г триптона, 5 г экстракта дрожжей и 10 г NaCl). После охлаждения в раствор добавляли соответствующий антибиотик, и раствор заливали в планшет (планшеты с ампициллином в концентрации 100 мкг/мл и планшеты
15 с канамицином в концентрации 50 мкг/мл).
Полимеразная цепная реакция (ПЦР)
Все ПЦР проводили с применением 1 л дНТФ (10 мМ для каждого дНТФ; Invitrogen, Карлсбад, Калифорния, США), 2 единиц ДНК-полимеразы Phusion(r) (Finnzymes Оу, Эспоо, Финляндия), 25 нмоль Праймера A (Microsynth, Бальгах, Швейцария или Орегоп, Эберсберг, Германия), 25 нмоль Праймера В (Microsynth, Бальгах, Швейцария или 5 Орегоп, Эберсберг, Германия), 10 мкл 5Х буфера HF (7,5 мМ MgCh, Finnzymes, Эспоо, Финляндия), 1,5 мкл диметилсульфоксида (DMSO, Finnzymes, Эспоо, Финляндия) и 1 -3 мкл матрицы (10-20 нг) в 50 мкл конечного объема. Все использованные праймеры приведены в Таблица 2.
10 ГЩР запускали начальной денатурацией при температуре 98°С в течение 3 мин., за которой следовали 35 циклов денатурации по 30 сек. при температуре 98°С, 30 сек. отжига при праймер-специфичной температуре (в зависимости от содержания GC) и элонгация в течение 2 мин. при температуре 72°С. Конечную элонгацию проводили при температуре 72°С в течение 10 мин., после чего образцы охлаждали и хранили при
15 температуре 4°С.
GlnPrl502
GGCCGATCGATTTATCACTTGCCAGGAGACAG
GlnPrl516
GATGAAAGCTTGGTAGGTGATCCTCCTG
GlnPrl517
ATGTATTCGAATATCTCCACCGGTTGCAGCTCTGAGCCAGGGAGGAG GGAAG
GlnPrl518
TAAGCTAGCCCACCATGGAGAGCCCTGC
GlnPrl519
GAGGCTCTTCTGCGTGTAGTGGTTGTGCAAGGCCTCGTGCATCACGC TG
GlnPrl520
CTACCAAGCTTTCATCATTTACCCGGAGACAGGGAGAGGCTCTTCTG CGTG
GlnPrl521
GGGAGCTGGACGGGCTGTGGACGACCATCACCATCTTCATCACACTC TTCCTGTTAAGCGTGTGCTACAGTGCCACCGTCACCTTCTTCAAG
GlnPrl522
GTAGTCGGGGATGATGGTCTGCTTCAGGTCCACCACCGAGGAGAAG ATCCACTTCACCTTGAAGAAGGTGACGGTGGCACTGTAGCACACGC
GlnPrl523
ATATACCGGTGGAGAGCTGTGCGGAGGCGCAGGACGGGGAGCTGGA CGGGCTGTG
GlnPrl524
ATATTTCGAATCACTAGGCCCCCTGTCCGATCATGTTCCTGTAGTCG GGGATGATGGTC
GlnPrl649
TCTCCACCGGTTGCAGCTCTGTTCCCTCCTCCCTCGGTTAG
GlnPrl650
GCGCCATCGATACAGACATGATAAGATACATTG
GlnPrl651
GCGCGATCGATACTTGTTTATTGCAGCTTATAATGG
GlnPrl689
ATATGCTAGCCCACCATGCGGAGCCCTGCCCAGCTGCTGTTCCTGCT GCTGCTG
GlnPrl690
TGCTGTTCCTGCTGCTGCTGTGGATCCCTGGCACCAACGCCGAGGTG CAGCTGGTCGAGTC
GlnPrl725
ATATACTAGTCCACCATGCGGAGCCCTGCCCAGCTGCTGTTCCTGCT GCTGCTG
GlnPrl726
CTGTTCCTGCTGCTGCTGTGGATCCCTGGCACCAACGCCCAGGTGCA GCTGCAGCAGTC
GlnPrl727
CTGTTCCTGCTGCTGCTGTGGATCCCTGGCACCAACGCCATGGAGAC AGACACACTCC
GlnPrl735
GACTTCGAATCATCAATGATGGTGGTGGTGATGGGCGCTGGCGAGG AGCAGGTCGAACAGGAGCAGCTTG
GlnPrl760
CCGCATCGATTTATCATTTACCCGGGCTCAGGCTCAG
GlnPrl799
ATATACCGGTGGAGGCCCTGTGGCTGGGCGTGCTGAGACTGCTGCTG TTCAAGCTGCTCCTGTTCGACCTG
GlnPrl800
GTAAGCTTTCATCATTTACCCGGAGACAGGGAGAGGCTCTTCTGCGT GAATCGGTTGTGC
GlnPrl801
GCGCGAAGCTTTCATCATTTACCCGGAGACAGGGAGAGGCTCTTCTG CGTATAATGATTG
GlnPrl840
ATATACCGGTGGAGGCCCTGTGGCTGGGCGTGCTG
GlnPr2099
TCCTCGGGGGGAGATCCACCACCACCTGAGCCAGGGAGGAGGGAAG
GlnPr2100
GCGCTTCGAATCATCACAGAAACACGGTCTG
GlnPr2101
TGGTGGTGGATCTCCCCCCGAGGACCCCCCTGACTCCAAG
GlnPr2102
TCCTCGGGGGGAGATCCACCACCACCTGTTCCCTCCTCCCTCGGTTA G
GlnPr2160
CCAAGCTTTCATCATTTGCCCGGAGACAGGGAGAGG
312
GlnPr2161
CCAAGCTTTCATCATTTACCGGGAGACAGGGAGAGGCTCTTC
313
GlnPr2162
GTCCTCGGGGGGAGATCCACCACCACCTGTCCCAGAAGGAGACGGT TAG
314
GlnPr2163
GTCCTCGGGGGGAGATCCACCACCACCTGTGCAATCCTCCCAGGGTT AG
315
GlnPr2164
GTCCTCGGGGGGAGATCCACCACCACCTGTGCAATAAGGACAGGGT TAG
316
GlnPr2165
GTCCTCGGGGGGAGATCCACCACCACCTGTCCCCTCAGGTCTCGGTT AG
317
GlnPr2166
GTCCTCGGGGGGAGATCCACCACCACCTGAGCCAGGTAGCAGGGAA GGG
318
GlnPr2294
CTACCAAGCTTTCATCATTTACCCGGAGACAGGGAGAGGCTCTTCTG CGTGTAGTGGTTGTGCAAGGCCTCG
261
GlnPr2376
GGCCGTTCGAATCATCACTTGCAGAAGCACTTGATAATC
219
GlnPr2377
GTCATTTCGAATCATCAATGATGGTGGTGGTGATGGGCGCTGGCGAT AATCACGACGATCACGAC
220
GlnPr2378
TTGAACAGCAGCAGTCTCAGCACGCCCAGCCACAGGGCCCCGTCCA GCTCCCCGTCCTG
221
GlnPr2379
CTGAGACTGCTGCTGTTCAAGCTGCTCCTGTTCGACCTGCTCCTCAA GTGGATCTTCTCCTCGGTG
222
GlnPr2380
GCTTGAACAGCAGCAGTCTCAGCACGCCCAGCCACAGGGCATTCTT GGAGTCAGGGGGGTCCTC
223
GlnPr2381
CAGGACCGGTGCTTGCAGAAGCACTTGAGGAGCAGGTCGAACAGGA GCAGCTTGAACAGCAGCAGTCTC
224
GlnPr2382
GCTTGAACAGCAGCAGTACCAGCACGCCCAGCCACAGGGCATTCTT GGAGTCAGGGGGGTCCTC
225
GlnPr2383
CAGGACCGGTGCTTGCAGAAGCACTTGAGGAGCAGGTCGAACAGGA GCAGCTTGAACAGCAGCAGTACC
226
GlnPr2384
GACCGGTGCTTGCAGAAGCACTTGAGGAGCAGGTCGAACAGGAGCA GCACGAACAGCAGCAGTCTC
227
GlnPr2385
GACCGGTGCTTGCAGAAGCACTTGAGGAGCAGGACGAACAGGAGCA GCTTGAACAGCAGCAGTCTC
228
GlnPr2386
CAGGACCGGTGCTTGCAGAAGCACTTGAGGAGCAGGTCGAACAGGA GCAGCACGAACAGCAGCAGTACC
229
GlnPr2387
CAGGACCGGTGCTTGCAGAAGCACTTGAGGAGCAGGACGAACAGGA GCAGCTTGAACAGCAGCAGTACC
230
GlnPr2388
GACCGGTGCTTGCAGAAGCACTTGAGGAGCAGGACGAACAGGAGCA GCACGAACAGCAGCAGTCTC
231
GlnPr2389
CAGGACCGGTGCTTGCAGAAGCACTTGAGGAGCAGGACGAACAGGA GCAGCACGAACAGCAGCAGTACC
232
GlnPr2390
GGTCGTGATCGTCGTGATTATCAAGTGGATCTTCTCCTCGGTGGTGG
233
GlnPr2391
CCACCACCGAGGAGAAGATCCACTTGAT AATCACGACGATCACGAC С
234
GlnPr2392
CTTCGGCGCCACCGTGGTCGTGATCGTCGTGATTATCAAGTG
235
GlnPr2393
CAGGACCGGTGCTTGCAGAAGCACTTGATAATCACGACGATC
236
GlnPr2394
CTTCGGCGCCACCGTGATCGTCGTGATTATCAAGTGCTTC
237
GlnPr2395
CAGGACCGGTGCTTGCAGAAGCACTTGATAATCACGAC
238
GlnPr2396
CTTCGGCGCCGTGGTCATTGTAACCGTGGTCGTGATCGTCGTG
239
GlnPr2397
CAGGACCGGTGCTTGCAGAAGCACTTGATAATCACGACGATCACGA CCAC
240
GlnPr2398
CTTCGGCGCCGTGGTCATTGTAGTCGTAACCGTGGTCGTGATCGTCG TG
241
GlnPr2399
CAGGACCGGTGCTTGCAGAAGCACTTGATAATCACGACGATCACGA CCACGG
242
GlnPr2400
GAGCCACCAGTGCCAGCAGAGCCAGCACAGGTCCCAGGATCAGAGC CAGATTCTTGGAGTCAGGGGGGTC
243
GlnPr2401
CAGGACCGGTGCTTGCAGAAGCACTTCCACAGTCCCAGCACTCCCA GAGCCACCAGTGCCAGCAG
244
GlnPr2402
CGATGCCCAGCAGCAGGAGCAACACCAGGATCACGATGATGGCGGC GATATTCTTGGAGTCAGGGGGGTC
245
GlnPr2403
CAGGACCGGTGCTTGCAGAAGCACTTCCAGAACCACCACATCAGGC CGATGCCCAGCAGCAGGAG
246
GlnPr2404
GATAAACAGCAGCAGGCCAGCCACTCCGCCCAGCACAATCAGGGCC ATATTCTTGGAGTCAGGGGGGTC
247
GlnPr2405
CAGGACCGGTGCTTGCAGAAGCACTTGAAGAAGATGCCCAGGCCGA TAAACAGCAGCAGGCC
248
GlnPr2406
GTCCAATCAGCACGATGCCAGCCACCACGCCGGCCACGATAGGGAT GATATTCTTGGAGTCAGGGGGGTC
249
GlnPr2407
CAGGACCGGTGCTTGCAGAAGCACTTCCAGATCAGCAGCAGGGCCA GTCCAATCAGCACGATGCC
250
GlnPr2408
CCAGGAAGATGATCACGAACAGCAGGATGCCAGCGATCACGCCAGC GATATTCTTGGAGTCAGGGGGGTC
251
GlnPr2409
CAGGACCGGTGCTTGCAGAAGCACTTCATCACGAGCACCACGCCCA GGAAGATGATCACGAA
252
GlnPr2410
GCAGGATGGCGAACAGGATGCCGAAGATGATGGGGATCACGACCA GAGCATTCTTGGAGTCAGGGGGGTC
253
GlnPr2411
CAGGACCGGTGCTTGCAGAAGCACTTGATGAACACCAGCACCAGCA GGATGGCGAACAGGATG
254
GlnPr2412
CTTCGGCGCCGTGATTACCGTGGTCGTGATCGTCGTGATTATCAGGT CCCAGCAGGAGGCCGCCG
255
GlnPr2413
GTCATTTCGAATCATCAGAAGAACTTCTTGGCGGCGGCCTCCTGCTG GGAC
256
GlnPr2414
GTCATTTCGAATCATCACCACCACTTCTTGGCGGCGGCCTCCTGCTG GGAC
257
GlnPr2415
GGTCATTTCGAATCATCAGGAGCCCTTCAGGGTCAGGAACATGATA ATCACGACGATCACGAC
258
Расщепление рестриктазами
Для всех процедур расщепления рестриктазами приблизительно 1 г ДНК плазмиды (количественно определяли с применением спектрофотометра NanoDrop, ND-1000 5 (Thermo Scientific, Уилмингтон, Делавер, США)) перемешивали с 10-20 единицами каждого фермента и 4 мкл соответствующего 10Х буфера NE (NEB, Ипсвич, Массачусетс, США), объем раствора доводили до 40 мкл стерильной ШО. Реакции инкубировали в течение 1 ч при температуре, необходимой для ферментов.
После каждого препаративного расщепления скелета добавляли 1 единицу кишечной щелочной фосфатазы теленка (calf intestinal alkaline phosphatase, СГР; NEB, Ипсвич, Массачусетс, США), и смесь инкубировали в течение 30 мин. при температуре 37°С.
5 Очистка продукта ПЦР
Для проведения расщепления все ПЦР-фрагменты очищали перед расщеплением рестриктазами с применением набора Macherey Nagel Extract II (Macherey Nagel, Энзинген, Швейцария) или набора Gel and PCR clean-up (новое торговое название того же набора) согласно руководству производителя с применением 40 мкл буфера для 10 элюирования. Данный протокол также использовали для замены буферов в образцах ДНК.
Экстракция ДНК
Гель-электрофорез проводили с использованием 1 - 2% агарозных гелей. Данные гели 15 готовили с применением необходимого количества агарозы UltraPure(tm) (Invitrogen, Карлсбад, Калифорния, США) и IX буфера Трис - уксусная кислота - EDTA (ТАЕ, рН 8,3; Bio RAD, Мюнхен, Германия). Для окрашивания ДНК к 100 мл агарозного геля добавляли 1 мкл Gel Red Dye (Biotum, Hayward, Калифорния, США). В качестве маркера размера использовали 2 мкл "лесенки" ДНК 1 kb (NEB, Ипсвич, Массачусетс, США). 20 Электрофорез проводили в течение приблизительно 1 часа при напряжении 125 вольт.
Полосы, представляющие интерес, вырезали из агарозного геля и очищали с применением набора Extract II (Macherey-Nagel, Энзинген, Швейцария) или Gel and PCR clean-up kit (новое торговое название того же набора) либо Qiaquick Gel extraction kit 25 (Qiagen, Hilden, Германия) согласно руководству производителя с применением 40 мкл буфера для элюирования.
Лигирование
Для каждого лигирования 4 мкл вставки перемешивали с 1 мкл вектора, 400 единицами 30 лигазы (ДНК-лигаза Т4, NEB, Ипсвич, Массачусетс, США) и 1 мкл 10Х буфера для лигазы (буфер для ДНК-лигазы Т4; NEB, Ипсвич, Массачусетс, США). Конечный объем раствора доводили до 10 мкл водой СВЧ (сверхвысокой чистоты). Смесь инкубировали в течение 1 - 2 ч при к.т.
Трансформация продуктов лигирования в компетентную бактерию Для трансформации продуктов лигирования использовали компетентную бактерию "ТОР 10" (One Shot(r) TOP 10 Competent E. coli; Life Technologies, Карлсбад, Калифорния, США). 25 - 50 мкл бактерий оттаивали на льду в течение 5 минут. Затем к компетентным 5 бактериям добавляли 3-5 мкл продукта лигирования и инкубировали в течение 20-30 мин. на льду перед коротким тепловым шоком в течение 1 мин. при температуре 42°С. Затем в пробирку добавляли 500 мкл среды S.O.C (Invitrogen, Карлсбад, Калифорния, США) и инкубировали в течение 1 ч при температуре 37°С при перемешивании. Наконец, бактерии переносили на планшет LB с ампициллином или канамицином 10 (Sigma-Aldrich, Сент-Луис, Миссури, США) и инкубировали в течение ночи при температуре 37°С.
Минипрепараты плазмид
Для получения минипрепаратов колонии трансформированных бактерий выращивали в 15 течение 6-16 часов в 2,5 мл LB с ампициллином или канамицином при температуре 37°С, 200 об./мин. ДНК экстрагировали с применением набора для очистки плазмиды для Е. coli (NucleoSpin QuickPure или NucleoSpin Plasmid (Macherey Nagel, Энзинген, Швейцария) или Qiagen QuickLyse Miniprep (Qiagen)) согласно руководству производителя.
Плазмидную ДНК из минипрепаратов количественно определяли один раз с применением спектрофотометра NanoDrop ND-1000 (Thermo Scientific, Уилмингтон, Делавер, США) посредством измерения поглощения при 260 нм и оценки соотношения ОП (оптическая плотность) 260 нм/ОП280 нм, которое должно составлять от 1,8 до 2. 25 Контрольное расщепление проводили перед отправкой образца в компанию Fastens SA (План-ле-Отс, Швейцария) для подтверждения последовательности.
Мидипрепараты плазмид
Для получения мидипрепаратов трансформированные бактерии выращивали при 30 температуре 37°С в течение ночи в 200 мл LB с ампициллином (или канамицином). Затем культуру центрифугировали в течение 20 мин. при 725 g, и плазмиду очищали с применением коммерческого набора (NucleoBond Xtra Midi; Macherey Nagel, Энзинген, Швейцария) согласно протоколу, приведенному в руководстве производителя.
Плазмидную ДНК из мидипрепаратов количественно определяли трижды с применением спектрофотометра NanoDrop ND-1000 посредством измерения поглощения при 260 нм и оценки соотношения ОП260 нм/ОП280 нм, которое должно составлять от 1,8 до 2, а также подтверждали посредством расщепления рестриктазами. 5 Затем образцы направляли на секвенирование (Fastens SA, План-ле-Отс, Швейцария).
Максипрепараты плазмид
Для получения максипрепаратов трансформированные бактерии выращивали при температуре 37°С в течение ночи в 500 мл LB с ампициллином (или канамицином). 10 Культуру центрифугировали в течение 20 мин. при 725 g, и плазмиду очищали с применением коммерческого набора (NucleoBond РС500 или NucleoBond Xtra Maxi; Macherey Nagel, Энзинген, Швейцария) согласно протоколу, приведенному в руководстве производителя.
15 Плазмидную ДНК из максипрепаратов количественно определяли трижды с применением спектрофотометра NanoDrop ND-1000 посредством измерения поглощения при 260 нм и оценки соотношения ОП260 нм/ОП280 нм, которое должно составлять от 1,8 до 2, а также подтверждали посредством расщепления рестриктазами. Затем образцы направляли на секвенирование (Fastens SA, План-ле-Отс, Швейцария).
Гигапрепараты плазмид
Для получения гигапрепаратов трансформированные бактерии выращивали при температуре 37°С в течение ночи в 1500 мл LB с ампициллином (или канамицином). Культуру центрифугировали в течение 20 мин. при 725 g, и плазмиду очищали с 25 применением коммерческого набора (NucleoBond PC 10000; Macherey Nagel, Энзинген, Швейцария) согласно протоколу, приведенному в руководстве производителя.
Плазмидную ДНК из гигапрепаратов количественно определяли трижды с применением спектрофотометра NanoDrop ND-1000 посредством измерения поглощения при 260 нм и 30 оценки соотношения ОП260 нм/ОП280 нм, которое должно составлять от 1,8 до 2, а также подтверждали посредством расщепления рестриктазами. Затем образцы направляли на секвенирование (Fastens SA, План-ле-Отс, Швейцария).
Результаты
Клонирование тяжелой цепи антитела IgGl
Ген, кодирующий тяжелую цепь IgGl, используемый в данном патенте, оптимизировали для экспрессии в клетках китайского хомячка посредством технологии GeneArt (Регенсбург, Германия). Вариабельную часть и константную часть тяжелой цепи 5 обеспечивали в двух различных плазмидах посредством технологии GeneArt. После получения конструкции GeneArt солюбилизировали в воде, и константную область тяжелой цепи и вариабельную область тяжелой цепи клонировали совместно с применением ферментов Kpnl и Ара! Данную работу проводила сторонняя контрактная исследовательская организация; слитый продукт направляли в компанию Glenmark.
10 После секвенирования данной слитой конструкции вариацию последовательности в константной области тяжелой цепи по сравнению с теоретической последовательностью идентифицировали в домене СН2 Fc-области (ЕЕМТК на DELTK). Конструировали праймеры для изменения данной области с применением мегапраймера ГЩР и одновременно вводили подходящие сайты рестрикции с 5'- и 3'-конца от открытой
15 рамки считывания.
Первую ПЦР с применением праймеров GlnPr497 (SEQ Ш N0:2) и GlnPr498 (SEQ Ш N0:3) проводили на исходной конструкции. Полученный ампликон (304 п.о.) использовали в различных концентрациях в качестве мегапраймера во второй ПЦР с применением второго праймера GlnPr501 и исходной конструкции в качестве матрицы.
20 Конечный продукт ПЦР очищали на геле и клонировали в челночный вектор pCR-blunt (Zero Blunt(r) PCR Cloning Kit, Invitrogen, LifeTechnologies).
После скрининга минипрепаратов оказалось, что, несмотря на то, что последовательность вставки была правильной, сайты рестрикции с 5'- и 3'-конца от открытой рамки считывания были утрачены. Вследствие этого вставку повторно
25 амплифицировали с применением праймеров GlnPr501 (SEQ Ш N0:4) и GlnPr498 (SEQ Ш NO: 3) и более высокой температуры отжига (64°С). Ампликон очищали на геле и клонировали в pCR-blunt (Zero Blunt(r) PCR Cloning Kit, Invitrogen, LifeTechnologies). Один минипрепарат с правильным характером расщепления выбирали для субклонирования в pSELl, челночный вектор, с применением рестрикционных
30 ферментов Hindlll и Xbal. После скрининга минипрепаратов получали максипрепараты. Вставку данного максипрепарата снова вырезали с применением рестрикционных ферментов Xbal и Hindlll и клонировали в скелет плазмиды pGLEX41 (GSC281, SEQ ID NO: 304), открытый с помощью тех же ферментов и обработанный CIP. pGLEX41 представляет собой стандартный вектор экспрессии собственной разработки, который
содержит кассету экспрессии, содержащую промотор CMV мыши, за которым следуют конститутивно сплайсированный интрон, сайт множественного клонирования (multiple cloning site, MCS) и последовательность поли(А) SV40. После скрининга минипрепаратов получали максипрепарат pGLEX41_HC, которому присваивали номер 5 серии плазмиды GSC314. Следующие мидипрепараты или гигапрепараты той же ДНК позволили получить серии плазмиды номер GSC314a, GSC314b, GSC314c, GSC314d и GSC314e (в результате секвенирования ДНК было подтверждено, что все данные препараты являлись идентичными, и данные препараты были названы плазмидой GSC314(SEQIDNO: 48)).
Клонирование вектора экспрессии на основе альтернативного сплайсинга для экспонированной на мембране тяжелой цепи антитела IgGl
Кодирующую область тяжелой цепи антитела формата IgGl амплифицировали методом ПЦР с применением праймеров GlnPrl518 (SEQ Ш NO: 11), GlnPrl519 (SEQ Ш NO: 12)
15 и GlnPrl520 (SEQ Ш NO: 13) и плазмиды pGLEX41_HC (GSC314, SEQ Ш NO: 48) в качестве матрицы. Полученный в результате продукт ПЦР содержал сайт рестрикции Nhel на 5'-конце, а 3'-конец ампликона был модифицирован и содержал строго последние 40 п.о. записи базы данных NCBI для гена ighgl (SEQ Ш NO: 65), а также сайт рестрикции Hindlll. Модификацию 3'-конца проводили с целью воссоздания природного
20 донорного сайта сплайсинга в С-концевой области константной части тяжелой цепи IgGl. Продукт ПЦР вырезали с применением рестрикционных ферментов Nhel и Hindlll и клонировали в плазмиду pGLEX41 (GSC281, SEQ Ш NO: 304), разрезанную с применением тех же ферментов и обработанную CIP. Полученный в результате вектор, которому присваивали название pGLEX41_HC-AS (номер серии плазмиды GSC3836,
25 SEQ Ш N0: 287), подтверждали посредством расщепления рестриктазами и анализа последовательности.
Интрон номер 4 (SEQ Ш NO: 69) тропонина курицы (cTNT) амплифицировали из плазмиды собственной разработки, содержащей последовательность указанного интрона 30 (GSC2819, SEQ ID NO: 67), с применением праймеров GlnPrl516 (SEQ ГО NO: 9) и GlnPrl517 (SEQ ГО NO: 10). Тропонин экспрессируется исключительно в сердечных мышцах и эмбриональных скелетных мышцах. В раннем эмбриональном сердце и скелетных мышцах свыше 90 % мРНК содержат экзон, тогда как > 95 % мРНК взрослых не содержат экзона (Cooper & Ordahl (1985) J Biol Chem, 260(20): 11140-8). Праймеры
добавляли сайт Hindlll на 5'-конце и сайт Agel, за которым следует BstBI, на 3'-конце. Ампликон очищали на геле, расщепляли с применением Hindlll и BstBI и клонировали в вектор pGLEX41_HC-IgAS (GSC3836, SEQ ID NO: 287), открытый с применением тех же ферментов и обработанный СП3. Полученный в результате вектор, которому 5 присваивали название pGLEX41_HC-cTNTintron4 (номер серии плазмиды GSC3848, SEQ Ш N0: 289), подтверждали посредством расщепления рестриктазами и анализа последовательности.
Последовательность, кодирующую трансмембранную область гена ighgl человека (М1М2), собирали с применением плазмид GlnPrl521 (SEQ Ш N0: 14) и GlnPrl522 (SEQ Ш N0: 15). Данные праймеры частично перекрывались и были дополнены до двухцепочечной ДНК с применением ПЦР Продукт ПЦР с тупыми концами клонировали в pCR-blunt (Zero Blunt(r) PCR Cloning Kit, Invitrogen, LifeTechnologies), что приводило к получению плазмиды pCRblunt-MlM2, которую подтверждали посредством секвенирования. Вставку повторно амплифицировали с применением праймеров GlnPrl523 (SEQ Ш N0: 16) и GlnPrl524 (SEQ Ш N0: 17) для завершения последовательности трансмембранного домена М1М2. Ампликон очищали на геле, расщепляли с применением Agel и BstBI и клонировали в вектор pGLEX41_HC-cTNTintron4 (GSC3848, SEQ Ш NO: 289). Полученную в результате плазмиду под названием pGLEX41_HC-I4-MlM2-MlM2-MlM2 нарабатывали в масштабе максипрепарата, которому присваивали номер серии плазмиды GSC3899 и который подтверждали посредством анализа последовательности (SEQ Ш N0: 36).
Для увеличения соотношения сплайсинга между экспрессированным и 25 экспонированным на мембране антителом уменьшали количество пиримидинов в поли(У)-участке "выше по течению" экзона, кодирующего трансмембранную область. С данной целью фрагмент 14(0Y) (SEQ Ш N0: 70) амплифицировали из вектора собственной разработки (GSC3469, SEQ IDNO: 68) с применением праймеров GlnPrl516 (SEQ Ш N0: 9) и GlnPrl649 (SEQ Ш N0: 18). Ампликон расщепляли с применением 30 рестрикционных ферментов Hindlll и Agel и клонировали в скелет pGLEX41_HC-I4-М1М2-М1М2-М1М2 (GSC3899, SEQ Ш N0: 36), открытый с применением тех же ферментов и обработанный CIP. После скрининга минипрепаратов нарабатывали мидипрепарат pGLEX41_HC-I4(0Y)-MlM2-MlM2-MlM2, и получали серию номер GSC4398, которую подтверждали посредством секвенирования (SEQ Ш N0: 37).
Поли(А) вводили в интрон, который отделял экзон, кодирующий IgGl, от альтернативного экзона, кодирующего трансмембранную область. Поли(А)-сигнал SV40 амплифицировали из вектора собственной разработки (GSC3469, SEQ Ш N0: 305) с 5 применением праймеров GlnPrl650 (SEQ Ш NO: 19) и GlnPrl651 (SEQ Ш NO: 20). Ампликон расщепляли с применением рестрикционного фермента Clal и клонировали в вектор pGLEX41_HC-MlM2-MlM2-MlM2 (GSC3899, SEQ Ш NO: 36), который расщепляли с применением Clal и обрабатывали CIP, что приводило к получению интрона I4(polyA) (SEQ Ш N0: 71). После скрининга минипрепарата и подтверждения 10 правильной ориентации вставки нарабатывали мидпрепарат pGLEX41_HC-I4(polyA)-М1М2-М1М2-М1М2, которому присваивали номер серии GSC4401 и который подтверждали посредством секвенирования (SEQ Ш N0: 38).
Ранее последовательность терминатора гастрина добавляли к поли(А)-сигналу SV40 15 вектора собственной разработки (GSC23, SEQ Ш N0: 306), который содержит такой же общий скелет, что и pGLEX41 (GSC281, SEQ Ш NO: 304), но несет отличный промотор. Слияние поли(А) SV40 и терминатора гастрина в номенклатуре плазмид обозначали как "SV40ter" (SEQ Ш NO: 306). Кассету экспрессии GSC23 (SEQ ГО N0: 306) (промотор + кодирующая последовательность) заменяли кассетой экспрессии pGLEX41_HC-I4-20 М1М2-М1М2-М1М1 (GSC3899, SEQ ГО NO: 36), за исключением поли(А)-сигнала SV40 (т.е. промотора и кодирующей последовательности). Вставку вырезали с применением рестрикционных ферментов BstBI и Nrul и клонировали в скелет GSC23 (SEQ ГО N0: 306), расщепленный теми же ферментами и обработанный CIP. После скрининга минипрепарата нарабатывали мидипрепарат плазмиды pGLEX41_HC-I4-MlM2-MlM2-25 MlM2-SV40ter, которому присваивали номер серии плазмиды GSC4402 и который подтверждали посредством секвенирования (SEQ ГО N0: 39).
Другая предпочтительная конструкция содержит поли(А)-сигнал с терминатором гастрина в интроне. Последовательность I4(SV40ter) приведена в SEQ ГО N0: 77.
Клонирование вектора экспрессии на основе альтернативного сплайсинга для экспонированной на мембране тяжелой цепи антитела IgGl с применением трансмембранного домена рецептора Т-клеток альфа человека (PTCRA)
С целью замены трансмембранной области М1М2 в конструкциях на основе альтернативного сплайсинга трансмембранным доменом гена рецептора Т-клеток альфа человека (PTCRA) комплементарные праймеры GlnPrl799 (SEQ Ш NO: 28) и GlnPrl735 (SEQ Ш NO: 26) использовали для получения фрагмента вставки. Данные праймеры 5 частично перекрывались и были дополнены до двухцепочечной ДНК с применением ПНР. Фрагмент-вставку вырезали с применением Agel и BstBI и клонировали в скелет pGLEX41_HC-I4-MlM2-MlM2-MlM2 (GSC3899, SEQ Ш NO: 36), расщепленный теми же ферментами и обработанный CIP. Поскольку часть вставки была утрачена из полученных в результате минипрепаратов, на данном минипрепарате проводили новую
10 амплификацию с применением праймеров GlnPrl799 (SEQ Ш NO: 28) и GlnPr269 (SEQ Ш NO: 1). Амплифицированный фрагмент-вставку расщепляли с помощью Agel и BstBI и клонировали в скелет pGLEX41_HC-I4(0Y)-MlM2-MlM2-MlM2 (GSC4398, SEQ Ш NO: 37), расщепленный теми же ферментами и обработанный CIP. Один минипрепарат подтверждали посредством секвенирования и использовали для проведения другой ПЦР
15 с применением праймеров GlnPrl840 (SEQ Ш NO: 31) и GlnPr269 (SEQ Ш NO: 1). Ампликон расщепляли с применением Agel и BstBI и клонировали в скелеты PGLEX41HC-I4-M1M2-M1M2-M1M2 (GSC3899, SEQ Ш NO: 36), pGLEX41_HC-I4(0Y)-M1M2-M1M2-M1M2 (GSC4398, SEQ Ш NO: 37), pGLEX41_HC-I4(polyA)-MlM2-M1M2-M1M2 (GSC4401, SEQ Ш NO: 38) и pGLEX41_HC-I4-MlM2-MlM2-MlM2-
20 SV40ter (GSC4402, SEQ Ш NO: 39), расщепленные с применением тех же ферментов и обработанные СП3. Лигирование приводило к получению мидипрепаратов pGLEX41_HC-I4-PTCRA (GSC5854, SEQ Ш NO: 40), pGLEX41_HC-I4(0Y)-PTCRA (GSC5855, SEQ Ш NO: 41), pGLEX41_HC-I4(polyA)-PTCRA (GSC5857, SEQ Ш NO: 42) и pGLEX41_HC-I4-PTCRA-SV40ter (GSC5856, SEQ Ш NO: 43), соответственно. Все
25 мидипрепараты подтверждали посредством секвенирования.
Клонирование вектора экспрессии на основе альтернативного сплайсинга для экспонированной на мембране тяжелой цепи антитела IgGl с применением слитой конструкции M1M2-PTCRA 30 Вставку, кодирующую слитую конструкцию М1М2-PTCRA, заказывали в GeneArt под названием GeneArt_Seq32 (SEQ Ш NO: 64). Данный фрагмент содержит стандартную трансмембранную область М1М2 тяжелой цепи IgGl, за исключением трансмембранного домена, который заменяли трансмембранным доменом субъединицы альфа рецептора Т-клеток (PTCRA). Плазмиду, предоставленную GeneArt, разрезали с
применением рестрикционных ферментов Agel и BstBI, и очищенную вставку лигировали в скелет pGLEX41_HC-I4-MlM2-MlM2-MlM2 (GSC3899, SEQ Ш NO: 36), pGLEX41_HC-I4(0Y)-MlM2-MlM2-MlM2 (GSC4398, SEQ Ш NO: 37), pGLEX41_HC-14(ро1уА)-М1М2-М1М2-М1М2 (GSC4401, SEQ Ш NO: 38) и pGLEX41_HC-I4-MlM2-5 MlM2-MlM2-SV40ter (GSC4402, SEQ Ш NO: 39), соответственно, расщепленный теми же ферментами и обработанный СП3.
Лигирования приводили к получению мидипрепаратов pGLEX41_HC-I4-MlM2-PTCRA-М1М2 (GSC6030, SEQ Ш NO: 44), pGLEX41_HC-I4(0Y)-MlM2-PTCRA-MlM2 (GSC6048, SEQ Ш NO: 45), pGLEX41_HC-I4(polyA)-MlM2-PTCRA-MlM2(GSC6047, 10 SEQ Ш NO: 46) и pGLEX41_HC-I4-MlM2-PTCRA-MlM2-SV40ter (GSC6046, SEQ Ш NO: 47). Все мидипрепараты подтверждали посредством секвенирования.
Сначала было получено слияние М1М2-PTCRA; данные конструкции обеспечивали экспонирование IgGl на мембране и продемонстрировали такое же поведение 15 относительно модификации интронов, что и нативные конструкции М1М2 (см. фигуру 6 в примере 3).
Следующая конструкция pGLEX41_HC-I4-MlM2-PTCRA-MlM2_corrected была сконструирована для обеспечения правильного анализа влияния модификации 20 трансмембранного домена в трансмембранной области.
Для данной конструкции проводили слияние методом ПЦР (ПЦР со сращиванием перекрывающимися расширениями). Участок 4 интрона cTNT и внеклеточную часть транс мембранной области М1М2 амплифицировали из плазмиды pGLEX41_HC-I4-
25 М1М2-М1М2-М1М2- (GSC3899, SEQ Ш NO: 36) с применением праймеров GlnPrl285 (SEQ Ш NO: 259) и GlnPr2378 (SEQ Ш NO: 221). Цитозольный хвост трансмембранной области М1М2, а также поли(А)-сигнал SV40 амплифицировали с применением праймеров GlnPr2379 (SEQ Ш NO: 222) и GlnPrl650 (SEQ Ш NO: 19) из той же матрицы. Праймеры GlnPr2378 (SEQ Ш NO: 221) и GlnPr2379 (SEQ Ш NO: 222) обеспечили
30 создание перекрывающихся концов двух продуктов ПЦР с получением правильного трансмембранного домена PTCRA. Затем из данных двух первых продуктов ПЦР проводили ПЦР с перекрывающимися расширениями с применением праймеров GlnP1285 (SEQ Ш NO: 259) и GlnPrl650 (SEQ Ш N0:19). Полученный в результате продукт слияния ПЦР расщепляли с применением Agel и BstBI и лигировали в скелет
pGLEX41_HC-I4-MlM2-MlM2-MlM2 (GSC3899, SEQ Ш NO: 36), расщепленный теми же ферментами и обработанный СГР. После скрининга минипрепарата нарабатывали мидипрепарат pGLEX41_HC-I4-MlM2-PTCRA-MlM2_corrected, которому присваивали номер серии плазмиды GSC11206 и который подтверждали посредством секвенирования 5 (SEQ ID NO: 284).
Клонирование вектора экспрессии на основе альтернативного сплайсинга для экспонированной на мембране тяжелой цепи антитела IgGl с применением трансмембранной области В 7-1 мыши 10 С целью замены трансмембранной области трансмембранной областью гена В7-1 мыши проводили слияние методом ПЦР.
Сначала последовательность, кодирующую трансмембранную область В7-1 мыши, амплифицировали методом ПЦР из конструкции собственной разработки (заказанной в GeneArt под названием GeneArt_Seq43, SEQ Ш NO: 66) с применением праймеров
15 GlnPr2100 (SEQ Ш NO: 33) и GlnPr2101 (SEQ Ш N0:34).
Для клонирования вектора pGLEX41_HC-I4(0Y)-B7-B7-B7 фрагмент, кодирующий cTNT-I4(0Y), амплифицировали методом ПЦР из матрицы pGLEX41_HC-I4(0Y)-MlM2-М1М2-М1М2 (GSC4398, SEQ Ш NO: 37) с применением праймеров GlnPrl516 (SEQ Ш NO: 9) и GlnPr2102 (SEQ Ш N0:35). Последовательность, кодирующую
20 трансмембранную область В7-1 мыши, амплифицировали методом ПЦР из конструкции собственной разработки (заказанной в GeneArt под названием GeneArt_Seq43, SEQ Ш NO: 66) с применением праймеров GlnPr2100 (SEQ Ш NO: 33) и GlnPr2101 (SEQ Ш N0:34). Оба продукта ПЦР сливали с применением праймеров GlnPrl516 (SEQ Ш NO: 9) и GlnPr2100 (SEQ Ш N0:33). Полученный в результате продукт ПЦР расщепляли с
25 применением BstBI и Hindlll и лигировали в pGLEX41_HC-I4-MlM2-MlM2-MlM2 (GSC3899, SEQ Ш NO: 36), расщепленный теми же ферментами и обработанный CIP. После скрининга минипрепарата нарабатывали мидипрепарат pGLEX41_HC-I4(0Y)-B7-В7-В7, которому присваивали номер серии GSC7057 и который подтверждали посредством расщепления рестриктазами и секвенирования (SEQ Ш N0: 53).
Для клонирования вектора pGLEX41_HC-I4(polyA)-B7-B7-B7 фрагмент, кодирующий cTNT-I4(polyA), амплифицировали методом ПЦР из матрицы pGLEX41_HC-I4(polyA)-М1М2-М1М2-М1М2 (GSC4401, SEQ Ш NO: 38) с применением праймеров GlnPrl516 (SEQ Ш NO: 9) и GlnPr2099 (SEQ Ш N0:32). Последовательность, кодирующую
трансмембранную область В7-1 мыши, амплифицировали методом ПЦР из конструкции собственной разработки (заказанной в GeneArt под названием GeneArt_Seq43, SEQ Ш NO: 66) с применением праймеров GlnPr2100 (SEQ Ш NO: 33) и GlnPr2101 (SEQ Ш N0:34). Оба продукта ПЦР сливали с применением праймеров GlnPrl516 (SEQ Ш N0: 5 9) и GlnPr2100 (SEQ Ш N0:33). Полученный в результате продукт ПЦР расщепляли с применением BstBI и Hindlll и лигировали в pGLEX41_HC-I4-MlM2-MlM2-MlM2 (GSC3899, SEQ Ш N0: 36), расщепленный теми же ферментами и обработанный CIP. После скрининга минипрепарата полученный в результате мидипрепарат pGLEX41_HC-I4(polyA)-B7-B7-B7, которому был присвоен номер серии GSC7058, подтверждали 10 посредством расщепления рестриктазами и секвенирования (SEQ Ш N0: 54).
Для клонирования вектора pGLEX41_HC-I4-B7-B7-B7 cTNT-I4 амплифицировали методом ПЦР из матрицы pGLEX41_HC-I4-MlM2-MlM2-MlM2 (GSC3899, SEQ Ш N0: 36) с применением праймеров GlnPrl516 (SEQ Ш N0: 9) и GlnPr2099 (SEQ Ш N0:32). Последовательность, кодирующую трансмембранную область В7-1 мыши, амплифицировали методом ПЦР из конструкции собственной разработки (заказанной в GeneArt под названием GeneArt_Seq43, SEQ Ш N0: 66) с применением праймеров GlnPr2100 (SEQ Ш N0: 33) и GlnPr2101 (SEQ Ш N0:34). Оба продукта ПЦР сливали с применением праймеров GlnPrl516 (SEQ Ш N0: 9) и GlnPr2100 (SEQ Ш N0:33). Полученный в результате продукт ПЦР расщепляли с применением BstBI и Hindlll и лигировали в pGLEX41_HC-I4-MlM2-MlM2-MlM2 (GSC3899, SEQ Ш N0: 36), расщепленный теми же ферментами и обработанный CIP. После скрининга минипрепаратов полученный в результате мидипрепарат pGLEX41_HC-I4-B7-B7-B7, которому был присвоен номер серии GSC7056, подтверждали посредством расщепления рестриктазами и секвенирования (SEQ Ш N0: 55).
Для клонирования вектора pGLEX41_HC-I4-B7-B7-B7-SV40ter использовали тот же продукт ПЦР, что и для конструкции pGLEX41_HC- I4-B7-B7-B7, который расщепляли с применением Hindlll и BstBI и лигировали в pGLEX41_HC-I4-MlM2-MlM2-MlM2-30 SV40ter (GSC4402, SEQ Ш NO: 39), расщепленный теми же ферментами и обработанный CIP. После скрининга минипрепарата полученный в результате мидипрепарат pGLEX41_HC-I4-B7-B7-B7-SV40ter, которому был присвоен номер серии GSC7059, подтверждали посредством расщепления рестриктазами и секвенирования (SEQ Ш N0: 56).
Последующее уменьшение соотношения сплайсинга секретируемой тяжелой цепи антитела IgGl к тяжелой цепи антитела IgGl, экспонированной на мембране, с применением трансмембранной области В 7-1 мыши 5 Было продемонстрировано, что экспонирование на мембране химерных белков является высокоэффективным с применением трансмембранной области В7-1 мыши (Chou W-C et al, (1999) Biotechnol Bioeng, 65: 160-9; Liao K-W et al, (2001) Biotechnol Bioeng, 73: 313-23). В настоящей заявке также было показано, что снижение количества Y в поли(У)-участке акцептора сплайсинга до 0 значительно уменьшало количество антитела, 10 экспонированного на мембране клетки (см. фигуру 6F в примере 3).
Для оценки эффекта уменьшения количества пиримидинов в поли(У)-участке интрона некоторые конструкции были получены посредством слияния методом П1 IP
(SEQ ID N0:314)
pGLEX4 l_HC-I4(15Y-3 ')-I4-B7-B7-B7
25Y
GSC2332
(SEQ Ш NO:
311)
GlnPrl516 (SEQ ID NO: 9)1 GlnPr2166 (SEQ ID N0:318)
Iм П1 IP позволила провести амплификацию желаемого интрона из скелетов собственной разработки, содержащих модифицированные интроны. Праймеры и матрицы, использованные для каждой конструкции, приведены в Таблица 3. 2м ПЦР (общая для 5 всех конструкций) позволила провести амплификацию трансмембранных доменов В7-1 из конструкции pGLEX41_HC-I4-B7-B7-B7 (GSC7056, SEQ Ш N0: 55) с применением праймеров GlnPr2101 (SEQ ID NO: 34) и GlnPr2100 (SEQ ID N0:33). После очистки данных продуктов ПЦР интроны и трансмембранный домен сливали методом ПЦР со сращиванием перекрывающимися расширениями с применением праймеров GlnPrl516
10 (SEQ ID NO: 9) и GlnPr2100 (SEQ ID N0:33). Затем очищенные продукты ПЦР расщепляли с применением Hindlll и BstBI и лигировали в скелет pGLEX41_HC-I4-B7-B7-B7 (GSC7056, SEQ Ш N0: 55), расщепленный теми же ферментами и обработанный CIP. После скрининга минипрепаратов для каждой из конструкций были наработаны мидипрепараты, которые подтверждали посредством секвенирования. Номера серий
15 плазмид, присвоенные каждой конструкции, являлись следующими:
pGLEX41_HC-I4(3Y)-I4-B7-B7-B7
GSC9770 (SEQ Ш NO: 62)
pGLEX41_HC-I4(5Y)-I4-B7-B7-B7
GSC9763 (SEQ Ш NO: 61)
pGLEX41_HC-I4(5Y-5)-I4-B7-B7-B7
GSC9768 (SEQ Ш NO: 60)
pGLEX41_HC-I4(9Y)-I4-B7-B7-B7
GSC9949 (SEQ Ш NO: 59)
pGLEX41_HC-I4(15Y-3')-I4-B7-B7-B7
GSC9950 (SEQ Ш NO: 63)
Другим способом уменьшения сплайсинга является ослабление донорного сайта сплайсинга. Донор сплайсинга характеризуется консенсусной последовательностью, определяющей 5'-конец интрона. Вследствие этого разрабатывали две конструкции, в 20 которых консенсусную последовательность ДНК донора сплайсинга модифицировали без оказания влияния на последовательность белка, экспрессируемую геном.
ПЦР-амплификацию тяжелой цепи IgGl с модифицированной последовательностью 3'-конца проводили на матрице pGLEX41_HC-I4-B7-B7-B7 (GSC7056, SEQ Ш NO: 55) с праймером GlnPrl518 (SEQ ID NO: 11) и GlnPr2161 (SEQ ID NO: 313) для конструкции SD CCC и GlnPrl518 (SEQ ID NO: 11) и GlnPr2160 (SEQ ID NO: 314) для конструкции 5 SD GGC. Продукт ПЦР расщепляли с применением Nhel и Hindlll и лигировали в скелет pGLEX41_HC-I4-B7-B7-B7 (GSC7056, SEQ Ш NO: 55), расщепленный теми же ферментами и обработанный CIP. После скрининга минипрепарата нарабатывали мидипрепараты pGLEX41_HC-SD_CCC-I4-B7-B7-B7 (номер серии плазмиды GSC9764, SEQ ID N0: 58) и pGLEX41_HC-SD_GGC-I4-B7-B7-B7 (номер серии плазмиды 10 GSC9765, SEQ ГО N0: 57), которые подтверждали посредством секвенирования. Последовательность интрона конструкции pGLEX41_HC-SD_GGC-I4-B7-B7-B7 приведена в SEQ ГО N0: 78.
Замена трансмембранного домена В7-1 трансмембранными доменами аналогичной
15 длины, содержащими исключительно гидрофобные остатки
Для оценки эффекта трансмембранного домена на экспонирование на мембране разрабатывали несколько конструкций. Трансмембранные спирали, содержащие преимущественно гидрофобные остатки, считают благоприятными для стабилизации экспонирования на поверхности, и вследствие этого в качестве 10г0 подхода
20 трансмембранный домен В7-1 трансмембранной области В7-1 заменяли трансмембранными доменами других белков, содержащими исключительно гидрофобные остатки. Более того, поскольку длина трансмембранной спирали может оказывать влияние на экспонирование на поверхности, данные первые конструкции состояли исключительно из трансмембранных доменов, длина которых была подобна
25 длине трансмембранного домена В7-1.
Последовательности и характеристики данных трансмембранных доменов обобщены в
Таблица 4.
Различные трансмембранные домены образовывали посредством 2 этапов П1IP-амплификации участка интрона 4 cTNT с применением праймеров, модифицирующих 3'-конец трансмембранного домена. Матрица во всех случаях представляла собой конструкцию pGLEX41_HC-I4-B7-B7-B7 (GSC7056, SEQ Ш N0: 55). Для каждой
конструкции первый раунд ПЦР проводили с применением соответствующих праймеров, приведенных в Таблица 5. После очистки данных продуктов ПЦР 10г0 раунда проводили 2ой раунд ПЦР с применением праймеров, перечисленных в Таблица 5. После очистки данные продукты ПЦР расщепляли с помощью Agel и Clal и лигировали в 5 скелет pGLEX41_HC-I4-B7-B7-B7 (GSC7056, SEQ Ш NO: 55), расщепленный теми же ферментами и обработанный СГР. После подтверждения последовательностей на уровне минипрепарата нарабатывали мидипрепараты различных конструкций, и данным сериям плазмид были присвоены следующие номера GSC:
pGLEX41-GBR200HC-I4-B7-ACVL1-В7
GSC11213
(SEQ
81)
pGLEX41-GBR200HC-I4-B7-ANTR2-B7
GSC11214
(SEQ
82)
pGLEX41-GBR200HC-I4-B7-CD4-B7
GSC11210
(SEQ
83)
pGLEX41-GBR200HC-I4-B7-PTPRM-B7
GSC 11205
(SEQ
84)
pGLEX41-GBR200HC-I4-B7-TNR5 -B7
GSC11217
(SEQ
85)
pGLEX41-GBR200HC-I4-B7-ITBl-B7
GSC11756
(SEQ
86)
10 Все мидипрепараты подтверждали посредством секвенирования.
Замена трансмембранного домена В7-1 трансмембранными доменами аналогичной длины, содержащими заряженные и/или полярные остатки
Поскольку трансмембранные домены, содержащие исключительно гидрофобные 15 остатки, не оказывали влияния на экспонирование на поверхности (см. фигуру 10 в примере 4), были выбраны другие трансмембранные домены, которые характеризовались аналогичной длиной, что и трансмембранный домен В7-1, но содержали один или более заряженных и/или полярных остатков.
Последовательности и характеристики данных трансмембранных доменов обобщены в 20 таблице 6.
1В07
GIVAGLAVLAVVVIGAVVAAVMCR
180
TRBM
GLLIGISIASLCLWALLALLCHL
182
IL4RA
LLLGVSVSCIVILAVCLLCYVSIT
183
LRP6
TNTVGSVIGVIVTIFVSGTVYFI
184
GpA
ITLIIFGVMAGVIGTILLISYGI
185
PTCRA
ALWLGVLRLLLFKLLLFDLLL
186
Различные трансмембранные домены (за исключением PTCRA), названия которых
указаны в Таблица 7, заказывали в GeneArt. После получения конструкции GeneArt
10 ресуспендировали в воде, а затем расщепляли с помощью Agel и Clal. Полученные в
результате вставки лигировали в скелет pGLEX41_HC-I4-B7-B7-B7 (GSC7056, SEQ Ш
NO: 55), расщепленный теми же ферментами и обработанный СГР. После скрининга
минипрепаратов нарабатывали мидипрепараты и получали следующие номера серий:
GSC11296 (SEQ ID
pGLEX41-GBR200HC-I4-B7-lB07-B7 NO : 87)
GSC11295 (SEQ ID
pGLEX41-GBR200HC-I4-B7-IGFlR-B7 NO : 88)
GSC11390 (SEQ ID
pGLEX41-GBR200HC-I4-B7-TRBM-B7 NO : 89)
GSC11391 (SEQ ID
pGLEX41-GBR200HC-I4-B7-IL4RA-B7 NO : 90)
GSC11392 (SEQ ID
pGLEX41-GBR200HC-I4-B7-LRP6-B7 NO : 91)
GSC11397 (SEQ ID
pGLEX41-GBR200HC-I4-B7-GpA-B7 NO : 92)
Для конструкции pGLEX41_HC-I4-B7-PTCRA-B7 проводили 2 этап ПЦР. Интрон cTNT с внеклеточной частью В7 трансмембранной области В7-1 амплифицировали с применением праймеров GlnPrl516 (SEQ Ш NO: 9) и GlnPr2380 (SEQ Ш NO: 223) и pGLEX41_HC-I4-B7-B7-B7 (GSC7056, SEQ Ш NO: 55) в качестве матрицы. Полученный в результате продукт ПЦР повторно амплифицировали с применением праймеров GlnPrl516 (SEQ Ш NO: 9) и GlnPr2381 (SEQ Ш NO: 224). Праймеры GlnPr2380 (SEQ Ш NO: 223) и GlnPr2381 (SEQ ID NO: 224) обеспечивали слияние трансмембранного домена PTCRA с внеклеточной частью В7-1 трансмембранной области В7-1. Полученный в результате продукт ПЦР расщепляли с помощью Clal и Agel и повторно клонировали в скелет pGLEX41_HC-I4-B7-B7-B7 (GSC7056, SEQ Ш NO: 55), расщепленный теми же ферментами и обработанный CIP. После скрининга минипрепаратов нарабатывали мидипрепарат pGLEX41_HC-I4-B7-PTCRA-B7, которому присваивали номер серии GSC11204 и который подтверждали посредством секвенирования (SEQ Ш N0: 93).
Модификации заряженных остатков в трансмембранном домене PTCRA Трансмембранный домен PTCRA составляет 21 аминокислоту в длину, 3 из которых являются заряженными остатками. Наличие данных заряженных остатков может объяснить относительно низкую эффективность данного конкретного трансмембранного домена в системе экспонирования на поверхности (см. фигуру 11 в примере 4). Вследствие этого мутация данных остатков на гидрофобную аминокислоту валин может обеспечивать преимущество в отношении экспонирования на поверхности.
Все возможные комбинации немутантных и мутантных заряженных остатков в 5 трансмембранном домене PTCRA получали посредством проведения двух этапов ПЦР с применением в качестве матрицы pGLEX41_HC-I4-B7-B7-B7 (GSC7056, SEQ Ш N0:
55), с применением в качестве прямого праймера GlnPrl516 (SEQ Ш NO: 9) и обратного праймера, описанного в
Таблица 8, для различных конструкций. После 10г0 раунда ПЦР продукты ПЦР очищали, и второй раунд ПЦР проводили с GlnPr 1516 (SEQ Ш NO: 9) в качестве прямого праймера и обратного праймера, описанного в
Таблица 8. Полученные в результате продукты ПЦР очищали, расщепляли с помощью Clal и Age I и лигировали в скелет pGLEX41_HC-I4-B7-B7-B7 (GSC7056, SEQ Ш NO: 55), расщепленный теми же ферментами и обработанный СГР. После скрининга минипрепаратов положительные конструкции готовили в масштабе мидипрепаратов и подтверждали посредством секвенирования. Номера серий соответствующих конструкций являлись следующими:
pGLEX41_HC-I4-B7-PTCRA_R8V-B7 GSC11216
(SEQ ID NO: 94)
pGLEX41_HC-I4-B7-PTCRA_K13V-B7 GSC11203
(SEQ ID NO: 95)
pGLEX41_HC-I4-B7-PTCRA_D18V-B7 GSC11211
(SEQ ID NO: 96)
pGLEX41_HC-I4-B7-PTCRA_R8V_K13V-B7 GSC11212
(SEQ ID NO: 97)
pGLEX41_HC-I4-B7-PTCRA_R8V_D18V-B7 GSC11398
(SEQ ID NO: 98)
pGLEX41_HC-I4-B7-PTCRA_K13V_D18V-B7 GSC11208
(SEQ ID NO: 99)
pGLEX41_HC-I4-B7-PTCRA_R8V_K13V_D18V-B7 GSC11291
(SEQ ID NO: 100)
Замена трансмембранного домена B7-1 трансмембранными доменами различной длины, содержащими заряженные и/или полярные остатки
Поскольку присутствие заряженных и остатков в трансмембранных доменах не препятствует экспонированию на поверхности (см. фигуру 12 в примере 4), длину трансмембранного домена оценивали с применением трансмембранных доменов, более коротких или более длинных, чем трансмембранный домен В7-1, и содержащих на этот раз один или более заряженных и/или полярных остатков.
Последовательности и характеристики данных трансмембранных доменов обобщены в Таблица 9.
Различные трансмембранные домены, названия которых указаны в Таблица 10, заказывали в GeneArt. После получения конструкции GeneArt ресуспендировали в воде, 10 а затем расщепляли с помощью Agel и Clal. Полученные в результате вставки лигировали в скелет pGLEX41_HC-I4-B7-B7-B7 (GSC7056, SEQ Ш NO: 55), расщепленный теми же ферментами и обработанный СГР. После скрининга минипрепаратов нарабатывали мидипрепараты, которым присваивали следующие номера серий:
pGLEX41-GBR200HC-I4-B7-FCERA-B7 GSC11297 (SEQ ID NO : 101) pGLEX41-GBR200HC-I4-B7-KI2L2-B7 GSC11298 (SEQ ID NO : 102) pGLEX41-GBR200HC-I4-B7-IL3RB-B7 GSC11393 (SEQ ID NO : 103)
pGLEX41-GBR200HC-I4-B7-CD3E-B7 pGLEX41-GBR200HC-I4-B7-ITA2B-B7 pGLEX41-GBR200HC-I4-B7-CD28-B7 pGLEX41-GBR200HC-I4-B7-MlM2-B7
GSC11394 (SEQ ID NO GSC11395 (SEQ ID NO GSC11396 (SEQ ID NO GSC 11389 (SEQ ID NO
104) 105) 106) 107)
Модификация длины трансмембранного домена В 7-1
С целью оценки влияния длины трансмембранного домена на экспонирование на поверхности были получены различные варианты трансмембранных доменов В7-1 посредством удаления или добавления гидрофобных остатков в середину последовательности трансмембранного домена В7-1.
С данной целью проводили отжиг праймера. Для каждого варианта трансмембранных доменов В7-1 заказывали праймеры, которые отжигали на 3'-концах. Пары праймеров, использованные для каждой конструкции, описаны в Таблица 11. Праймерам позволяли отжечься, а затем последовательность завершали методом ПЦР. После очистки полученные в результате продукты ПЦР непосредственно расщепляли с помощью Sfol
и Agel и клонировали в скелет pGLEX41_HC-I4-B7-B7-B7 (GSC7056, SEQ Ш NO: 55),
расщепленный теми же ферментами и обработанный СГР, или лигировали в челночный
вектор pCR-blunt (Zero Blunt(r) PCR Cloning Kit, Invitrogen, LifeTechnologies) (поскольку
продукты отжига были очень короткими, непосредственное лигирование было возможно
5 не для каждого продукта). Во 20м случае минипрепараты экстрагировали из колоний,
полученных после лигирования отожженного продукта в pCR-blunt (Zero Blunt(r) PCR
Cloning Kit, Invitrogen, LifeTechnologies). После подтверждения последовательности
положительные минипрепараты расщепляли с помощью Sfol и Agel, и полученные
фрагменты лигировали и клонировали в скелет pGLEX41_HC-I4-B7-B7-B7 (GSC7056,
10 SEQ Ш NO: 55), расщепленный теми же ферментами и обработанный CIP. После
скрининга минипрепаратов для каждой конструкции нарабатывали мидипрепараты.
Данным мидипрепаратам присваивали номер серии GSC, описанный ниже, и препараты
подтверждали посредством секвенирования.
pGLEX41-GBR200HC-I4-B7-B7(18)-B7 GSC 11677 (SEQ ID NO : 108)
pGLEX41-GBR200HC-I4-B7-B7(20)-B7 GSC 11679 (SEQ ID NO : 109)
pGLEX41-GBR200HC-I4-B7-B7(24)-B7 GSC11484 (SEQ ID NO : 110)
pGLEX41-GBR200HC-I4-B7-B7(26)-B7 GSC11292 (SEQ ID NO : 111)
15 Модификация цитозолъного хвоста в трансмембранной области В7-1
Поскольку цитозольный хвост (с сигналом экспорта из ЭР или без такового) может оказывать влияние на экспонирование на поверхности, разрабатывали несколько конструкций с модифицированными цитозольными хвостами.
Последовательности и характеристики данных цитозольных хвостов обобщены в 20 Таблица 12.
ERGIC53_noER
Нет
RSQQEAAAKKWW
209
GAT1
MFLTLKGSLKQRLQVMIQPSEDIVRPENGPEQPQA GSSASKEAYI
210
GATlnoER
Нет
MFLTLKGS
211
AGTR2
CFVGNRFQQKLRSVFRVPITWLQGKRETMSCRKSS SLREMDTFVS
212
AGTR2_noER
Нет
CFVGNRFQQKLRSVFRVPITWLQGKRETMSCRKSS SLR
213
V1BR
NSHLLPRPLRHLACCGGPQPRMRRRLSDGSLSSRH TTLLTRSSCPATLSLSLSLTLSGRPRPEESPRDLELA DGEGTAETIIF
214
VIBRnoER
Нет
NSHEESPRDLELADGEGTAETIIF
215
VGLG
CIKLKHTKKRQlYTDIEMNRLGK
216
VGLGnoER
Нет
CIKLKHTKKRQIAAAAAANRLGK
217
Применяли различные стратегии клонирования в зависимости от длины различных конструкций.
Первые конструкции были получены методом ПЦР-амплификации интрона 4 cTNT с внеклеточным и трансмембранным доменами В7-1 с применением праймеров, модифицирующих цитозольный хвост.
Использованные пары праймеров описаны в Таблица 13, использованная матрица представляла собой pGLEX41_HC-I4-B7-B7-B7 (GSC7056, SEQ Ш N0: 55). Очищенные продукты ПЦР расщепляли ферментами, описанными в Таблица 13, и клонировали в скелет pGLEX41_HC-I4-B7-B7-B7 (GSC7056, SEQ Ш N0: 55), расщепленный теми же ферментами и обработанный СГР. После скрининга минипрепаратов нарабатывали мидипрепараты, которым присваивали следующие номера серий:
pGLEX41-GBR200HC-I4-B7-B7-6His GSC11207 (SEQ ID NO : 112) pGLEX41-GBR200HC-I4-B7-B7-
KCFCK GSC11209 (SEQ ID NO : 113)
pGLEX41-GBR200HC-I4-B7-B7-
GATlnoER GSC11483 (SEQ ID NO : 118)
Все мидипрепараты подтверждали посредством секвенирования.
5 С целью слияния цитозольного хвоста М1М2 с трансмембранной областью В7-1 проводили слияние методом П1 IP Интрон 4 cTNT с внеклеточными и трансмембранными доменами В7-1 амплифицировали с GlnPrl516 (SEQ Ш NO: 9) и GlnPr2391 (SEQ Ш NO: 234) с применением pGLEX41_HC-I4-B7-B7-B7 (GSC7056, SEQ Ш NO: 55) в качестве матрицы. Цитозольный хвост М1М2 с сигналом поли(А) SV40
10 амплифицировали с применением праймеров GlnPr2390 (SEQ Ш NO: 233) и GlnPrl650 (SEQ Ш NO: 19) с применением pGLEX41_HC-I4-MlM2-MlM2-MlM2 (GSC3899, SEQ Ш NO: 36) в качестве матрицы. После очистки оба продукта ПЦР сливали в Зеи ПЦР с применением GlnPrl516 (SEQ Ш NO: 9) и GlnPrl650 (SEQ Ш NO: 19) в качестве праймеров. Полученный в результате продукт ПЦР очищали, расщепляли с помощью
15 Sfol и BstBI и лигировали в pGLEX41_HC-I4-B7-B7-B7 (GSC7056, SEQ Ш NO: 55), расщепленный теми же ферментами и обработанный CIP. После скрининга минипрепаратов нарабатывали мидипрепарат pGLEX41_HC-I4-B7-B7-MlM2, которому присваивали номер серии GSC11758 и который подтверждали посредством секвенирования (SEQ Ш NO: 114).
Для некоторых конструкций выбирали стратегию отжига праймера. Для каждого цитозольного хвоста заказывали праймеры, которые отжигали на 3'-конце. Пары праймеров, использованные для каждой конструкции, описаны в Таблица 14. Праймерам позволяли отжечься, а затем последовательность завершали методом ПЦР. После
25 очистки полученные в результате продукты ПЦР непосредственно расщепляли с помощью Sfol и BstBI и клонировали в скелет pGLEX41_HC-I4-B7-B7-B7 (GSC7056, SEQ Ш NO: 55), расщепленный теми же ферментами и обработанный CIP, или лигировали в челночный вектор pCR-blunt (Zero Blunt(r) PCR Cloning Kit, Invitrogen, LifeTechnologies) (поскольку продукты отжига были очень короткими,
30 непосредственное лигирование было возможно не для каждого продукта). Во 20м случае
минипрепараты экстрагировали из колоний, полученных после лигирования отожженного продукта в pCR-blunt (Zero Blunt(r) PCR Cloning Kit, Invitrogen, LifeTechnologies). После подтверждения последовательности положительные минипрепараты расщепляли с помощью Sfol и BstBI, и полученные фрагменты 5 лигировали в скелет pGLEX41_HC-I4-B7-B7-B7 (GSC7056, SEQ Ш NO: 55), расщепленный теми же ферментами и обработанный CIP. После скрининга минипрепарата для каждой конструкции нарабатывали мидипрепараты, которым присваивали номера серий GSC, представленные в Таблица 14, и которые подтверждали посредством секвенирования.
Наконец, последовательности для последней конструкции заказывали в GeneArt, 15 названия последовательностей представлены в Таблица 15. После получения конструкции GeneArt ресуспендировали в воде, а затем расщепляли с помощью Sfol и BstBI. Полученные в результате вставки лигировали в скелет pGLEX41_HC-I4-B7-B7-B7 (GSC7056, SEQ Ш N0: 55), расщепленный теми же ферментами и обработанный CIP. После скрининга минипрепаратов нарабатывали мидипрепараты, которым присваивали 20 номера серий, подробно описанные в следующей таблице.
AGTR2_noER
GeneArt Seq 97
279
GSC11761 (SEQ ID NO: 120)
V1BR
GeneArt_Seq 98
280
GSC11762 (SEQ ID NO: 121)
VIBRnoER
GeneArt_Seq 99
281
GSC11765 (SEQ ID NO: 122)
VGLG
GeneArt_Seq 100
282
GSC11766 (SEQ ID NO: 123)
VGLGnoER
GeneArt_Seq 101
283
GSC11763 (SEQ ID NO: 124)
Для дополнительной оценки влияния цитозольного хвоста В7-1 цитозольный хвост трансмембранного домена М1М2 заменяли цитозольным хвостом В7-1. С данной целью трансмембранный домен М1М2 с цитозольным хвостом В7-1 заказывали в GeneArt под 5 названием GeneArt_Seq82 (SEQ Ш NO: 264). Конструкцию GeneArt расщепляли с помощью Clal и BstBI, и вставку лигировали в скелет pGLEX41_HC-I4-B7-B7-B7 (GSC7056, SEQ Ш NO: 55), расщепленный теми же ферментами и обработанный СП3. После скрининга минипрепаратов нарабатывали мидипрепарат pGLEX41_HC-MlM2-М1М2-В7, которому присваивали номер серии плазмиды GSC11294 и который 10 подтверждали посредством секвенирования (SEQ Ш NO: 125).
Клонирование вектора для экспрессии легкой цепи антитела IgGl
Вектор клонирования, полученный от GeneArt, несущий вставку легкой цепи (0704970pGA4), использовали в качестве матрицы для ПЦР с применением праймеров
15 GlnPr501 (SEQ Ш NO: 4) и GlnPr502 (SEQ Ш N0:5). Данные праймеры амплифицировали открытую рамку считывания легкой цепи и добавляли сайт рестрикции Hindlll с 5'-конца и сайт рестрикции Xbal с 3'-конца от открытой рамки считывания. Ампликон расщепляли с помощью Xbal и Hindlll и лигировали в челночный вектор, разрезанный с применением Xbal и Hindlll. После скрининга минипрепаратов
20 нарабатывали гигапрепарат, который подтверждали посредством секвенирования и расщепления.
Кодирующую область легкой цепи антитела формата IgGl вырезали из данного гигапрепарата с помощью Xbal и Hindlll и клонировали в скелет плазмиды pGLEX41 (GSC281, SEQ Ш NO: 304), открытый с применением тех же ферментов и обработанный 25 СП3. После скрининга минипрепаратов нарабатывали максипрепарат pGLEX41_LC ed,
которому присваивали номер серии GSC315 (SEQ IDNO: 294) и который подтверждали посредством секвенирования. Впоследствии несколько серий той же ДНК нарабатывали на уровне мидипрепарата или гигапрепарата, которым присваивали номера серий GSC315a, GSC315b, GSC315c, GSC315d и GSC315e (поскольку все данные препараты 5 подтверждали посредством секвенирования, в настоящей заявке в дальнейшем данные препараты называют плазмидой GSC315 (SEQ Ш N0: 294)).
Клонирование вектора для экспрессии легкой цепи антитела IgG4
Последовательность, кодирующую тяжелую цепь IgG4, нарабатывали в компании 10 Glenmark и получали в челночном векторе. Последовательность, кодирующую тяжелую цепь IgG4, амплифицировали методом ПЦР с применением праймеров GlnPrl488 (SEQ Ш NO: 328) и GlnPrl452 (SEQ Ш N0:327). После очистки полученный в результате продукт ПЦР повторно амплифицировали с применением праймеров GlnPrl494 (SEQ Ш NO: 260) и GlnPrl452 (SEQ Ш NO: 327). В ходе данных двух раундов ПЦР 15 модифицировали лидерный пептид и добавляли сайты рестрикции на обоих концах кодирующей последовательности. Полученный в результате продукт ПЦР очищали и клонировали в челночный вектор pCR-blunt (Zero Blunt(r) PCR Cloning Kit, Invitrogen, LifeTechnologies). После скрининга минипрепаратов положительный клон расщепляли с помощью Spel и Clal для экстракции последовательности, кодирующей тяжелую цепь 20 IgG4. Полученную в результате вставку лигировали в pGLEX41 (GSC281, SEQ Ш NO: 304), расщепляли с применением Nhel и BstBI и обрабатывали СП3. После скрининга минипрепаратов нарабатывали rnranpenapaTpGLEX41_IgG4-HC, которому присваивали номер серии плазмиды GSB59 и который подтверждали посредством секвенирования (SEQ ID NO: 79).
Клонирование вектора для экспрессии тяжелой цепи антитела IgG4 на основе альтернативного сплайсинга, обеспечивающего экспрессию трансмембранной области В7-1
С целью добавления кассеты альтернативного сплайсинга для экспрессии 30 мембраносвязанного IgG4 кодирующую последовательность тяжелой цепи IgG4 амплифицировали методом ПЦР с помошью праймеров GlnPr1494 (SEQ Ш NO: 260) и GlnPr2294 (SEQ Ш NO: 261) с применением pGLEX41_IgG4-HC (GSB59, SEQ Ш NO: 79) в качестве матрицы. Полученный в результате продукт ПЦР очищали, расщепляли с помошью Spel и Hindlll и лигировали в скелет pGLEX41_HC-I4-B7-B7-B7 (GSC7056,
SEQ Ш NO: 55), расщепленный с применением Nhel и Hindlll и обработанный СГР. После скрининга минипрепаратов нарабатывали мидипрепарат pGLEX41_IgG4-HC-B7-В7-В7, которому был присвоен номер серии плазмиды GSC11218 и который подтверждали посредством секвенирования (SEQ Ш N0: 80).
Клонирование вектора для экспрессии легкой цепи антитела IgG4
Последовательность, кодирующую легкую цепь IgG4, нарабатывали в компании Glenmark и получали в челночном векторе. С применением одного раунда ПЦР с тремя различными праймерами GlnPrl487 (SEQ Ш N0:325), GlnPrl491 (SEQ Ш NO: 326) и
10 GlnPr1494 (SEQ Ш N0:260) заменяли лидерный пептид и добавляли сайты рестрикции на обоих концах кодирующей последовательности. Продукт ПЦР расщепляли с помощью Spel и Clal и лигировали в скелет pGLEX41 (GSC281, SEQ Ш NO: 304), открытый с применением Nhel и BstBI и обработанный CIP. После скрининга минипрепаратов нарабатывали мидипрепарат pGLEX41_IgG4-LC, которому
15 присваивали номер серии плазмиды GSC3704 и который подтверждали посредством секвенирования (SEQ Ш N0: 319).
Клонирование вектора для экспрессии секретируемой тяжелой цепи биспецифичного антитела ВЕЛ 7(r)
20 Тяжелую цепь биспецифичного антитела нарабатывали в компании Glenmark в качестве части биспецифичного формата BEAT(r). С применением двух раундов ПЦР добавляли последовательность Козака, сигнальный пептид и фланкирующие сайты рестрикции. В первом раунде матрицу амплифицировали с применением праймеров GlnPr1726 (SEQ Ш NO: 24) и GlnPrl500 (SEQ Ш NO: 7). Продукт ПЦР очищали и использовали в качестве
25 матрицы для второго раунда ПЦР с применением праймеров GlnPrl500 (SEQ Ш NO: 7) и GlnPrl725 (SEQ Ш NO: 23). Полученный в результате ампликон очищали и вырезали с применением рестрикционных ферментов Spel и Clal. Данную вставку клонировали в скелет pGLEX41 (GSC281, SEQ Ш NO: 304), открытый с применением Nhel и BstBI и обработанный CIP. После скрининга минипрепаратов нарабатывали pGLEX41_BEAT-
30 НС-His в масштабе мидипрепарата и получали серию номер GSC5607 (SEQ Ш N0: 296). Контроль посредством секвенирования и расщепления рестриктазами позволил подтвердить плазмиду.
Данную плазмиду использовали в качестве матрицы для модифицирующей ПЦР с применением праймеров GlnPrl725 (SEQ Ш NO: 23) и GlnPrl760 (SEQ Ш NO: 27) с
целью удаления His-метки из последовательности матрицы. Ампликон расщепляли с помощью Spel и Clal и клонировали в скелет вектора pGLEX41 (GSC281, SEQ Ш NO: 304), открытый с применением рестрикционных ферментов Nhel и BstBI и обработанный СП3. После скрининга минипрепаратов мидипрепарат pGLEX41_BEAT-HC, которому 5 был присвоен номер серии плазмиды GSC5644, подтверждали посредством секвенирования (SEQ Ш N0: 49).
Клонирование вектора экспрессии на основе альтернативного сплайсинга для экспонированной на мембране тяжелой цепи биспецифичного антитела BEAT(r)
10 Матричный вектор, кодирующий тяжелую цепь BEAT (GSC5644, SEQ Ш NO: 49), амплифицировали с применением праймеров GlnPrl800 (SEQ Ш NO: 29) и GlnPrl725 (SEQ Ш NO: 23). Очищенный продукт расщепляли с помощью рестрикционных ферментов Spel и Hindlll и клонировали в вектор pGLEX41_HC-I4-MlM2-MlM2-MlM2 (GSC3899, SEQ Ш NO: 36), открытый с применением ферментов Nhel и Hindlll и
15 обработанный СП3. После скрининга минипрепаратов нарабатывали максипрепарат pGLEX41_BEAT-HC-I4-MlM2-MlM2-MlM2, которому присваивали номер серии плазмиды GSC5537 (SEQ Ш N0: 50) и который подтверждали посредством расщепления рестриктазами и секвенирования.
С целью применения трансмембранной области В7-1 для экспонирования на 20 поверхности вставку конструкции pGLEX41_BEAT-HC-I4-MlM2-MlM2-MlM2 (GSC5537, SEQ Ш NO: 50) расщепляли с помощью Sad и Hindlll и повторно клонировали в pGLEX41_HC-I4-B7-B7-B7 (GSC7056, SEQ Ш NO: 55), расщепленный теми же ферментами и обработанный СП3. После скрининга минипрепаратов нарабатывали максипрепарат pGLEX41_BEAT-HC-I4-B7-B7-B7, которому присваивали 25 номер серии плазмиды GSC10488 и который подтверждали посредством секвенирования (SEQ ID NO: 321).
Клонирование вектора экспрессии для секретируемого биспецифичного антитела scFv-Fc
30 Последовательность scFv-Fc представляла собой последовательность собственной разработки, которая являлась частью биспецифичного формата BEAT(r). Амплификацию проводили с применением праймеров GlnPrl690 (SEQ ГО NO: 22), GlnPrl689 (SEQ ГО NO: 21) и GlnPrl502 (SEQ ID NO: 8). Данные праймеры добавляли в ампликон последовательность Козака, сигнальный пептид и сайты рестрикции. Продукт ПЦР
повторно амплифицировали с применением праймеров GlnPr1689 (SEQ Ш NO: 21) и GlnPrl502 (SEQ Ш NO: 8), и полученный в результате ампликон расщепляли с применением Nhel и Clal. Данный фрагмент-вставку лигировали со скелетом pGLEX41 (GSC281, SEQ Ш NO: 304), разрезанным с применением Nhel и BstBI и обработанным 5 CIP. После скрининга минипрепаратов нарабатывали мидипрепарат pGLEX41_scFv-Fc, которому присваивали номер серии GSC5608 (SEQ Ш N0: 51) и который подтверждали посредством расщепления рестриктазами и секвенирования.
Клонирование вектора экспрессии на основе альтернативного сплайсинга для 10 экспонирования биспецифичного антитела scFv-Fc на мембране
Матричный вектор, кодирующий scFv (GSC5608, SEQ Ш NO: 51), амплифицировали с применением праймеров GlnPrl801 (SEQ Ш NO: 30) и GlnPrl689 (SEQ Ш N0:21). Очищенный продукт расщепляли с помощью Nhel и Hindlll и клонировали в вектор pGLEX41_HC-I4-MlM2-MlM2-MlM2 (GSC3899, SEQ Ш NO: 36), открытый с 15 применением тех же ферментов и обработанный СП3. После скрининга минипрепаратов нарабатывали мидипрепарат pGLEX41_scFv-Fc-I4-MlM2-MlM2-MlM2, которому присваивали номер серии плазмиды GSC5538 (SEQ Ш N0: 52) и который подтверждали посредством расщепления рестриктазами и секвенирования.
20 С целью применения трансмембранной области В7-1 для экспонирования на поверхности вставку конструкции pGLEX41_scFv-Fc-I4-MlM2-MlM2-MlM2 (GSC5537, SEQ Ш NO: 50) расщепляли с применением Nhel и Hindlll и повторно клонировали в pGLEX41_HC-I4-B7-B7-B7 (GSC7056, SEQ Ш NO: 55), расщепленный теми же ферментами и обработанный СП3. После скрининга минипрепаратов
25 нарабатывали максипрепарат pGLEX41_scFv-Fc-I4-B7-B7-B7, которому присваивали номер серии плазмиды GSC10487 и который подтверждали посредством секвенирования (SEQ ID NO: 323).
Клонирование вектора экспрессии для легкой цепи биспецифичного антитела 30 Последовательность легкой цепи представляла собой последовательность, которая является частью биспецифичного формата BEAT(r). Амплификацию проводили с применением праймеров GlnPr1689 (SEQ Ш NO: 21), GlnPr1727 (SEQ Ш NO: 25) и GlnPr 143 7 (SEQ ID N0:6). Данные праймеры добавляли в ампликон сигнальный пептид, последовательность Козака и фланкирующие сайты рестрикции. Ампликон очищали,
расщепляли с применением рестрикционных ферментов Clal и Nhel и клонировали в скелет челночного вектора, открытого с применением Nhel и Clal и обработанного СГР. После скрининга минипрепаратов нарабатывали максипрепарат, который подтверждали посредством секвенирования. Данный челночный вектор, кодирующий легкую цепь 5 биспецифичной конструкции, расщепляли с применением рестрикционных ферментов Nhel и Clal, и вставку клонировали в вектор pGLEX41 (GSC281, SEQ Ш NO: 304), открытый с применением Nhel и BstBI и обработанный CIP. После скрининга минипрепаратов нарабатывали мидипрепарат pGLEX41_BEAT-LC (номер серии плазмиды GSC5540, SEQ Ш N0: 302), и плазмиду подтверждали посредством 10 расщепления рестриктазами и секвенирования.
Пример 2: Экспонирование на поверхности и специфичное обнаружение транслированного продукта
Введение
В примере 1 описано клонирование конструкций на основе альтернативного сплайсинга, которые приводили к экспрессии двух различных мРНК с одной матрицы ДНК, кодирующей секретируемый белок или тот же белок с С-концевой трансмембранной областью (ТМ). Как подробно описано в разделе определений, транс мембранная область содержит необязательный линкер, трансмембранный домен и необязательный цитоплазматический хвост. Клетки CHO-S трансфицировали данными конструкциями с целью определить, возможно ли использование данной технологии для экспонирования фракции белка на мембране клетки с одновременным поддержанием эффективной секреции целевого белка.
В данном эксперименте использовали три различных белка: антитело подкласса IgGl, антитело подкласса IgG4 и биспецифичное антитело формата BEAT(r).
Материалы и методы Трансфекции
Суспензию клеток CHO-S трансфицировали векторами экспрессии с применением 30 полиэтиленимина (JetPEI(r), Polyplus-transfection, Илькирш, Франция) в формате биореактора с объемом пробирки 50 мл (Tubespins, ТРР). С данной целью клетки, которые находились в экспоненциальной фазе роста, высевали при плотности 2 Е6 клеток/мл в 5 мл среды OptiMEM (№31985-047, Invitrogen) или среды CD-CHO (№10743011, Life Technologies). К клеткам добавляли комплекс JetPEI(r):,ZIHK в массовом
соотношении 3 (мкг/мкг). Конечная концентрация ДНК в суспензии клеток составляла 2,5 мкг/мл. Через 5 часов инкубации при температуре 37°С при встряхивании (200 об./мин.) к суспензии клеток добавляли 5 мл свежей культуральной среды. Затем клетки инкубировали на встряхиваемой платформе при температуре 37°С при содержании СО2 5 5% и влажности 80%.
Поверхностное окрашивание
Поверхностное окрашивание клеток проводили в день 1 после трансфекции. Суммарно собирали 1 Е5 клеток и переносили в круглодонную лунку 96-луночного планшета.
10 Клетки дважды промывали промывочным буфером (2% ЭБС, эмбриональная бычья сыворотка, в ФБР, фосфатном буферном растворе), а затем ресуспендировали в 100 мкл промывочного буфера, содержащего детектирующее антитело. Специфичное обнаружение легкой цепи каппа проводили с применением антитела мыши против легкой цепи каппа человека, меченного АФЦ (№561323, BD Pharmingen), который
15 возбуждали красным лазером (640 нм) и обнаруживали в спектральной области 661/19 нм. Как тяжелую цепь, так и scFv-Fc обнаруживали с применением специфичного антитела козы против Fc-гамма человека, конъюгированного с ФЭ (№12-4998-82, eBioscience), который возбуждали голубым лазером (488 нм) и обнаруживали в спектральной области 583/26 нм, a scFv-Fc специфично обнаруживали с применением
20 белка А, меченного ФИТЦ (№Р5145, Sigma), который возбуждали при 488 нм голубым лазером и обнаруживали в спектральной области 525/30. Через 20 мин. инкубации в темноте при комнатной температуре клетки один раз промывали промывочным буфером и ресуспендировали в 200 мкл промывочного буфера для анализа методом проточной цитометрии. Клетки анализировали на проточном цитометре Guava (Merck Millipore) или
25 FACSCalibur (Becton Dickinson).
Уровень временной экспрессии секретируемых молекул измеряли в день 4-6 после трансфекции с применением прибора Octet QK (Fortebio, Menlo Park, CA) и биосенсоров на основе белка А.
30 Результаты
Для экспрессии антитела IgGl клетки CHO-S трансфицировали, как описано в разделе "Материалы и методы", с применением вектора экспрессии pGLEX41_LC (SEQ Ш NO: 294), экспрессирующего легкую цепь, и второго вектора под названием pGLEX41_HC-I4-B7-B7-B7 (SEQ Ш NO: 55), pGLEX41_HC-I4-MlM2-MlM2-MlM2 (SEQ Ш NO: 36),
pGLEX41_HC-I4-PTCRA (SEQ Ш NO: 40) или pGLEX41_HC-I4-MlM2-PTCRA-MlM2_corrected (SEQ Ш NO: 284), соответственно. В качестве контроля использовали несплайсируемую конструкцию, кодирующую секретируемую тяжелую цепь (SEQ Ш N0: 48).
После трансфекции клетки окрашивали, как описано в разделе "Материалы и методы", и анализировали методом проточной цитометрии. Отрицательный контроль, экспрессирующий секретируемый вариант легкой цепи и тяжелой цепи (альтернативный сплайсинг трансмембранной области отсутствовал), образовывал лишь незначительную
10 интенсивность поверхностного окрашивания (см. незакрашенную гистограмму на фигуре 2А и фигуре 2Е, представляющую процент окрашенных клеток) с относительно высоким уровнем секреции IgGl (см. фигуру 2F). В отличие от данных результатов в клетках, трансфицированных конструкциями, содержащими область М1М2 (SEQ Ш N0: 36), наблюдалась значительная положительная популяция, экспонирующая антитело на
15 мембране клетки (см. заполненную гистограмму на фигуре 2В). Замена всей транс мембранной области М1М2 трансмембранной областью PTCRA (см. фигуру 2С; SEQ Ш N0: 40) или специфичная замена трансмембранного домена М1М2 трансмембранным доменом PTCRA (см. фигуру 2D; SEQ Ш N0: 284) приводила к получению положительно, но слабо окрашенной популяции клеток. В случае
20 трансмембранной области В7-1 мыши (см. фигуру 2A; SEQ Ш N0: 55) наблюдался неожиданно высокий уровень окрашивания с 40% популяции, положительной в отношении экспонированного на мембране IgGl.
Альтернативный сплайсинг и, следовательно, мембраносвязанная экспрессия фракции 25 общего наработанного антитела, как представляется, оказывает отрицательное влияние на титры секретируемого IgG. Несмотря на это, транс мембранная область М1М2 (также в комбинации с трансмембранным доменом PTCRA) и, в особенности, трансмембранная область В7-1 обеспечила до 80% уровня секреции контрольной конструкции без альтернативного сплайсинга (см. фигуру 2F).
С целью экспрессии антитела IgG4 клетки CHO-S трансфицировали, как описано в разделе "Материалы и методы", с применением вектора экспрессии pGLEX41_IgG4-LC (SEQ Ш NO: 319), экспрессирующего легкую цепь, и второго вектора, кодирующего тяжелую цепь с альтернативным сплайсингом трансмембранной области В7-1 для
экспонирования на мембране (SEQ Ш N0: 80). В качестве контроля использовали несплайсируемые конструкции, кодирующие секретируемую тяжелую цепь IgG4 (SEQ ID NO: 79).
5 После трансфекции клетки окрашивали, как описано в разделе "Материалы и методы", и анализировали методом проточной цитометрии. Отрицательный контроль, экспрессирующий секретируемый вариант легкой цепи и тяжелой цепи (без альтернативного сплайсинга трансмембранной области), образовывал исключительно отрицательную популяцию (см. фигуру ЗА) со значительным уровнем секреции IgG4 -
10 приблизительно 6 мкг/мл (см. фигуру ЗС). В отличие от данных результатов клетки, трансфицированные конструкциями, содержащими область В7-1 (SEQ Ш N0: 80), продемонстрировали значительную положительную популяцию, экспонирующую антитело на мембране клетки (см. гистограмму на фигуре ЗА и процент окрашивания на фигуре ЗВ), тогда как уровень экспрессии остался на аналогичном уровне как с
15 альтернативным сплайсингом, так и без него (см. фигуру ЗС).
Для определения того, может ли биспецифичное антитело быть экспонировано на мембране клетки посредством трансмембранной области (ТМ), конструкции на основе альтернативного сплайсинга, описанные в примере 1, кодирующие биспецифичные
20 антитела, временно экспрессировали в клетках СНО. В данном примере в качестве модельного белка использовали конструкции на основе альтернативного сплайсинга, которые кодируют формат биспецифичного антитела собственной разработки и которые описаны в международной заявке WO2012/131555 (под названием "ВЕАТ(r)"). Молекула BEAT представляет собой тример тяжелой цепи IgG ("тяжелая цепь"), легкой цепи каппа
25 ("легкая цепь") и scFv, слитого с константной областью тяжелой цепи ("scFv-Fc"). Сайт связывания белка А тяжелой цепи удаляли, так что связываться с белком А был способен лишь Fc-фрагмент scFv-Fc. Разработка молекулы и конструирование сайта связывания белка А тяжелой цепи обеспечивают специфичное обнаружение любой субъединицы тримера. Экспонирования на мембране клетки достигали посредством трансфекции
30 клеток конструкцией на основе альтернативного сплайсинга тяжелой цепи или scFv-Fc либо посредством трансфекции обеими конструкциями на основе альтернативного сплайсинга. Мембраносвязанное биспецифичное антитело BEAT, экспонированное на поверхности отдельных клеток, специфично обнаруживали методом проточной цитометрии.
Затем векторы, кодирующие стандартные экспрессирующие конструкции, укорачивали до "рНС" в случае pGLEX41 BE AT-НС (SEQ Ш NO: 49), "pLC" в случае pGLEX41 BEAT-LC (SEQ Ш NO: 302) и "pScFv-Fc" в случае pGLEX41_scFv-Fc (SEQ Ш NO: 51). Конструкцию на основе альтернативного сплайсинга, добавляющую трансмембранную область к НС, называют "рНС-М1М2" (pGLEX41_BEAT-HC-I4-М1М2-М1М2-М1М2; SEQ Ш NO: 50), и конструкцию, добавляющую трансмембранную область к scFv-Fc, называют "pScFv-Fc-MlM2" (pGLEX41_scFv-Fc-I4-MlM2-MlM2-М1М2; SEQ Ш NO: 52). Клетки котрансфицировали векторами экспрессии, кодирующими три субъединицы антитела BEAT, с применением экспрессирующих конструкций на основе альтернативного сплайсинга или стандартных экспрессирующих конструкций в различных комбинациях. Таблица 16 обобщены проведенные трансфекции и формы, которые, как ожидают, будут экспонированы на мембране клетки.
Профили проточной цитометрии, полученные в день 1 после трансфекции, представлены на фигуре 4А и В. Первый коктейль для трансфекции (рНС + pScFv-Fc + pLC) не содержал конструкций с трансмембранной областью для экспонирования на мембране клетки. Таким образом, профили, полученные для данной трансфекции (фигура 4А, D, G), считали отрицательным контролем для эксперимента; данные профили представлены на гистограммах в виде заштрихованного распределения.
Трансфекция вектором pScFv-Fc-MlM2 самим по себе позволяла получить исключительно положительные клетки в отношении окрашивания против Fc
(обнаружение тяжелой цепи) и белка А (фигура 4К, N, Q). В данном случае легкая цепь не была обнаружена на мембране клетки, что свидетельствует о специфичности анализа. Котрансфекция векторами рНС-М1М2 и pLC позволяла получить положительные клетки в отношении окрашивания против Fc и легкой цепи каппа, но связывания с 5 белком А не наблюдалось (фигура 4L, О, R). Данный результат согласовывается с тем фактом, что сайт связывания белка А в субъединице тяжелой цепи молекулы BEAT был удален. Следовательно, несмотря на то, что антитело против Fc-гамма человека не было специфичным к тяжелой цепи и также распознавало scFv-Fc, обнаружение легкой цепи позволило авторам настоящего изобретения сделать заключение об экспрессии тяжелой 10 цепи.
Трансфекции, проведенные с коктейлями плазмид, кодирующими все три субъединицы, независимо от использованной конструкции на основе альтернативного сплайсинга, продемонстрировали экспрессию конструкции BEAT с по меньшей мере одной
15 трансмембранной областью (фигура 4В, С, J, Е, F, М, Н, I, Р). Окрашивание являлось положительным в отношении легкой цепи и scFv-Fc, а также в отношении фрагментов Fc (тяжелой цепи и scFv-Fc); данный результат свидетельствует, что на мембране клетки присутствовали все ожидаемые формы. Следовательно, на мембране клетки присутствовали полностью свернутые мультимеры, что подтверждает эффективность
20 репортерной системы для экспрессии мультимерных белков. Неожиданно были обнаружены все формы вне зависимости от положения трансмембранной области. В случаях, когда трансмембранная область (ТМ) была присоединена к тяжелой цепи (НС) и субъединице scFv-Fc (фигура 4В, Е, Н), исключительно к НС (фигура 4С, F, I) или исключительно к scFv-Fc (фигура 4J, М, Р), различия отсутствовали.
Вследствие этого подход, представленный в настоящей заявке, позволяет разделять гетеродимер (например, тяжелая цепь + scFv-Fc + легкая цепь) и гомодимеры (тяжелая цепь + легкая цепь или гомодимер scFv-Fc), экспонированные на мембране клетки. В контексте экспрессии мультимерных белков, таких как биспецифичные антитела, 30 информация такого свойства является чрезвычайно полезной.
Концентрации секретируемого BEAT и гомодимера scFv-Fc измеряли на приборе Octet QK с применением биосенсоров на основе белка А в день 6 после трансфекции. Результаты представлены на фигуре 5. Как и ожидалось, в случае трансфекции с
применением векторов экспрессии рНС-М1М2 + pLC экспрессию на биосенсорах на основе белка А невозможно было измерять, поскольку полученный в результате продукт (гомодимер тяжелая цепь - легкая цепь) не связывается с белком А. В случае трансфекции с применением вектора экспрессии pScFv-Fc-MlM2 наблюдался более 5 низкий уровень экспрессии по сравнению с контрольной трансфекцией, которая приводила к получению исключительно секретируемого продукта. В случае всех вариантов трансфекции молекулы BEAT или гомодимер scFv-Fc можно было обнаружить в супернатантах с применением конструкций на основе альтернативного сплайсинга. Данный факт подтверждает, что гетеротримеры BEAT не только
10 экспонировались на мембране клетки, что было продемонстрировано ранее, но также успешно секретировались посредством секреторного пути клеток. Более важно, что уровни экспрессии, полученные с конструкцией на основе альтернативного сплайсинга, были сравнимы с контролем (рНС + pScFv-Fc + pLC). Данный результат свидетельствует, что лишь небольшая фракция белков отклоняется от секреторного пути
15 для экспонирования на поверхности, поскольку значительное влияние на уровень секреции, которое можно было измерять в данной экспериментальной модели, отсутствовало.
Заключение
20 На основании данных результатов можно заключить, что конструкции на основе альтернативного сплайсинга успешно направляли фракцию продуцированного антитела к мембране клетки посредством альтернативного сплайсинга. В то время как степень поверхностного окрашивания для конструкций, содержащих трансмембранный домен PTCRA, являлась низкой, для клеток, трансфицированных конструкциями,
25 содержащими трансмембранную область М1М2, степень окрашивания являлась высокой, и даже большей в случае конструкций, содержащих трансмембранную область В7-1. Помимо силы сигнала, процент популяции клеток, который мог окрашиваться, был неожиданно высоким при трансфекции конструкциями В7-1, с учетом того, что трансмембранная область М1М2 была отобрана в процессе эволюции В-клеток для
30 эффективного экспонирования антитела на мембране и, вследствие этого, должна была представлять наиболее эффективную конструкцию для экспонирования иммуноглобулинов на мембране.
Общий уровень экспрессии антитела уменьшался, когда часть секретируемого антитела перенаправлялась к мембране клетки, но с различными конструкциями было достигнуто приблизительно 80% уровня экспрессии несплайсированного контроля.
5 Молекулы с более чем двумя субъединицами можно успешно экспонировать на мембране клетки с применением конструкций на основе альтернативного сплайсинга согласно настоящему изобретению, что подтверждается примером конструкций BEAT(r). В данных конструкциях трансмембранную область сливали с небольшой фракцией экспрессируемого белка. С применением биспецифичного антитела (BEAT) в качестве
10 примера, значительных отличий уровня секреции по сравнению с контрольной трансфекцией, которая приводила к получению исключительно секретируемого белка, не наблюдалось. Тот факт, что влияние альтернативного сплайсинга на уровень экспрессии отсутствовало либо являлось лишь незначительным, делает данную технологию пригодной для промышленного применения. Более того, можно
15 продемонстрировать, что подход, описанный в настоящей заявке, обеспечивал специфичное обнаружение мультимеров, экспонированных на мембране клетки. Неожиданно было установлено, что трансмембранную область можно добавить к тяжелой цепи или к scFv-Fc либо к обеим субъединицам, не оказывая влияния на экспонирование на поверхности или уровень экспрессии секретируемого белка.
20 Поскольку мультимерные молекулы, экспонированные на мембране клетки посредством альтернативного сплайсинга, отражают состав продукта секретируемых мультимерных белков конкретной клетки, данная технология позволит проводить качественное прогнозирование профиля секреции на уровне одной клетки с применением цитометрии. Данный эксперимент продемонстрирован в примере 5.
Пример 3: Модуляция экспонирования на поверхности клетки и титра экспрессии посредством модификации последовательности интрона
Введение
Как продемонстрировано в примере 2, альтернативный сплайсинг трансмембранной 30 области позволяет перенаправлять фракцию антитела, которая в противном случае является секретируемой, на поверхность клетки. Однако данная модификация процесса секреции может оказывать отрицательное влияние на уровень секреции антитела. Тонкая настройка соотношения сплайсинга между секретируемым и экспонированным на мембране антителом может способствовать восстановлению уровня экспрессии,
наблюдаемого в случае несплайсированных конструкций антитела (без альтернативного сплайсинга трансмембранной области). Данный эксперимент продемонстрирован в следующем примере.
5 Материалы и методы Трансфекции
Суспензию клеток CHO-S трансфицировали векторами экспрессии с применением полиэтиленимина (JetPEI(r), Polyplus-transfection, Илькирш, Франция) в формате биореактора с объемом пробирки 50 мл (Tubespins, ТРР). С данной целью клетки,
10 которые находились в экспоненциальной фазе роста, высевали при плотности 2 Е6 клеток/мл в 5 мл среды OptiMEM (№31985-047, Invitrogen). К клеткам добавляли комплекс МРЕГ(r):ДНК в массовом соотношении 3 (мкг/мкг). Конечная концентрация ДНК в суспензии клеток составляла 2,5 мкг/мл. Через 5 часов инкубации при температуре 37°С при встряхивании (200 об./мин.) к суспензии клеток добавляли 5 мл
15 свежей культуральной среды. Затем клетки инкубировали на встряхиваемой платформе при температуре 37°С при содержании СО2 5% и влажности 80%.
Поверхностное окрашивание
Поверхностное окрашивание клеток проводили в день 1 после трансфекции. Суммарно 20 собирали 1 Е5 клеток и переносили в круглодонную лунку 96-луночного планшета. Клетки дважды промывали промывочным буфером (2% ЭБС в ФБР), а затем ресуспендировали в 100 мкл промывочного буфера, содержащего детектирующее антитело. Специфичное обнаружение тяжелой цепи проводили с применением антитела козы против IgG человека, конъюгированного с ФЭ (№512-4998-82, eBioscience), 25 который возбуждали голубым лазером (488 нм) и обнаруживали в спектральной области 583/26 нм. Через 20 мин. инкубации в темноте при комнатной температуре клетки один раз промывали промывочным буфером и ресуспендировали в 200 мкл промывочного буфера для анализа методом проточной цитометрии. Клетки анализировали на проточном цитометре Guava (Merck Millipore) или FACSCalibur (Becton Dickinson). 30 Уровень временной экспрессии секретируемых молекул измеряли в день 4-6 после трансфекции с применением прибора Octet QK (Fortebio, Menlo Park, CA) и биосенсоров на основе белка А.
Результаты
Клетки CHO-S трансфицировали, как описано в разделе "Материалы и методы", с применением вектора экспрессии pGLEX41_LC (SEQ Ш NO: 294), экспрессирующего легкую цепь, и второго вектора, кодирующего тяжелую цепь и содержащего модифицированные варианты интрона с трансмембранным доменом М1М2 (SEQ Ш N0: 5 36-39), с трансмембранным доменом PTCRA (SEQ Ш N0: 40-43), со слитым трансмембранным доменом М1М2-PTCRA (SEQ Ш N0: 44-47) или с трансмембранным доменом В7-1 (SEQ Ш N0: 53-56). В качестве контроля использовали секретируемую тяжелую цепь без альтернативного сплайсинга (SEQ Ш N0: 48).
После трансфекции клетки окрашивали, как описано в разделе "Материалы и методы", и анализировали методом проточной цитометрии. Как уже наблюдалось в примере 2, отрицательный контроль, экспрессирующий секретируемый вариант легкой цепи и тяжелой цепи (без альтернативного сплайсинга трансмембранной области), образовывал лишь незначительную фракцию окрашенных клеток (см. фигуру 6) со значительным уровнем секреции IgGl (см. фигуру 7). В отличие от данных результатов в клетках, трансфицированных конструкциями, содержащими область М1М2 (SEQ Ш N0: 36, фигура 6А) и трансмембранный домен В7-1 (SEQ Ш N0: 55, фигура 6М), наблюдалась значительная положительная популяция, экспонирующая антитело на мембране клетки. В случае трансмембранного домена PTCRA (SEQ Ш N0: 40, фигура 6Е) или слитого транс мембранного домена М1М2-PTCRA (SEQ Ш N0: 44, фигура 61) положительная популяция была окрашена слабо.
Уменьшение содержания У в поли(У)-участке интрона, как было продемонстрировано, ослабляет акцептор сплайсинга, и данную модификацию проводили с целью смещения 25 соотношения сплайсинга в сторону секретируемого антитела. В случае обеих трансмембранных областей, использование которых приводило к успешному экспонированию (М1М2 и В7-1), конструкции без У в поли(У)-участке интрона (SEQ Ш N0: 37 и SEQ Ш N0: 53) не продемонстрировали поверхностного окрашивания клеток (см. фигуру 6В и N). Данный результат свидетельствует, что соотношение сплайсинга 30 было преимущественно смещено в сторону секретируемого антитела.
Присутствие дополнительного поли(А)-сайта в интроне иммуноглобулина ц мыши в первичном транскрипте, как было продемонстрировано, оказывает влияние на событие альтернативного сплайсинга, что приводило к получению большей фракции
секретируемого продукта (Galli et al., 1987) и меньшей - экспонированного на мембране антитела. На основании данного результата поли(А)-сайт SV40 вводили с 3'-конца от стоп-кодона секретируемого полипептида и с 5'-конца от точки разветвления интрона с целью смещения соотношения сплайсинга в сторону секреции антитела. С добавлением 5 поли(А)-сайта S V 40 в интрон уровень секреции антитела был значительно увеличен для конструкции М1М2 по сравнению с исходной 14 (см. фигуру 7). Наряду с этим фракция экспонированного на мембране антитела в случае конструкции М1М2 (см. фигуру 6С) была увеличена. Поскольку окрашивание клеток В7-1 уже было очень высоким, невозможно было сделать выводы относительно влияния поли(А) на экспонирование на 10 мембране (см. фигуру 60).
Сайт терминатора гастрина (который, как сообщается, терминирует транскрипцию мРНК) вводили непосредственно с 3'-конца от поли(А)-сайта кассеты экспрессии во избежание нарушения событий сплайсинга с другими акцепторами сплайсинга 15 поблизости от кассеты экспрессии. Конструкция терминатора гастрина увеличивала фракцию экспонированного на мембране антитела, в особенности в случае конструкции на основе М1М2 (фигура 6D), но не приводила к значительному увеличению уровня секреции. И вновь в случае клеток В7-1 сделать выводы было невозможно (фигура 6Р).
20 Альтернативный сплайсинг и, следовательно, мембраносвязанная экспрессия части суммарного продуцированного антитела, как представляется, оказывает отрицательное влияние на общие титры секретируемого IgG. Несмотря на это, трансмембранная область М1М2 (также в комбинации с трансмембранным доменом PTCRA) и, в особенности, трансмембранная область В7-1 обеспечили до 80% уровня секреции контрольной
25 конструкции без альтернативного сплайсинга (см. фигуру 7). Более того, было обнаружено, что добавление в интрон поли(А)-сигнала является благоприятным для секреции IgG и одновременно поддерживает значительную степень окрашивания на мембране клетки. С другой стороны, терминатор гастрина оказывал лишь незначительное влияние на секрецию по сравнению с соответствующими эталонными
30 конструкциями (см. фигуру 7).
В предыдущих экспериментах различные модификации последовательности интрона продемонстрировали аналогичное влияние на эффективность альтернативного сплайсинга, вне зависимости от трансмембранной области конструкции. Вследствие
этого трансмембранную область В7-1 выбрали для дальнейшей характеризации влияния модификации последовательности интрона на соотношение альтернативного сплайсинга и уровень секреции антитела, поскольку использование данной области приводило к максимальным уровням окрашивания.
С целью уменьшения количества экспонированного на поверхности клетки антитела и восстановления уровня экспрессии контрольной конструкции соотношение сплайсинга было изменено в сторону секретируемого продукта, т.е. сайты донора сплайсинга и акцептора сплайсинга были ослаблены.
10 Поли(У)-участок, присутствующий в консенсусной последовательности акцептора сплайсинга, как известно, оказывает важное влияние на силу акцептора сплайсинга (чем короче поли(У)-участок, тем слабее акцепторный сайт сплайсинга). В предшествующем эксперименте было показано, что полное снижение содержания У в поли(У)-участке до нуля устраняет экспонирование антитела на поверхности клетки.
15 Поли(У)-участок нативного интрона 4 TNT курицы содержит 27 У. Клетки CHO-S трансфицировали рядом конструкций с модифицированными интронами, содержащими уменьшенные количества У в поли(У)-участке, описанными ранее (SEQ Ш N0: 53, 55, 59-63). После поверхностного окрашивания и оценки уровня экспрессии с применением прибора Octet и биосенсоров на основе белка А можно однозначно определить влияние
20 поли(У)-участка на экспонирование антитела на поверхности клетки: менее 9Y в поли(У)-участке резко уменьшали процент окрашенных клеток (см. фигуру 8 А, В, С, D, Е, F, G, Н), а также интенсивность окрашивания (см. фигуру 8 А, В, С, D, Е, F, G, J). К сожалению, данное уменьшение экспонирования на поверхности клеток не оказывало влияния на общий уровень экспрессии, который оставался для каждой конструкции
25 более низким, чем у контроля (см. фигуру 8 I).
Другим способом увеличения соотношения сплайсинга в сторону секретируемого продукта является уменьшение силы донора сплайсинга на 5'-конце альтернативно сплайсированного интрона посредством изменения последовательности ДНК донора 30 сплайсинга. Можно получить две различные конструкции ДНК (SD CCC, SEQ Ш N0 58 и SD_GGC, SEQ Ш NO 57), кодирующие ту же аминокислотную последовательность, что и исходная конструкция, воспользовавшись преимуществом альтернативных кодонов, кодирующих одни и те же аминокислоты.
В то время как первая модификация консенсусной последовательности донора сплайсинга (SDCCC, SEQ ID N0 58) не оказывала эффекта на процент окрашенных клеток, интенсивность окрашивания или уровень экспрессии (см. фигуру 9), вторая модификация (SD GGC, SEQ ГО N0 57) вызвала резкое уменьшение экспонирования на 5 поверхности (как процента, так и интенсивности, см. фигуру 9 С, D и F). Данное уменьшение экспонирования на поверхности коррелировало с однозначным увеличением титра экспрессии до уровня контроля без альтернативного трансмембранного домена (см. фигуру 9Е). Более того, несмотря на то, что экспонирование на поверхности клетки резко уменьшалось по сравнению с нативной 10 последовательностью интрона 4 TNT курицы, по сравнению с контролем без трансмембранного домена наблюдалось значительное окрашивание (см. фигуру 9С).
Заключение
Терминатор гастрина увеличивал фракцию клеток, положительно окрашенных в 15 отношении IgG на мембране клетки, в особенности в случае конструкции М1М2, но не приводил к более высокой экспрессии секретируемого IgG по сравнению со стандартной конструкцией. Вставка дополнительного поли(А) в интрон увеличивала фракцию экспонированного на мембране антитела в конструкциях М1М2 (в случае В7-1 сделать заключение было невозможно). Конструкция М1М2 с дополнительным поли(А) также 20 продемонстрировала высокие уровни секретируемого IgG (до 80% от экспрессии несплайсированных контрольных конструкций).
Уменьшение поли(У)-участка, как ожидалось, ослабило акцептор сплайсинга и уменьшило экспрессию экспонированного на мембране варианта сплайсинга. Данный
25 факт подтверждался для всех четырех различных основных конструкций (М1М2, PTCRA, M1M2-PTCRA и В7-1). Более того, было установлено, что уровень экспонирования на поверхности напрямую коррелировал с длиной поли(У)-участка, что иллюстрируют примеры с трансмембранным доменом В7-1. Было обнаружено, что в данном контексте минимум 5Y в поли(У)-участке необходимы для значительного
30 поверхностного окрашивания. Наряду с этим увеличение уровней экспрессии секретируемого антитела не могло быть обнаружено. Следовательно, смещение альтернативного сплайсинга не способствовало накоплению секретируемого продукта. Неожиданно было установлено, что специфичная модификация консенсусной последовательности донора сплайсинга позволила уменьшить уровень поверхностного
окрашивания и при этом увеличить уровень секретируемого антитела. Уровень экспонирования на поверхности был достаточно низким, но все еще значительным по сравнению с контрольной конструкцией; было обнаружено, что уровень секреции был таким же, как в случае контроля.
Авторы настоящего изобретения считают, что частота события альтернативного сплайсинга определяется силой донорного сайта сплайсинга. Если соответствующий акцептор сплайсинга является достаточно сильным (более 5Y в поли(У)-участке), альтернативный сплайсинг приведет к образованию альтернативной мРНК, кодирующей
10 конструкцию с трансмембранной областью, - следовательно, экспонированную на мембране. Если акцептор сплайсинга ослаблен в результате уменьшения количества У в поли(У)-участке до менее 5Y, событие сплайсинга будет являться менее эффективным, и альтернативная пре-мРНК может деградировать, тогда как влияние на несплайсированную мРНК и, следовательно, на уровень секреции будет отсутствовать.
15 В соответствии с этим после ослабления акцептора сплайсинга наблюдалось меньшее экспонирование на мембране, однако влияние на уровень секреции отсутствовало. С другой стороны, уменьшение силы донора сплайсинга может уменьшить частоту события альтернативного сплайсинга. Вследствие этого больше мРНК кодирует секретируемый продукт несплайсированной мРНК, что приводит к наблюдаемому
20 увеличению количества секретируемого антитела. Сильный акцептор сплайсинга приводит к эффективному альтернативному сплайсингу мРНК, но с меньшей частотой в связи со слабым донором сплайсинга, чем можно объяснить наблюдаемое значимое, но слабое экспонирование на мембране.
25 В целом, модификации последовательностей донора сплайсинга и/или акцептора сплайсинга позволили провести модуляцию как уровня экспонирования на поверхности, так и уровня секреции антитела до уровня секреции антитела, экспрессируемого без альтернативного сплайсинга. Вследствие этого представленные конструкции позволяют осуществлять тонкую настройку экспонирования и секреции до желаемых уровней
30 посредством корректирования эффективности альтернативного сплайсинга.
Galli Gl, Guise J, Tucker PW, Nevins JR (1988). Poly(A) site choice rather than splice site choice governs the regulated production of IgM heavy-chain RNAs. Proc Natl Acad Sci USA. Apr;85(8):2439-43.
Пример 4: Влияние трансмембранной области на экспонирование на поверхности клетки
Введение
5 Систему альтернативного сплайсинга для экспонирования фракции антитела, продуцированного клетками, на мембране можно изменить посредством изменения характеристик трансмембранной области. Например, можно предположить, что длина и структура трансмембранного домена может влиять на эффективность экспонирования на мембране. Более того, цитозольный хвост трансмембранной области может оказывать 10 влияние на экспонирование на поверхности клетки посредством наличия или отсутствия сигнала экспорта из ЭР. В следующем примере авторы настоящего изобретения продемонстрировали, что ни аминокислотный состав трансмембранного домена, ни его длина, ни цитозольный хвост трансмембранной области не оказывают решающего влияния на экспонирование на поверхности и секрецию.
Материалы и методы Трансфекции
Суспензию клеток CHO-S трансфицировали векторами экспрессии с применением полиэтиленимина (JetPEI(r), Polyplus-transfection, Илькирш, Франция) в формате
20 биореактора с объемом пробирки 50 мл (Tubespins, ТРР). С данной целью клетки, которые находились в экспоненциальной фазе роста, высевали при плотности 2 Е6 клеток/мл в 5 мл среды OptiMEM (№31985-047, Invitrogen). К клеткам добавляли комплекс МРЕГ(r):ДНК в массовом соотношении 3 (мкг/мкг). Конечная концентрация ДНК в суспензии клеток составляла 2,5 мкг/мл. Через 5 часов инкубации при
25 температуре 37°С при встряхивании (200 об./мин.) к суспензии клеток добавляли 5 мл свежей культуральной среды. Затем клетки инкубировали на встряхиваемой платформе при температуре 37°С при содержании СО2 5% и влажности 80%.
Поверхностное окрашивание 30 Поверхностное окрашивание клеток проводили в день 1 после трансфекции. Суммарно собирали 1 Е5 клеток и переносили в круглодонную лунку 96-луночного планшета. Клетки дважды промывали промывочным буфером (2% ЭБС в ФБР), а затем ресуспендировали в 100 мкл промывочного буфера, содержащего детектирующее антитело. Специфичное обнаружение тяжелой цепи проводили с применением антитела
козы против IgG человека, конъюгированного с ФЭ (№512-4998-82, eBioscience), который возбуждали голубым лазером (488 нм) и обнаруживали в спектральной области 583/26 нм. Через 20 мин. инкубации в темноте при комнатной температуре клетки один раз промывали промывочным буфером и ресуспендировали в 200 мкл промывочного 5 буфера для анализа методом проточной цитометрии. Клетки анализировали на проточном цитометре Guava (Merck Millipore) или FACSCalibur (Becton Dickinson). Уровень временной экспрессии секретируемых молекул измеряли в день 4-6 после трансфекции с применением прибора Octet QK (Fortebio, Menlo Park, CA) и биосенсоров на основе белка А.
Результаты
Клетки CHO-S трансфицировали, как описано в разделе "Материалы и методы", с применением вектора экспрессии pGLEX41_LC (SEQ Ш NO: 294), экспрессирующего легкую цепь, и второго вектора, кодирующего тяжелую цепь с различными 15 трансмембранными областями. В качестве контроля использовали секретируемую тяжелую цепь без альтернативного сплайсинга (SEQ Ш N0: 48), в качестве положительного контроля использовали конструкцию с трансмембранной областью В7-1 (SEQIDNO: 55).
20 После трансфекции клетки окрашивали, как описано в разделе "Материалы и методы", и анализировали методом проточной цитометрии.
Длина и состав трансмембранного домена
С целью анализа влияния трансмембранного домена на экспонирование на поверхности 25 клетки и уровни секреции антитела трансмембранный домен В7-1 заменяли трансмембранными доменами аналогичной длины (22 - 23 аминокислоты), содержащими исключительно гидрофобные остатки (см. SEQ Ш NO: 81-86). Замена трансмембранного домена не оказывала влияния на экспонирование на поверхности клетки или секрецию антитела (см. фигуру 10).
Когда трансмембранный домен В7-1 заменяли трансмембранными доменами аналогичной длины (21 - 24 аминокислоты), содержащими не только гидрофобные остатки, но также полярные или заряженные остатки (SEQ Ш NO: 87-93), влияния на экспонирование на поверхности или на секрецию не наблюдалось, за исключением
транс мембранного домена, полученного из PTCRA (SEQ Ш NO: 93). Данный трансмембранный домен не вызывал изменения фракции клеток, экспонирующих продукт на поверхности клетки, но резко уменьшал поверхностную плотность продукта без какого-либо влияния на уровень секреции (см. фигуру 11 Н, J, К и L). 5 Трансмембранные домены окружены гидрофобной липидной фазой. Затраты энергии на введение ионогенной группы в гидрофобное окружение мембраны очень высоки, вследствие этого должна наблюдаться стойкая тенденция против заряженных аминокислот в трансмембранном домене (White and Wimley, 1999). Статистический анализ трансмембранной спирали подтвердил, что трансмембранные домены
10 образованы преимущественно гидрофобными остатками аминокислот, в частности, в гидрофобном ядре трансмембранной области (Beza-Delgado, 2012). Основываясь на данных наблюдениях, авторы настоящего изобретения поставили целью определить влияние трех заряженных остатков (R8, К13 и D18, нумерация начинается от начала трансмембранной спирали) в трансмембранном домене PTCRA на наблюдаемую слабую
15 интенсивность окрашивания. Разрабатывали несколько конструкций PTCRA, в которых различные заряженные остатки заменяли аминокислотой валином (одна из четырех наиболее часто встречающихся аминокислот в трансмембранном домене (Baeza-Delgado et al., 2012)), после чего указанными конструкциями трансфицировали клетки CHO-S (SEQ Ш N0: 94-100). Результаты данной трансфекции подтвердили влияние заряженных
20 остатков на интенсивность окрашивания поверхности. Мутация одной аминокислоты R8V (SEQ ID NO: 94), K13V (SEQ ГО NO: 95) или D18V (SEQ ГО NO: 96) позволила значительно увеличить плотность экспонированного на поверхности антитела, но не оказывала значительного влияния на уровень секреции антитела (см. фигуру 12 В, С, D и J). Как и ожидалось, исходя из результатов единичных мутаций, комбинации 2
25 мутантаных заряженных остатков (R8V и K13V (SEQ ГО NO: 97), R8V и D18V (SEQ ГО NO: 98) или K13V и D18V (SEQ ГО NO: 99)) продемонстрировали такой же уровень экспонирования на поверхности и аналогичный уровень секреции, что и трансмембранный домен PTCRA (см. фигуру 12 Е, F, G и J). Наконец, мутация всех трех заряженных остатков на валин (SEQ ГО NO: 100) привела, как и ожидалось, к высокой
30 степени экспонирования на поверхности по сравнению с контролем. Неожиданно было установлено, что уровень экспрессии секретируемого антитела, а также процент окрашенных клеток в случае данной конструкции являлся незначительно меньшим (см. фигуру 12 Н и J). Причина уменьшения уровней секреции и окрашивания на сегодняшний день неизвестна.
Когда трансмембранный домен В7-1 заменяли более короткими трансмембранными доменами (17 - 19 аминокислот), содержащими не только гидрофобные остатки, но также полярный или заряженный остатки (SEQ Ш N0: 101-103), можно было 5 обнаружить различные эффекты. Полученные результаты представлены на фигуре 13. При том, что трансмембранные домены FCERA (SED Ш NO: 101) и KI2L2 (SEQ ID N0: 102) оказывали минимальный отрицательный эффект на процент окрашенных клеток (фигура 13 В, С и Е), лишь трансмембранный домен, полученный из FCERA, оказывал отрицательное влияние на интенсивность окрашивания (фигура 13 С и G). Более того,
10 оба трансмембранных домена (FCERA и KI2L2) оказывали минимальный благоприятный эффект на уровень секреции (фигура 13F). С другой стороны, в случае трансмембранного домена из IL3RB (SEQ ГО NO: 103) не наблюдалось изменений по сравнению с эталонной конструкцией В7-1 относительно процента окрашенных клеток и уровня секреции (фигура 13 D, Е и F), и было зафиксировано лишь незначительное
15 уменьшение интенсивности окрашивания (фигура 13 G). Данный факт делает короткие трансмембранные домены потенциальным инструментом для тонкой настройки продукта экспонирования на поверхности.
Когда трансмембранный домен В7-1 заменяли более длинными трансмембранными 20 доменами, содержащими не только гидрофобные остатки, но также полярные или заряженные остатки (SEQ ГО NO: 104-107), отсутствовал эффект как на процент окрашенных клеток, так и на интенсивность окрашивания по сравнению с эталонной конструкцией с трансмембранным доменом В7-1 (см. фигуру 14 В, С, D, Е, F и Н). Несмотря на это секреция в случае всех данных трансмембранных доменов являлась 25 незначительно лучшей, чем в случае В7-1 (см. фигуру 14 G).
С целью оценки влияния длины трансмембранного домена более определенным образом без переключения с одного трансмембранного домена на другой разрабатывали конструкции с модифицированными трансмембранными доменами В7-1. Несколько 30 гидрофобных аминокислот удаляли из гидрофобного центра трансмембранного домена В7-1 или добавляли в данный центр (SEQ ГО NO: 108-111). Укорачивание В7-1 до 18 аминокислот (SEQ ГО NO: 108) являлось благоприятным в отношении процента окрашенных клеток, но незначительно отрицательным в отношении интенсивности окрашивания (см. фигуру 15 В, F и Н). Три другие конструкции (20 (SEQ ГО NO: 109), 24
(SEQ Ш NO: ПО) и 26 (SEQ Ш NO: 111) аминокислот, соответственно) не оказывали значительного влияния на процент окрашенных клеток или интенсивность окрашивания (см. фигуру 14 С, D, Е, F и Н). Относительно уровня секреции было установлено, что укорачивание длины трансмембранного домена является благоприятным, тогда как 5 конструкции с удлиненным трансмембранным доменом продемонстрировали сравнимый уровень секреции, что и конструкции с нативным В7-1 (см. фигуру 14G). В целом, более короткий трансмембранный домен, как представляется, является благоприятным в отношении процента окрашенных клеток и в отношении секреции антитела, несмотря на то, что интенсивность окрашивания может незначительно 10 уменьшаться по сравнению с более длинными трансмембранными доменами.
Цитозольный хвост
Литературные данные свидетельствуют о наличии структурного нелинейного сигнала экспорта из ЭР в цитозольном хвосте В7-1 (Lin et al., 2013). Авторы настоящего
15 изобретения установили, что наличие сигнала экспорта из ЭР в цитозольном домене трансмембранного белка, нацеленного на поверхность клетки, должно оказывать положительное влияние на количество белка на поверхности клеток. В случае белка с высокой степенью метаболизма ускоренный экспорт из ЭР к мембране может компенсировать протеолитическое расщепление в плазматической мембране.
20 С целью оценить, имеет ли отношение сигнал экспорта из ЭР к экспонированию на мембране в разработанной системе, цитозольный хвост В7-1 заменяли цитозольными хвостами нескольких трансмембранных белков, которые, как известно, содержат сигнал экспорта из ЭР, и делеционными мутантами без сигнала экспорта из ЭР (SEQ Ш N0: 112 - 124).
25 Как представлено на фигуре 16 Р, было установлено, что отсутствие сигнала экспорта из ЭР оказывает незначительный благоприятный эффект на уровень секретируемого антитела, тогда как значительное влияние на процент окрашенных клеток (фигура 16 В-N и О) и интенсивность окрашивания (фигура 16 B-N и Q) отсутствовало. Следовательно, предложенное антитело, экспонированное на мембране, может не подвергаться
30 быстрому метаболизму.
В дополнение к данным конструкциям проводили замену цитозольного хвоста М1М2 цитозольным хвостом В7-1 в трансмембранном домене М1М2 (SEQ Ш NO: 125). Как представлено на фигуре 17 Е, данная замена незначительно увеличивала интенсивность
флуоресценции, но не оказывала влияния ни на процент окрашенных клеток (фигура 17 С), ни на уровень секреции (фигура 17 D).
Заключение
5 Взятые вместе, полученные данные свидетельствуют, что длина или аминокислотный состав трансмембранных доменов в предложенной системе на основе альтернативного сплайсинга оказывают лишь минимальное влияние на уровень секреции антител и экспонирование продукта на мембране клетки. Наблюдалось незначительное смещение соотношения от секретируемого продукта в сторону продукта, экспонированного на
10 мембране, которое можно использовать для тонкой настройки системы на основе альтернативного сплайсинга. Все конструкции обеспечивали значительное экспонирование антитела на поверхности, а также соответствующие уровни секреции. Интересно отметить, что наблюдалось значительное влияние трансмембранного домена на уровень флуоресценции экспонирования на поверхности клетки. Присутствие или
15 отсутствие гидрофобных аминокислот позволило контролировать среднюю флуоресценцию и при этом не оказывало влияния на уровень секреции или процент клеток, демонстрирующих экспонирование на поверхности клетки. Сигнал экспорта из ЭР в цитоплазматическом хвосте, как было установлено, не является необходимым для экспонирования контрольного антитела на поверхности клетки.
20 Минимального цитоплазматического хвоста, содержащего линкер глицин-аланин и 6 гистидинов или первые 5 аминокислот хвоста В7-1, было достаточно для экспонирования на поверхности клетки. Данное наблюдение может не являться справедливым в отношении других антител или белков, которые подвергаются быстрому метаболизму. Таким образом, цитозольный хвост может представлять собой интересный
25 инструмент для корректировки экспонирования белка, представляющего интерес, на поверхности.
Взятые вместе, данные, полученные в примерах 2-4, свидетельствуют, что на уровень экспонирования на поверхности и уровень секреции влияют различные 30 последовательности, вовлеченные в альтернативный сплайсинг и интеграцию мембраносвязанного белка в мембране. В то время как специфичная модификация донорного сайта сплайсинга обеспечивала восстановление того же уровня секреции, что и у контрольной альтернативно несплайсированной конструкции (см. пример 3 фигура 9), поверхностное окрашивание значительно уменьшалось с применением
трансмембранной области В7-1. С другой стороны, добавление поли(А) SV40 в интрон с применением транс мембранной области М1М2 увеличивало уровни как секреции, так и экспонирования на поверхности (см. пример 3, фигуры 6 и 7). Более того, модификации трансмембранных доменов В7-1, такие как уменьшение В7-1 до 18 или 20 аминокислот 5 (см. фигуру 15), оказывали положительное влияние как на уровень секреции, так и на уровень экспонирования на поверхности. Наконец, замена цитозольного хвоста В7-1 цитозольным хвостом, не содержащим сигнала экспорта из ЭР, такого как 6His или KCFCK, также улучшала как экспонирование на поверхности, так и уровни секреции. Наконец, влияние терминатора гастрина на конце кассеты экспрессии на экспрессию 10 являлось положительным, и, возможно, даже более благоприятным при размещении в интроне. Вследствие этого конструкции, объединяющие данные различные свойства, могут являться еще более благоприятными, что обеспечит лучший уровень секреции в сочетании с высоким динамическим диапазоном экспонирования на поверхности клетки, желаемым для отбора клеток.
Скелетом данных конструкций является pGLEX41 (GSC281, SEQ Ш NO: 304), и последовательности последних 5 аминокислот несплайсированной ОРС на конце экспрессирующей конструкции приведены в виде последовательностей ДНК, а также последовательностей белка, начиная от тех же аминокислот, со слитой трансмембранной 20 областью, в виде последовательности белка в Error! Not a valid bookmark self-reference..
Публикации:
Lin, Y., Chen, В., Wei-Cheng Lu, W., Chien-I Su, C, Prijovich,Z., Chung, W., Wu, P., Chen, K., Lee, I., Juan, T and Roffler, S. (2013). The B7-1 Cytoplasmic Tail Enhances Intracellular 5 Transport and Mammalian Cell Surface Display of Chimeric Proteins in the Absence of a Linear ER Export Motif PLoS One. Sep 20;8(9)
Baeza-Delgado, CI, Marti-Renom, MA, Mingarro, I. (2012). Structure-based statistical analysis of transmembrane helices. Eur Biophys J. 2013 Mar;42(2-3): 199-207 White, SH and Wimley, WC. (1999). Membrane protein folding and stability: physical 10 principles. Annu Rev Biophys Biomol Struct. 28:319-65.
Пример 5: Качественное прогнозирование секреции продукта с применением альтернативного сплайсинга для экспонирования на поверхности
Введение
15 Трансфекция клеток является начальным этапом для установления стабильной клеточной линии с целью экспрессии рекомбинантного белка. По многим причинам (гетерогенность исходной популяции клеток, различные локусы интеграции плазмид в геном, различный посттрансляционный аппарат и эпигенетическая регуляция экспрессии) данный этап, как правило, приводит к гетерогенности популяций клеток в
20 отношении экспрессии и уровня секреции, а также свойств качества продукта, таких как фолдинг белка, гликозилирование и другие посттрансляционные модификации. Биспецифичные антитела образованы четырьмя или менее различными субъединицами (2 тяжелые цепи и 2 легкие цепи), которые могут собираться во всех возможных комбинациях. В зависимости от интеграции плазмиды, регуляции транскрипции и
25 трансляции, а также эффективности фолдинга в ЭР, конкретный клон может секретировать предпочтительно правильно собранный продукт вместо нежелательных побочных продуктов. Отбор клона с данным желаемым характером секреции требует проведения крупномасштабного скрининга и характеризации секретируемых белков. Уменьшение длительности скрининга, необходимого для получения клеточной линии,
30 которая продуцирует продукт, представляющий интерес, и минимальное количество побочных продуктов, станет значительным достижением.
Ранее в примерах 2-4 было продемонстрировано, что с применением технологии альтернативного сплайсинга фракцию секретируемого белка можно отклонить от
секреторного пути для экспонирования на мембране клетки. Также было показано, что специфичное обнаружение белков, экспонированных на мембране клетки, возможно посредством проточной цитометрии.
5 Целью данного примера являлась демонстрация того, что характер экспонирования продукта на мембране клетки позволяет спрогнозировать профиль секреции клона. Для достижения данной цели в качестве модели использовали гетеротримерное биспецифичное антитело BEAT(r), представленное в примере 2. Данная молекула связывается с двумя различными растворимыми молекулами, далее называемыми
10 "Мишенью 1" и "Мишенью 2". Схематичное изображение молекулы можно найти на фигуре 18, структура А. Далее данную молекулу сокращенно называют "ВЕАТ". После трансфекции секретируются не только молекулы BEAT, но также моноспецифичный димер тяжелая цепь - легкая цепь, связывающийся с "Мишенью 1". Данную молекулу называют гомодимером Fab (сокращенно "Fab-DJJVI"). Второй побочный продукт
15 представляет собой моноспецифичный гомодимер scFv-Fc (сокращенно "scFv-Fc-DFM"), связывающийся с "Мишенью 2". Данные побочные продукты представлены на фигуре 18 в виде структур В и С.
После стабильной трансфекции клеток векторами экспрессии pGLEX41_BEAT-HC-I4-20 М1М2-М1М2-М1М2 (SEQ Ш NO: 50), pGLEX41_scFv-Fc-I4-MlM2-MlM2-MlM2 (SEQ Ш NO: 52) и pGLEX41 BEAT-LC (SEQ Ш NO: 302) или pGLEX41 BEAT-LC (SEQ Ш NO: 302), pGLEX41_scFv-Fc-I4-B7-B7-B7 (SEQ Ш NO: 323) и pGLEX41_BEAT-HC-I4-B7-B7-B7 (SEQ Ш NO: 321) клоны подвергали скринингу посредством поверхностного окрашивания. Для характеризации поверхностного фенотипа клеток использовали два 25 подхода. Согласно первому подходу проводили двойное поверхностное окрашивание легкой цепи и Fc-фрагментов. Хотя данное окрашивание не позволяло проводить обнаружение всех продуцированных форм (различие между BEAT и Fab-DFM отсутствовало), данный подход позволил обнаружить моноспецифичное загрязняющее вещество scFv-Fc-DFM. Данный способ является универсальным для молекул BEAT 30 любого типа. Второй подход являлся более специфичным и включал использование растворимых мишеней для обнаружения соответствующих связывающих плеч. В данном случае все три возможных продукта были однозначно обнаружены посредством поверхностного окрашивания.
Рекомбинантные пулы и клоны были получены посредством предельного разведения и сортировки клеток методом проточной цитометрии, соответственно. Проводили периодическое культивирование или культивирование с подпиткой, и продукт, накопленный в супернатантах, анализировали методом капиллярного электрофореза. В 5 конечном счете в супернатанте измеряли профиль секреции (фракция BEAT, Fab-DFM или scFv-Fc-DIM) по сравнению с профилем продукта, экспонированного на мембране рекомбинантных клеток.
Материалы и методы
10 Установление стабильных пулов
Стабильно трансфицированные клетки СНО получали посредством котрансфекции клеток ранее описанными векторами pGLEX41_BEAT-HC-I4-MlM2-MlM2-MlM2 (сокращенно "рНС-М1М2"; SEQ ID N0: 50), pGLEX41_scFv-Fc-I4- М1М2-М1М2-М1М2 (сокращенно "pscFv-Fc-MlM2"; SEQ ГО NO: 52) и pGLEX41 BE AT-LC (сокращенно
15 "pLC"; SEQ ID N0:302) для экспрессии биспецифичного гетеродимера BEAT вместе с двумя запатентованными векторами для экспрессии белка, обеспечивающими устойчивость к антибиотикам пуромицину и генетицину, соответственно. Суспензию клеток CHO-S трансфицировали линеаризированными векторами с применением полиэтиленимина (JetPEI(r), Polyplus-transfection, Илькирш, Франция) в
20 формате биореактора с объемом пробирки 50 мл. С данной целью клетки, которые находились в экспоненциальной фазе роста, высевали при плотности 2 Е6 клеток/мл в 5 мл среды OptiMEM (№31985-047, Invitrogen). К клеткам добавляли комплекс JetPEI(r):nHK в массовом соотношении 3 (мкг/мкг). К клеткам добавляли ДНК в конечной концентрации 2,5 мкг/мл. Через 5 часов инкубации клеток с комплексом МРЕГ(r):ДНК
25 при температуре 37°С при встряхивании (200 об./мин.) к суспензии клеток добавляли 5 мл культуральной среды PowerCH02 (№BE12-771Q, Lonza). Затем клетки инкубировали на встряхиваемой платформе при температуре 37°С при содержании СО2 5% и влажности 80%. Через один день после трансфекции клетки высевали в 96-луночных планшетах в различных концентрациях (0,7, 0,5 и 0,4 Е5 клеток/мл) в селективной среде,
30 содержащей пуромицин (№P8833-25mg, Sigma) и генетицин (№11811-098, Gibco) в концентрациях, обеспечивающих рост стабильных пулов. Через 14 дней отбора в статических условиях из лунок отбирали 15 продуцирующих стабильных пулов и переносили в биореакторы TubeSpin.
Установление рекомбинантных клонов
Клоны получали посредством котрансфекции клеток ранее описанными векторами pGLEX41_BEAT-HC-I4-B7-B7-B7 (сокращенно "рНС-В7"; SEQ ID N0: 321), pGLEX41_scFv-Fc-I4-B7-B7-B7 (сокращенно "pscFv-Fc-B7"; SEQ ГО N0: 323) и 5 pGLEX41 BE AT-LC (сокращенно "pLC"; SEQ ID NO: 302) для экспрессии биспецифичного гетеродимера BEAT вместе с двумя запатентованными векторами для экспрессии белка, обеспечивающими устойчивость к антибиотикам пуромицину и генетицину, соответственно.
Трансфекцию и отбор стабильных трансфектантов проводили, как было описано ранее. 10 Через 14 дней отбора в статических условиях всех стабильных трансфектантов собирали, объединяли и перевивали в динамических условиях (орбитальное встряхивание) в течение недели. Сортировку отдельных клеток проводили с применением прибора FACSAria II посредством отбора живых клеток и исключения дублетов клеток в результате преобразования импульсов.
Окрашивание LC и Fc продукта, экспонированного на поверхности клетки Двойное поверхностное окрашивание легкой цепи (LC) и Fc-фрагмента на стабильных клетках проводили в день 2 после высевания серии, как подробно описано в примере 2. Вкратце, суммарно собирали 1 Е5 клеток и переносили в круглодонную лунку 9620 луночного планшета. Клетки дважды промывали промывочным буфером (ФБР, содержащий 2% ЭБС), а затем ресуспендировали в 100 мкл детектирующего антитела. Специфичное обнаружение легкой цепи каппа проводили с применением антитела мыши против LC каппа человека, меченного АФЦ (№561323, BD Pharmingen), Fc-фрагменты обнаруживали с применением специфичного антитела козы против Fc-гамма человека, 25 конъюгированного с ФЭ (№12-4998-82, eBioscience). Через 20 мин. инкубации в темноте при комнатной температуре клетки один раз промывали промывочным буфером и ресуспендировали в 200 мкл буфера для анализа методом проточной цитометрии. Клетки анализировали на проточном цитометре Guava (Merck Millipore).
30 Окрашивание специфичных связывающих сайтов, экспонированных на поверхности клеток
В случае данного окрашивания для обнаружения связывающих плеч молекулы, экспонированной на поверхности клетки, использовали растворимые мишени. Вкратце, суммарно собирали 1 Е5 клеток и переносили в круглодонную лунку 96-луночного
планшета. Клетки дважды промывали промывочным буфером (ФБР, содержащий 2% ЭБС), а затем ресуспендировали в 100 мкл смеси биотинилированной Мишени 1 и Мишени 2, меченной меткой His. Через 20 мин. инкубации в темноте при комнатной температуре клетки дважды промывали промывочным буфером и ресуспендировали в 5 100 мкл смеси, содержащей стрептавидин, конъютированный с АФЦ (№554067, BD Pharmingen), и антитело против метки His, меченное ФЭ (№IC050P, RD Systems). Через 20 мин. инкубации в темноте при комнатной температуре клетки один раз промывали промывочным буфером и ресуспендировали в 200 мкл буфера для анализа методом проточной цитометрии на проточном цитометре Guava (Merck Millipore).
Анализ профиля секреции клетки
Рекомбинантные пулы высевали в биореаторы TubeSpin при плотности клеток 0,5 Е6 клеток/мл в среде роста с добавками (PowerCH02, 2 мМ L-Глутамин, 8 мМ Glutamax (Life Technologies, Карлсбад, Калифорния), 15% Efficient Feed A (Life Technologies), 15%
15 Efficient Feed В (Life Technologies). Клоны высевали в биореаторы TubeSpin при плотности клеток 0,5 Е6 клеток/мл в среде роста (PowerCH02, 2 мМ L-Глутамин), и ежедневно проводили подпитку ActiCHO Feed А & В (№U050-078, РАА Laboratories GmbH). В день 14 супернатанты культур периодического культивирования или культивирования с подпиткой собирали посредством центрифугирования и фильтровали
20 с применением шприцевого фильтра с размером пор 0,2 мкм (№99722 ТРР). Неочищенные супернатанты непосредственно анализировали или очищали с применением бусин с белком A Streamline (№17-1281-02, GE). Белки анализировали с применением системы для анализа белка Caliper LabChip GXII. Различные формы обнаруживали на основании молекулярной массы, и определяли фракцию каждого
25 продукта.
Результаты
После трансфекции конструкциями рНС-М1М2, pScFv-Fc-MlM2 и pLC в сумме было получено 15 стабильных пулов. Культивирование серий с подпиткой начинали с целью 30 определения профиля секреции данных пулов. Двойное поверхностное окрашивание легкой цепи и Fc-фрагментов (scFv-Fc и тяжелая цепь) в пулах проводили в день 2 после высевания серии. На фигуре 19 приведен пример профиля поверхности одного из пулов, измеренного посредством двойного окрашивания в день 2 культивирования серии с подпиткой. На точечной диаграмме представлена интенсивность окрашивания LC каппа
(ось у) по сравнению с интенсивностью окрашивания Fc человека (ось х). Квадрант определяет произвольные пределы между отрицательно и положительно окрашенными клетками. Квадрант Q8 представляет фракцию клеток, не экспрессирующих белок на мембране клетки, например, субпопуляцию непродуцентов. Q7 представляет собой 5 фракцию клеток, положительных в отношении Fc-фрагмента, но отрицательных в отношении LC каппа, то есть, фракцию, соответствующую клеткам, экспонирующим scFv-Fc-DEVI на мембране. Двойные положительные клетки, в Q6, представляют собой клетки, экспонирующие на мембране как Lc, так и Fc-фрагменты, например, молекулы BEAT или Fab-DEVI.
Анализ выявил гетерогенную популяцию клеток, состоящую из 33,8% непродуцентов (Q8), 50,3% клеток, секретирующих scFv-Fc-DEVI (Q7), и 15,8% клеток, потенциально секретирующих BEAT или Fab-DEVI (Q6). Для расчета корреляции между поверхностным окрашиванием и секретируемым продуктом учитывали исключительно
15 продуцирующую популяцию. Следовательно, фракцию продуцентов BEAT и Fab-DEVI, а также фракцию продуцентов scFv-Fc-DEVI в пределах фракции продуцирующих клеток (Q6 + Q7), рассчитывали заново, за исключением непродуцирующей фракции Q8 (данные фракции называют Q6* и Q7*). В анализе, результаты которого представлены на фигуре 17, например, популяции рассчитывали следующим образом:
20 Q6* = Q6/ (Q6+Q7) = 23,9% и Q7* = Q7/ (Q6+Q7) = 76,1%.
Данный анализ проводили для всех 15 продуцирующих стабильных пулов и использовали для получения корреляции, представленной на фигуре 20.
Фракцию продуцентов BEAT, Fab-DEVI и scFv-Fc-DEVI можно обнаружить с 25 применением поверхностного окрашивания в соответствии с экспонированием форм на мембране клетки посредством альтернативного сплайсинга. Затем результаты сопоставляли с фактическим профилем секреции анализируемых пулов. С данной целью супернатанты 15 продуцирующих стабильных пулов очищали в день 14 с применением белка А, и каждую секретируемую молекулу обнаруживали на основании молекулярной 30 массы и количественно определяли с применением системы для анализа белка Caliper LabChip GXII. Следует отметить, что в данных условиях очистки лишь формы, связывающие белок А, а именно молекулы BEAT и scFv-Fc-DEVI, очищаются из супернатанта, поскольку в молекулах Fab-DEVI отсутствует сайт связывания белка А. На фигуре 20 представлено соотношение между процентом секретируемых молекул и
соответствующей фракцией клеток, обнаруженной посредством поверхностного окрашивания.
Полученные данные свидетельствуют, что экспонирование на поверхности и профиль 5 секреции в высшей степени коррелируют (R2 = 0,9) как в случае секреции BEAT, так и в случае scFv-Fc-DIM. Природа данного взаимодействия, однако, является нелинейной. Отсутствие линейной регрессии можно объяснить тем фактом, что поверхностное окрашивание, проводимое в данном эксперименте, не позволяло разделять BEAT и Fab-DEVI, тогда как из очищенных секретируемых продуктов была исключена фракция Fab-
10 DEVI. Процент секретируемых BEAT и scFv-Fc-DEVI в супернатанте может быть незначительно завышен. Несмотря на это, эксперимент однозначно продемонстрировал, что, чем выше фракция клеток, положительных в отношении экспонирования конкретной молекулы на поверхности, тем большей является фракция данной молекулы в супернатанте. В данном примере фракция секретируемой молекулы BEAT
15 увеличивалась линейно, когда исследуемые стабильные пулы характеризовались процентом положительных клеток свыше 20%. Отбор стабильного пула, который содержит более 75% двойных положительных клеток (Q6), позволит осуществить отбор секретирующей популяции клеток, обеспечивающей выход желаемой молекулы BEAT более 90%. Для клональной популяции, несущей двойной положительный фенотип,
20 например, 100% популяции клеток, положительных в отношении поверхностного окрашивания как LC, так и Fc, разумно ожидать еще большую фракцию секреции BEAT, которая достигает приблизительно 100%.
С целью увеличения чувствительности способа и демонстрации линейной взаимосвязи 25 между экспонированием на поверхности и характером секреции применяли различные способы обнаружения, включая использование растворимой мишени в качестве детектирующего реактива. Таким образом, все 3 возможные продукта были однозначно обнаружены на основании характеров связывания последних. На фигуре 21 представлен пример профиля поверхности пула, измеренный перед сортировкой клеток. Точечная 30 диаграмма представляет поверхностную плотность клеток сайта связывания для Мишени 1 (ось у) по сравнению с поверхностной плотностью клеток сайта связывания для Мишени 2 (ось х). Квадрант определяет произвольные пределы между отрицательно и положительно окрашенными клетками. Q1 представляет собой фракцию клеток, положительных в отношении связывания Мишени 1, но отрицательных в отношении
связывания Мишени 2, то есть, фракцию, соответствующую клеткам, экспонирующим Fab-DEVI на мембране. Двойные положительные клетки, в Q2, представляют собой клетки, экспонирующие сайты связывания как для Мишени 1, так и для Мишени 2, на мембране клетки, и, таким образом, соответствующие клеткам, экспонирующим BEAT 5 на мембране. Q3 представляют собой клетки, экспонирующие исключительно сайты связывания для Мишени 2, и, таким образом, соответствующие scFv-Fc-DEVI. Квадрант Q4 представляет фракцию клеток, не экспрессирующих белок на мембране, например, субпопуляцию непродуцентов. Поскольку данные клетки не вносят вклад в секрецию антитела, такие клетки исключали из анализа.
10 Все продуцирующие клоны (28), полученные в результате сортировки клеток методом проточной цитометрии, после трансфекции конструкциями рНС-В7, pScFv-Fc-B7 и pLC анализировали с применением данного подхода. Как было описано ранее, фракцию продуцентов BEAT, Fab-DEVI и scFv-Fc-DEVI можно обнаружить с применением поверхностного окрашивания на основании форм, экспонированных на мембране
15 клетки, посредством альтернативного сплайсинга. Фактические профили секреции каждого клона определяли в день 14 подпитываемой культуры непосредственно в супернатанте с применением системы для анализа белка Caliper LabChip GXII. На фигуре 22 представлена корреляция между фракцией молекулы BEAT, обнаруживаемой в супернатантах, и фракцией клеток, экспонирующих фенотип BEAT
20 на своей поверхности (% от Q2). С применением данного специфичного окрашивания была получена хорошая линейная корреляция (R2 = 0,8). Полученные данные однозначно свидетельствуют, что способность клона секретировать молекулу BEAT можно прогнозировать на основании набора продуктов, обнаруженного на мембране клетки.
25 Заключение
В данном примере было продемонстрировано, что технология альтернативного сплайсинга в сочетании с экспонированием на мембране клетки является эффективной репортерной системой для качественного прогнозирования профиля секреции отдельных клеток. Однозначная корреляция была установлена между экспонированным 30 на мембране клетки набором продуктов и фактическим профилем секреции трансфицированных клеток с применением общепринятых способов обнаружения на основе поверхностного обнаружения LC и Fc или с применением способа продукт-специфичного окрашивания с помощью растворимых молекул-мишеней. Данный подход не требует ни времязатратного скрининга характеристик клеток в периодической
или подпитываемой культурах, ни сбора, очистки и крупномасштабной характеризации секретируемого продукта.
В заключении, репортерная система, описанная в настоящей заявке, обеспечивает 5 достоверный высокопроизводительный инструмент для скрининга клонов клеток, несущих конкретный профиль секреции гетеротримерных молекул.
Помимо качественного прогнозирования профилей секреции, значительный интерес представляет количественное прогнозирование уровня секреции конкретного клона 10 клеток для разработки клеточных линий. В следующем примере проводили исследование того, коррелирует ли уровень мембраносвязанного экспонированного на поверхности продукта с применением подхода альтернативного сплайсинга с уровнем секреции клона.
15 Пример 6: Количественное прогнозирование уровня секреции с применением альтернативного сплайсинга для экспонирования на поверхности
Введение
Большой проблемой процесса разработки клеточной линии является проведение отбора высокопроизводительных клонов с минимальными затратами времени, например,
20 клонов с высокой степенью секреции рекомбинантного белка хорошего качества. Ранее было продемонстрировано, что экспонирование на мембране клетки фракции экспрессированного белка посредством альтернативного сплайсинга демонстрирует фактический качественный профиль секреции клона. В данном примере будет продемонстрировано, что уровень экспонирования на мембране клетки количественно
25 коррелирует с уровнем секреции клона и что высокопроизводительные клетки можно отобрать на основе интенсивности экспонирования на поверхности.
Материалы и методы Разработка стабильной клеточной линии 30 Стабильно трансфицированные клетки СНО получали в результате котрансфекции векторами pGLEX41_HC-I4-MlM2-MlM2-MlM2 (SEQ Ш NO: 36) и pGLEX41_LC (SEQ Ш NO: 294) для экспрессии гуманизированного антитела IgGl вместе с двумя запатентованными векторами для экспрессии белка, обеспечивающими устойчивость к антибиотикам пуромицину и генетицину, соответственно.
Суспензию клеток CHO-S трансфицировали линеаризированными векторами с применением полиэтиленимина (JetPEI(r), Polyplus-transfection, Илькирш, Франция) в формате биореактора с объемом пробирки 50 мл. С данной целью клетки, которые находились в экспоненциальной фазе роста, высевали при плотности 2 Е6 клеток/мл в 5 мл среды OptiMEM (№31985-047, Invitrogen). К клеткам добавляли комплекс JetPEI(r):nHK в массовом соотношении 3 (мкг/мкг). К клеткам добавляли ДНК в конечной концентрации 2,5 мкг/мл. Через 5 часов инкубации клеток с комплексом МРЕГ(r):ДНК при температуре 37°С при встряхивании (200 об./мин.) к суспензии клеток добавляли 5 мл культуральной среды PowerCH02 (№BE12-771Q, Lonza). Затем клетки инкубировали на встряхиваемой платформе при температуре 37°С при содержании СО2 5% и влажности 80%. Через один день после трансфекции клетки высевали в 96-луночных планшетах при различных концентрациях (0,7, 0,5 и 0,4 Е5 клеток/мл) в селективной среде, содержащей 4 мкг/мл пуромицина (№P8833-25mg, Sigma) и 400 мкг/мл генетицина (№11811-098, Gibco). Через 14 дней отбора в статических условиях из лунок отбирали 15 продуцирующих стабильных пулов и наращивали в биореакторах TubeSpin для оценки уровня экспрессии.
Оценка уровня экспрессии
Серии культивирования с добавками высевали при плотности клеток 0,5 Е6 клеток/мл в PowerCH02 (№ BE12-771Q, Lonza) с добавками 2 мМ L-Глутамина, 8 мМ Glutamax, 15% Efficient Feed А (№А1023401, Invitrogen) и 15% Efficient Feed В (№А1024001, Invitrogen). Число жизнеспособных клеток (ЧЖК) и жизнеспособность контролировали в дни 1, 3 и 7 с применением анализа ViaCount на проточном цитометре Guava. Титры IgG измеряли в день 1, 3 и 7 с применением прибора Octet QK. Удельную продуктивность qP стабильных пулов рассчитывали между днем 1 и днем 3 по следующей формуле:
qP =
А1§Сдз-д1
ДЦз-д1
ЧЖК
среднее д1-дЗ
где:
qP = удельная скорость секреции или продуктивность [пг/клетку/день] IgG = титры IgG в [пг/мл] в день 3 и день 1 t = время культивирования [дни]
ЧЖКсреднее д1-дз = среднее число жизнеспособных клеток между днем 1 и днем 3 [клеток/мл]
Количественное определение IgG, экспонированных на мембране клетки, проводили в 5 день 1 в течение фазы экспоненциального роста, как описано ниже.
Окрашивание клеток
Окрашивание Fc-фрагментов на стабильных пулах проводили в день 1 после высевания серии. Вкратце, суммарно собирали 1 Е5 клеток и переносили в круглодонную лунку 9610 луночного планшета. Клетки дважды промывали промывочным буфером (ФБР, содержащий 2% ЭБС) и ресуспендировали в 100 мкл детектирующего антитела. Специфичное обнаружение Fc-фрагментов проводили с применением специфичного антитела козы против Fc-гамма человека, конъюгированного с ФЭ (№12-4998-82, eBioscience). Через 20 мин. инкубации в темноте при комнатной температуре клетки 15 один раз промывали промывочным буфером и ресуспендировали в 200 мкл буфера для анализа методом проточной цитометрии. Клетки анализировали на проточном цитометре Guava.
Сортировка клеток методом проточной цитометрии
20 Клоны получали посредством сортировки клеток методом проточной цитометрии из гетерогенного пула стабильных трансфектантов, установленных, как было описано ранее (см. раздел "Разработка стабильной клеточной линии"). С данной целью проводили поверхностное окрашивание Fc-фрагмента согласно протоколу, описанному ранее. Сортировку проводили с применением прибора FACSAria II с помощью отбора
25 живых клеток и исключения дублетов клеток в результате преобразования импульсов. Три группы были определены в соответствии с интенсивностью поверхностной флуоресценции ("низкая", "средняя" и "высокая"), и отдельные клетки переносили в 96-луночные планшеты, содержащие по 200 мкл среды клонирования. Через 2 недели роста в статических условиях клетки переносили в динамические условия, и характеристики
30 отобранных клонов оценивали, как было описано ранее.
Результаты
Анализ профиля поверхностного окрашивания стабильного пула проиллюстрирован на фигуре 23. Поверхностную флуоресценцию живых клеток, отобранных в области gl
(фигура 23, профиль А), отражали в виде гистограммы (фигура 23, график В), и вычисляли среднюю флуоресценцию распределения (среднее [ОЕФ], относительные единицы флуоресценции). Среднюю флуоресценцию используют в качестве показателя уровня IgG, экспрессированного на мембране клетки. Данный анализ проводили для всех 5 полученных стабильных пулов, и измеряли уровень поверхностного IgG по сравнению с фактическим уровнем секретируемых IgG в супернатанте.
На фигуре 24 представлена корреляция между интенсивностью поверхностной флуоресценции и уровнем секреции всех стабильных пулов, измеренным в день 1
10 культивирования с подпиткой. Хорошая корреляция (R2 > 0,8) наблюдалась между поверхностной экспрессией и титрами IgG (фигура 24, график А), а также между поверхностной экспрессией и удельной продуктивностью IgG (фигура 24, график В). Полученные данные свидетельствуют, что экспрессия на поверхности альтернативно сплайсированного трансмембранного IgG обеспечивала получение информации о
15 фактическом уровне секреции стабильно трансфицированных клеток. Подобная высокая корреляция (R2 > 0,8) наблюдалась между поверхностной флуоресценцией пулов в день 1 и объемной продуктивностью в день 7 периодического процесса культивирования (см. фигуру 25; в данной серии день 7 соответствует концу стационарной фазы). Полученные данные свидетельствуют, что характеристики пулов в конце периодического процесса
20 культивирования можно предсказать на ранних стадиях на основании обнаруженной поверхностной экспрессии IgG. При периодическом процессе культивирования физиологическое состояние клеток постоянно изменяется в соответствии с изменением окружающей среды. Вследствие этого корреляция между экспонированием на поверхности репортерного IgG посредством альтернативного сплайсинга и фактическим
25 уровнем секреции при периодическом процессе культивирования не зависит от физиологического состояния клеток (стадии экспоненциального роста или стационарной стадии) и фазы периодического процесса культивирования (роста или продукции).
Для проверки данной гипотезы клоны получали посредством сортировки клеток 30 методом проточной цитометрии в зависимости от плотности антитела, экспонированного на поверхности клеток. С данной целью проводили окрашивание стабильного пула в отношении поверхностного IgG с применением антитела против Fc человека, меченного ФЭ. В соответствии с интенсивностью поверхностной флуоресценции были определены три области ("низкая", "средняя" и "высокая"), и
отдельные клетки соответствующим образом клонировали в 96-луночных планшетах. Стратегия отбора представлена на фигуре 26А. Приблизительно через две недели клоны размножали, и поверхностную интенсивность клеток определяли снова, чтобы подтвердить, что после клонирования был получен действительно отсортированный 5 фенотип. Распределение поверхностной интенсивности всех клонов представлено на фигуре 26В. В целом, сортировка была успешной, поскольку распределение поверхностного IgG трех различных отсортированных групп соответствовало ожидаемому фенотипу с "низкой", "средней" и "высокой" флуоресценцией. Некоторые отклоняющиеся значения были обнаружены, например, в "низкой" группе,
10 демонстрирующие высокую поверхностную флуоресценцию, которые, вероятно, были вызваны артефактом при окрашивании перед сортировкой. Впоследствии характеристики полученных клонов анализировали в сериях культивирования с добавками. На фигуре 26С представлено распределение удельной продуктивности qP для каждой группы. qP исходного пула, которую также оценивали в четырех повторах,
15 приведена на диаграмме в качестве контроля. Образцы с наилучшими показателями однозначно обнаруживали в группе с "высокой" поверхностной флуоресценцией с медианой qP, составляющей приблизительно 10 пг/клетку/день. По сравнению с исходным пулом (приблизительно 5 пг/клетку/день) продуктивность была значительно улучшена в 2 - 6 раз, наилучший клон достиг показателя более 30 пг/клетку/день.
20 Напротив, клоны из "низкой" и "средней" категорий являлись, в целом, образцами с низкими характеристиками с медианой qP, близкой к 0 пг/клетку/день. Некоторые отклоняющиеся значения достигали > 20 пг/клетку/день, но данные фенотипы также продемонстрировали высокую поверхностную плотность IgG, обнаруженную методом проточной цитометрии.
Заключение
В данном примере было продемонстрировано, что уровень IgG, экспрессированного посредством альтернативного сплайсинга на мембране клетки, предоставляет информацию о фактическом уровне секреции рекомбинантных клеток. Флуоресценция 30 клеточной мембраны после специфичного обнаружения продукта коррелирует с накопленными концентрациями IgG в супернатанте и с qP трансфицированных стабильных клеток. Также было продемонстрировано, что корреляция сохранялась вне зависимости от фазы процесса периодического культивирования. Взятые вместе, полученные данные свидетельствуют, что количественный уровень секреции
рекомбинантных клеток можно прогнозировать посредством репортерной системы экспонирования на поверхности на основе альтернативного сплайсинга, описанной в настоящей заявке. Данный подход был подтвержден отбором клонов в зависимости от плотности IgG, экспонированного на поверхности клеток, с применением сортировки 5 клеток методом проточной цитометрии. Действительно, с применением данного подхода можно отобрать высокопродуктивные клетки, и можно получить клоны, демонстрирующие удельную продуктивность, которая соответствует промышленному масштабу, с минимальными затратами времени.
СПИСОК ПОСЛЕДОВАТЕЛЬНОСТЕЙ
<110> Гленмарк Фармасьютикалс С.А.
<12 0> ЭКСПРЕССИРУЮЩИЕ КОНСТРУКЦИИ И СПОСОБЫ ДЛЯ ОТБОРА КЛЕТОК-ХОЗЯЕВ, ЭКСПРЕССИРУЮЩИХ ПОЛИПЕПТИДЫ
<130> P3125PC00
<160> 347
<170> PatentIn версия 3.5
<210> <211> <212>
20 ДНК
<213> Искусственная последовательность
<220>
<223> Праймер GlnPr269
<400> 1
caggggggcg gagcctatgg 20
<210> 2
<211> 43
<212> ДНК
<213> Искусственная последовательность
<220>
<223> Праймер GlnPr497
<400> 2
gcccccctcc cgcgaggaga tgaccaagaa ccaggtgtcc ctg 43
<210> 3
<211> 34
<212> ДНК
<213> Искусственная последовательность
<220>
<223> Праймер GlnPr498
<400> 3
tttctagatt catcacttgc cgggggacag gctc 34
<210> 4
<211> 31
<212> ДНК
<213> Искусственная последовательность
<220>
<223> Праймер GlnPr501
<400> 4
tataaagctt ccaccatgga gagccctgcc c 31
<210> 5 <211> 33 <212> ДНК
<213> Искусственная последовательность
<220>
<223> Праймер GlnPr502
<400> 5
tatatctaga ttcatcagca ctcgccccgg ttg 33
<210> <211> <212>
35 ДНК
<213> Искусственная последовательность
<220>
<223> Праймер GlnPr1437 <400> 6
ccaaatcgat ttatcagcac tcgccccggt tgaag 35
<210> <211> <212> ДНК
<213> Искусственная последовательность
<220>
<223> Праймер GlnPr1500 <400> 7
ccgggatcga tttatcagtg atggtgatgg tgatg 35
<210> <211> <212>
32 ДНК
<213> Искусственная последовательность
<220>
<223> Праймер GlnPr1502 <400> 8
ggccgatcga tttatcactt gccaggagac ag 32
<210> 9
<211> 28
<212> ДНК
<213> Искусственная последовательность
<220>
<223> Праймер GlnPr1516
<400> 9
gatgaaagct tggtaggtga tcctcctg 28
<210> 10
<211> 52
<212> ДНК
<213> Искусственная последовательность
<220>
<223> Праймер GlnPr1517
<400> 10
atgtattcga atatctccac cggttgcagc tctgagccag ggaggaggga ag 52
<210> 11
<211> 28
<212> ДНК
<213> Искусственная последовательность
<220>
<223> Праймер GlnPr1518
<400> 11
taagctagcc caccatggag agccctgc 28
<210> 12
<211> 49
<212> ДНК
<213> Искусственная последовательность
<220>
<223> Праймер GlnPr1519
<400> 12
gaggctcttc tgcgtgtagt ggttgtgcaa ggcctcgtgc atcacgctg 49
<210> 13
<211> 51
<212> ДНК
<213> Искусственная последовательность
<220>
<223> Праймер GlnPr1520
<400> 13
ctaccaagct ttcatcattt acccggagac agggagaggc tcttctgcgt g 51
<210> 14
<211> 92
<212> ДНК
<213> Искусственная последовательность
<220>
<223> Праймер GlnPr1521 <400> 14
gggagctgga cgggctgtgg acgaccatca ccatcttcat cacactcttc ctgttaagcg 60 tgtgctacag tgccaccgtc accttcttca ag 92
<210> 15
<211> 92
<212> ДНК
<213> Искусственная последовательность
<220>
<223> Праймер GlnPr1522
<400> 15
gtagtcgggg atgatggtct gcttcaggtc caccaccgag gagaagatcc acttcacctt
gaagaaggtg acggtggcac tgtagcacac gc 92
<210> 16
<211> 55
<212> ДНК
<213> Искусственная последовательность
<220>
<223> Праймер GlnPr1523
<400> 16
atataccggt ggagagctgt gcggaggcgc aggacgggga gctggacggg ctgtg 55
<210> 17
<211> 59
<212> ДНК
<213> Искусственная последовательность
<220>
<223> Праймер GlnPr1524
<400> 17
atatttcgaa tcactaggcc ccctgtccga tcatgttcct gtagtcgggg atgatggtc 59
<210> 18
<211> 41
<212> ДНК
<213> Искусственная последовательность
<220>
<223> Праймер GlnPr1649
<400> 18
tctccaccgg ttgcagctct gttccctcct ccctcggtta g 41
<210> 19
<211> 33
<212> ДНК
<213> Искусственная последовательность
<220>
<223> Праймер GlnPr1650
<400> 19
gcgccatcga tacagacatg ataagataca ttg 33
<210> 20
<211> 36
<212> ДНК
<213> Искусственная последовательность
<220>
<223> Праймер GlnPr1651
<210> 21
<211> 54
<212> ДНК
<213> Искусственная последовательность
<220>
<223> Праймер GlnPr1689
<400> 21
atatgctagc ccaccatgcg gagccctgcc cagctgctgt tcctgctgct gctg 54
<210> 22
<211> 61
<212> ДНК
<213> Искусственная последовательность
<220>
<223> Праймер GlnPr1690
<400> 22
tgctgttcct gctgctgctg tggatccctg gcaccaacgc cgaggtgcag ctggtcgagt 60
c 61
<210> 23
<211> 54
<212> ДНК
<213> Искусственная последовательность
<220>
<223> Праймер GlnPr1725
<400> 23
atatactagt ccaccatgcg gagccctgcc cagctgctgt tcctgctgct gctg 54
<210> 24
<211> 59
<212> ДНК
<213> Искусственная последовательность
<220>
<223> Праймер GlnPr1726
<400> 24
ctgttcctgc tgctgctgtg gatccctggc accaacgccc aggtgcagct gcagcagtc 59
<210> 25
<211> 58
<212> ДНК
<213> Искусственная последовательность
<220>
<223> Праймер GlnPr1727
<400> 25
ctgttcctgc tgctgctgtg gatccctggc accaacgcca tggagacaga cacactcc 58
<211> 70 <212> ДНК
<213> Искусственная последовательность
<220>
<223> Праймер GlnPr1735 <400> 26
gacttcgaat catcaatgat ggtggtggtg atgggcgctg gcgaggagca ggtcgaacag 60 gagcagcttg 70
<210> 27
<211> 37
<212> ДНК
<213> Искусственная последовательность
<220>
<223> Праймер GlnPr1760
<400> 27
ccgcatcgat ttatcattta cccgggctca ggctcag 37
<210> 28
<211> 71
<212> ДНК
<213> Искусственная последовательность
<220>
<223> Праймер GlnPr1799 <400> 28
atataccggt ggaggccctg tggctgggcg tgctgagact gctgctgttc aagctgctcc 60 tgttcgacct g 71
<210> 29
<211> 60
<212> ДНК
<213> Искусственная последовательность
<220>
<223> Праймер GlnPr1800 <400> 29
gtaagctttc atcatttacc cggagacagg gagaggctct tctgcgtgaa tcggttgtgc 60
<210> 30
<211> 60
<212> ДНК
<213> Искусственная последовательность
<220>
<223> Праймер GlnPr1801
<400> 30
gcgcgaagct ttcatcattt acccggagac agggagaggc tcttctgcgt ataatgattg 60
<211> 35
<212> ДНК
<213> Искусственная последовательность
<220>
<223> Праймер GlnPr1840
<400> 31
atataccggt ggaggccctg tggctgggcg tgctg 35
32 46
<210> <211> <212> ДНК
<213> Искусственная последовательность
<220>
<223> Праймер GlnPr2099 <400> 32
tcctcggggg gagatccacc accacctgag ccagggagga gggaag 46
<210> <211> <212>
33 31 ДНК
<213> Искусственная последовательность
<220>
<223> Праймер GlnPr2100 <400> 33
gcgcttcgaa tcatcacaga aacacggtct g 31
34 40
<210> <211> <212> ДНК
<213> Искусственная последовательность
<220>
<223> Праймер GlnPr2101 <400> 34
tggtggtgga tctccccccg aggacccccc tgactccaag 40
35 48 ДНК
<210> <211> <212>
<213> Искусственная последовательность
<220>
<223> Праймер GlnPr2102 <400> 35
tcctcggggg gagatccacc accacctgtt ccctcctccc tcggttag 48
1082 ДНК
<220>
<223> Конструкция GSC3899 <400> 36
ctgtctccgg gtaaatgatg aaagcttggt aggtgatcct cctgctgctt tggttcaggg 60
ttttgcttga gggggggggg tggtgatttc cttgccatgg gcagactgag cagaaaaggc 120
cattgggacc atgttctgaa tgcctccacc tcaaccaccg gccggtagga ccaaagccac 180
cccgtgtttt ctcaggatct cttttcccag ggagatccct cggcccaaag agggagatgg 240
caatgctgga tgtgtgcaca ataattcaac aggcattgga acttcagcat cgatgctgaa 300
tgcaattaac aatgctcaag cagaaccccc ggctccatca gcacagtgca ggaccaaacc 360
ccatgctgca gcagtggggc tgtctgtacg gggtgggcaa tgggaaccgg ggtctgctgg 420
ggctcctgct gcttcagtgc tgccatgcag ccacacatcc tgagagctga aagggtcggc 480
gtcctcacct ggtgcacacc gtagctctgc cccacagctt taaggcacct ggctaacctc 540
tgcgcttctt cccttccctc ctccctggct cagagctgca accggtggag agctgtgcgg 600
aggcgcagga cggggagctg gacgggctgt ggacgaccat caccatcttc atcacactct 660
tcctgttaag cgtgtgctac agtgccaccg tcaccttctt caaggtgaag tggatcttct 720
cctcggtggt ggacctgaag cagaccatca tccccgacta caggaacatg atcggacagg 780
gggcctagtg attcgaaatg accgaccaag cgacgcccaa cctgccatca cgagatttcg 840
attccaccgc cgccttctat gaaaggttgg gcttcggaat cgttttccgg gacgccggct 900
ggatgatcct ccagcgcggg gatctcatgc tggagttctt cgcccacccc aacttgttta 960
ttgcagctta taatggttac aaataaagca atagcatcac aaatttcaca aataaagcat 1020
ttttttcact gcattctagt tgtggtttgt ccaaactcat caatgtatct tatcatgtct 1080
gt 1082
<210> 37 <211> 1064
<212> ДНК
<213> Искусственная последовательность
<220>
<223> Конструкция GSC4398 <400> 37
ctgtctccgg gtaaatgatg aaagcttggt aggtgatcct cctgctgctt tggttcaggg 60
ttttgcttga gggggggggg tggtgatttc cttgccatgg gcagactgag cagaaaaggc 120
cattgggacc atgttctgaa tgcctccacc tcaaccaccg gccggtagga ccaaagccac 180
cccgtgtttt ctcaggatct cttttcccag ggagatccct cggcccaaag agggagatgg 240
caatgctgga tgtgtgcaca ataattcaac aggcattgga acttcagcat cgatgctgaa 300
ccatgctgca gcagtggggc tgtctgtacg gggtgggcaa tgggaaccgg ggtctgctgg 420
ggctcctgct gcttcagtgc tgccatgcag ccacacatcc tgagagctga aagggtcggc 480
gtcctcacct ggtgcacacc gtagctctgc cccacagctt taaggcacct ggctaaccga 540
gggaggaggg aacagagctg caaccggtgg agagctgtgc ggaggcgcag gacggggagc 600
tggacgggct gtggacgacc atcaccatct tcatcacact cttcctgtta agcgtgtgct 660
acagtgccac cgtcaccttc ttcaaggtga agtggatctt ctcctcggtg gtggacctga 720
agcagaccat catccccgac tacaggaaca tgatcggaca gggggcctag tgattcgaaa 780
tgaccgacca agcgacgccc aacctgccat cacgagattt cgattccacc gccgccttct 840
atgaaaggtt gggcttcgga atcgttttcc gggacgccgg ctggatgatc ctccagcgcg 900
gggatctcat gctggagttc ttcgcccacc ccaacttgtt tattgcagct tataatggtt 960
acaaataaag caatagcatc acaaatttca caaataaagc atttttttca ctgcattcta 1020
gttgtggttt gtccaaactc atcaatgtat cttatcatgt ctgt 1064
<210> 38 <211> 1219 <212> ДНК
<213> Искусственная последовательность
<220>
<223> Конструкция GSC4401 <400> 38
ctgtctccgg gtaaatgatg aaagcttggt aggtgatcct cctgctgctt tggttcaggg 60
ttttgcttga gggggggggg tggtgatttc cttgccatgg gcagactgag cagaaaaggc 120
cattgggacc atgttctgaa tgcctccacc tcaaccaccg gccggtagga ccaaagccac 180
cccgtgtttt ctcaggatct cttttcccag ggagatccct cggcccaaag agggagatgg 240
caatgctgga tgtgtgcaca ataattcaac aggcattgga acttcagcat cgatacttgt 300
ttattgcagc ttataatggt tacaaataaa gcaatagcat cacaaatttc acaaataaag 360
catttttttc actgcattct agttgtggtt tgtccaaact catcaatgta tcttatcatg 420
tctgtatcga tgctgaatgc aattaacaat gctcaagcag aacccccggc tccatcagca 480
cagtgcagga ccaaacccca tgctgcagca gtggggctgt ctgtacgggg tgggcaatgg 540
gaaccggggt ctgctggggc tcctgctgct tcagtgctgc catgcagcca cacatcctga 600
gagctgaaag ggtcggcgtc ctcacctggt gcacaccgta gctctgcccc acagctttaa 660
ggcacctggc taacctctgc gcttcttccc ttccctcctc cctggctcag agctgcaacc 720
ggtggagagc tgtgcggagg cgcaggacgg ggagctggac gggctgtgga cgaccatcac 780
catcttcatc acactcttcc tgttaagcgt gtgctacagt gccaccgtca ccttcttcaa 840
gaacatgatc ggacaggggg cctagtgatt cgaaatgacc gaccaagcga cgcccaacct 960
gccatcacga gatttcgatt ccaccgccgc cttctatgaa aggttgggct tcggaatcgt 1020
tttccgggac gccggctgga tgatcctcca gcgcggggat ctcatgctgg agttcttcgc 1080
ccaccccaac ttgtttattg cagcttataa tggttacaaa taaagcaata gcatcacaaa 1140
tttcacaaat aaagcatttt tttcactgca ttctagttgt ggtttgtcca aactcatcaa 1200
tgtatcttat catgtctgt 1219
<210> 39
<211> 1263
<212> ДНК
<213> Искусственная последовательность
<220>
<223> Конструкция GSC4402
<400> 39
ctgtctccgg
gtaaatgatg
aaagcttggt
aggtgatcct
cctgctgctt
tggttcaggg
ttttgcttga
gggggggggg
tggtgatttc
cttgccatgg
gcagactgag
cagaaaaggc
120
cattgggacc
atgttctgaa
tgcctccacc
tcaaccaccg
gccggtagga
ccaaagccac
180
cccgtgtttt
ctcaggatct
cttttcccag
ggagatccct
cggcccaaag
agggagatgg
240
caatgctgga
tgtgtgcaca
ataattcaac
aggcattgga
acttcagcat
cgatgctgaa
300
tgcaattaac
aatgctcaag
cagaaccccc
ggctccatca
gcacagtgca
ggaccaaacc
360
ccatgctgca
gcagtggggc
tgtctgtacg
gggtgggcaa
tgggaaccgg
ggtctgctgg
420
ggctcctgct
gcttcagtgc
tgccatgcag
ccacacatcc
tgagagctga
aagggtcggc
480
gtcctcacct
ggtgcacacc
gtagctctgc
cccacagctt
taaggcacct
ggctaacctc
540
tgcgcttctt
cccttccctc
ctccctggct
cagagctgca
accggtggag
agctgtgcgg
600
aggcgcagga
cggggagctg
gacgggctgt
ggacgaccat
caccatcttc
atcacactct
660
tcctgttaag
cgtgtgctac
agtgccaccg
tcaccttctt
caaggtgaag
tggatcttct
720
cctcggtggt
ggacctgaag
cagaccatca
tccccgacta
caggaacatg
atcggacagg
780
gggcctagtg
attcgaaatg
accgaccaag
cgacgcccaa
cctgccatca
cgagatttcg
840
attccaccgc
cgccttctat
gaaaggttgg
gcttcggaat
cgttttccgg
gacgccggct
900
ggatgatcct
ccagcgcggg
gatctcatgc
tggagttctt
cgcccacccc
aacttgttta
960
ttgcagctta
taatggttac
aaataaagca
atagcatcac
aaatttcaca
aataaagcat
1020
ttttttcact
gcattctagt
tgtggtttgt
ccaaactcat
caatgtatct
tatcatgtct
1080
gtataccgtc
gacctctagc
tagagcttgg
cgtaatcatg
gtcatagctg
tttcctgtgt
1140
gaaattgtta
tccgctcaca
attccacaca
acatacgagc
cggggcagga
taatatatgg
1200
tagggttcat
agccagagta
accttttttt
ttaattttta
ttttatttta
tttttgagat
1260
cag 1263
<210> 40
<211> 977
<212> ДНК
<213> Искусственная последовательность
<220>
<223> Конструкция GSC5854 <400> 40
ctgtctccgg gtaaatgatg aaagcttggt aggtgatcct cctgctgctt tggttcaggg 60
ttttgcttga gggggggggg tggtgatttc cttgccatgg gcagactgag cagaaaaggc 120
cattgggacc atgttctgaa tgcctccacc tcaaccaccg gccggtagga ccaaagccac 180
cccgtgtttt ctcaggatct cttttcccag ggagatccct cggcccaaag agggagatgg 240
caatgctgga tgtgtgcaca ataattcaac aggcattgga acttcagcat cgatgctgaa 300
tgcaattaac aatgctcaag cagaaccccc ggctccatca gcacagtgca ggaccaaacc 360
ccatgctgca gcagtggggc tgtctgtacg gggtgggcaa tgggaaccgg ggtctgctgg 420
ggctcctgct gcttcagtgc tgccatgcag ccacacatcc tgagagctga aagggtcggc 480
gtcctcacct ggtgcacacc gtagctctgc cccacagctt taaggcacct ggctaacctc 540
tgcgcttctt cccttccctc ctccctggct cagagctgca accggtggag gccctgtggc 600
tgggcgtgct gagactgctg ctgttcaagc tgctcctgtt cgacctgctc ctcgccagcg 660
cccatcacca ccaccatcat tgatgattcg aaatgaccga ccaagcgacg cccaacctgc 720
catcacgaga tttcgattcc accgccgcct tctatgaaag gttgggcttc ggaatcgttt 780
tccgggacgc cggctggatg atcctccagc gcggggatct catgctggag ttcttcgccc 840
accccaactt gtttattgca gcttataatg gttacaaata aagcaatagc atcacaaatt 900
tcacaaataa agcatttttt tcactgcatt ctagttgtgg tttgtccaaa ctcatcaatg 960
tatcttatca tgtctgt 977
<210> 41
<211> 959
<212> ДНК
<213> Искусственная последовательность
<220>
<223> Конструкция GSC5855 <400> 41
ctgtctccgg gtaaatgatg aaagcttggt aggtgatcct cctgctgctt tggttcaggg 60 ttttgcttga gggggggggg tggtgatttc cttgccatgg gcagactgag cagaaaaggc 120 cattgggacc atgttctgaa tgcctccacc tcaaccaccg gccggtagga ccaaagccac 180 cccgtgtttt ctcaggatct cttttcccag ggagatccct cggcccaaag agggagatgg 240
caatgctgga tgtgtgcaca ataattcaac aggcattgga acttcagcat cgatgctgaa 300
tgcaattaac aatgctcaag cagaaccccc ggctccatca gcacagtgca ggaccaaacc 360
ccatgctgca gcagtggggc tgtctgtacg gggtgggcaa tgggaaccgg ggtctgctgg 420
ggctcctgct gcttcagtgc tgccatgcag ccacacatcc tgagagctga aagggtcggc 480
gtcctcacct ggtgcacacc gtagctctgc cccacagctt taaggcacct ggctaaccga 540
gggaggaggg aacagagctg caaccggtgg aggccctgtg gctgggcgtg ctgagactgc 600
tgctgttcaa gctgctcctg ttcgacctgc tcctcgccag cgcccatcac caccaccatc 660
attgatgatt cgaaatgacc gaccaagcga cgcccaacct gccatcacga gatttcgatt 720
ccaccgccgc cttctatgaa aggttgggct tcggaatcgt tttccgggac gccggctgga 780
tgatcctcca gcgcggggat ctcatgctgg agttcttcgc ccaccccaac ttgtttattg 840
cagcttataa tggttacaaa taaagcaata gcatcacaaa tttcacaaat aaagcatttt 900
tttcactgca ttctagttgt ggtttgtcca aactcatcaa tgtatcttat catgtctgt 959
<210> 42 <211> 1114 <212> ДНК
<213> Искусственная последовательность
<220>
<223> Конструкция GSC5857 <400> 42
ctgtctccgg gtaaatgatg aaagcttggt aggtgatcct cctgctgctt tggttcaggg 60
ttttgcttga gggggggggg tggtgatttc cttgccatgg gcagactgag cagaaaaggc 120
cattgggacc atgttctgaa tgcctccacc tcaaccaccg gccggtagga ccaaagccac 180
cccgtgtttt ctcaggatct cttttcccag ggagatccct cggcccaaag agggagatgg 240
caatgctgga tgtgtgcaca ataattcaac aggcattgga acttcagcat cgatacttgt 300
ttattgcagc ttataatggt tacaaataaa gcaatagcat cacaaatttc acaaataaag 360
catttttttc actgcattct agttgtggtt tgtccaaact catcaatgta tcttatcatg 420
tctgtatcga tgctgaatgc aattaacaat gctcaagcag aacccccggc tccatcagca 480
cagtgcagga ccaaacccca tgctgcagca gtggggctgt ctgtacgggg tgggcaatgg 540
gaaccggggt ctgctggggc tcctgctgct tcagtgctgc catgcagcca cacatcctga 600
gagctgaaag ggtcggcgtc ctcacctggt gcacaccgta gctctgcccc acagctttaa 660
ggcacctggc taacctctgc gcttcttccc ttccctcctc cctggctcag agctgcaacc 720
ggtggaggcc ctgtggctgg gcgtgctgag actgctgctg ttcaagctgc tcctgttcga 780
cctgctcctc gccagcgccc atcaccacca ccatcattga tgattcgaaa tgaccgacca 840
gggcttcgga atcgttttcc gggacgccgg ctggatgatc ctccagcgcg gggatctcat 960
gctggagttc ttcgcccacc ccaacttgtt tattgcagct tataatggtt acaaataaag 1020
caatagcatc acaaatttca caaataaagc atttttttca ctgcattcta gttgtggttt 1080
gtccaaactc atcaatgtat cttatcatgt ctgt 1114
<210> 43
<211> 1158
<212> ДНК
<213> Искусственная последовательность
<220>
<223> Конструкция GSC5856
<400> 43
ctgtctccgg
gtaaatgatg
aaagcttggt
aggtgatcct
cctgctgctt
tggttcaggg
ttttgcttga
gggggggggg
tggtgatttc
cttgccatgg
gcagactgag
cagaaaaggc
120
cattgggacc
atgttctgaa
tgcctccacc
tcaaccaccg
gccggtagga
ccaaagccac
180
cccgtgtttt
ctcaggatct
cttttcccag
ggagatccct
cggcccaaag
agggagatgg
240
caatgctgga
tgtgtgcaca
ataattcaac
aggcattgga
acttcagcat
cgatgctgaa
300
tgcaattaac
aatgctcaag
cagaaccccc
ggctccatca
gcacagtgca
ggaccaaacc
360
ccatgctgca
gcagtggggc
tgtctgtacg
gggtgggcaa
tgggaaccgg
ggtctgctgg
420
ggctcctgct
gcttcagtgc
tgccatgcag
ccacacatcc
tgagagctga
aagggtcggc
480
gtcctcacct
ggtgcacacc
gtagctctgc
cccacagctt
taaggcacct
ggctaacctc
540
tgcgcttctt
cccttccctc
ctccctggct
cagagctgca
accggtggag
gccctgtggc
600
tgggcgtgct
gagactgctg
ctgttcaagc
tgctcctgtt
cgacctgctc
ctcgccagcg
660
cccatcacca
ccaccatcat
tgatgattcg
aaatgaccga
ccaagcgacg
cccaacctgc
720
catcacgaga
tttcgattcc
accgccgcct
tctatgaaag
gttgggcttc
ggaatcgttt
780
tccgggacgc
cggctggatg
atcctccagc
gcggggatct
catgctggag
ttcttcgccc
840
accccaactt
gtttattgca
gcttataatg
gttacaaata
aagcaatagc
atcacaaatt
900
tcacaaataa
agcatttttt
tcactgcatt
ctagttgtgg
tttgtccaaa
ctcatcaatg
960
tatcttatca
tgtctgtata
ccgtcgacct
ctagctagag
cttggcgtaa
tcatggtcat
1020
agctgtttcc
tgtgtgaaat
tgttatccgc
tcacaattcc
acacaacata
cgagccgggg
1080
caggataata
tatggtaggg
ttcatagcca
gagtaacctt
tttttttaat
ttttatttta
1140
ttttattttt
gagatcag
1158
<210> 44
<211> 1076
<212> ДНК
<213> Искусственная последовательность
<220>
<223> Конструкция GSC6030 <400> 44
ctgtctccgg gtaaatgatg aaagcttggt aggtgatcct cctgctgctt tggttcaggg 60
ttttgcttga gggggggggg tggtgatttc cttgccatgg gcagactgag cagaaaaggc 120
cattgggacc atgttctgaa tgcctccacc tcaaccaccg gccggtagga ccaaagccac 180
cccgtgtttt ctcaggatct cttttcccag ggagatccct cggcccaaag agggagatgg 240
caatgctgga tgtgtgcaca ataattcaac aggcattgga acttcagcat cgatgctgaa 300
tgcaattaac aatgctcaag cagaaccccc ggctccatca gcacagtgca ggaccaaacc 360
ccatgctgca gcagtggggc tgtctgtacg gggtgggcaa tgggaaccgg ggtctgctgg 420
ggctcctgct gcttcagtgc tgccatgcag ccacacatcc tgagagctga aagggtcggc 480
gtcctcacct ggtgcacacc gtagctctgc cccacagctt taaggcacct ggctaacctc 540
tgcgcttctt cccttccctc ctccctggct cagagctgca accggtggag agctgtgcgg 600
aggcgcagga cggggagctg gacgccctgt ggctgggcgt gctgagactg ctgctgttca 660
agctgctcct gttcgacctg ctcctcacct tcttcaaggt gaagtggatc ttctcctcgg 720
tggtggacct gaagcagacc atcatccccg actacaggaa catgatcgga cagggggcct 780
agtgattcga aatgaccgac caagcgacgc ccaacctgcc atcacgagat ttcgattcca 840
ccgccgcctt ctatgaaagg ttgggcttcg gaatcgtttt ccgggacgcc ggctggatga 900
tcctccagcg cggggatctc atgctggagt tcttcgccca ccccaacttg tttattgcag 960
cttataatgg ttacaaataa agcaatagca tcacaaattt cacaaataaa gcattttttt 1020
cactgcattc tagttgtggt ttgtccaaac tcatcaatgt atcttatcat gtctgt 1076
<210> 45 <211> 1058
<212> ДНК
<213> Искусственная последовательность
<220>
<223> Конструкция GSC6048 <400> 45
ctgtctccgg gtaaatgatg aaagcttggt aggtgatcct cctgctgctt tggttcaggg 60
ttttgcttga gggggggggg tggtgatttc cttgccatgg gcagactgag cagaaaaggc 120
cattgggacc atgttctgaa tgcctccacc tcaaccaccg gccggtagga ccaaagccac 180
cccgtgtttt ctcaggatct cttttcccag ggagatccct cggcccaaag agggagatgg 240
caatgctgga tgtgtgcaca ataattcaac aggcattgga acttcagcat cgatgctgaa 300
tgcaattaac aatgctcaag cagaaccccc ggctccatca gcacagtgca ggaccaaacc 360
ggctcctgct gcttcagtgc tgccatgcag ccacacatcc tgagagctga aagggtcggc 480
gtcctcacct ggtgcacacc gtagctctgc cccacagctt taaggcacct ggctaaccga 540
gggaggaggg aacagagctg caaccggtgg agagctgtgc ggaggcgcag gacggggagc 600
tggacgccct gtggctgggc gtgctgagac tgctgctgtt caagctgctc ctgttcgacc 660
tgctcctcac cttcttcaag gtgaagtgga tcttctcctc ggtggtggac ctgaagcaga 720
ccatcatccc cgactacagg aacatgatcg gacagggggc ctagtgattc gaaatgaccg 780
accaagcgac gcccaacctg ccatcacgag atttcgattc caccgccgcc ttctatgaaa 840
ggttgggctt cggaatcgtt ttccgggacg ccggctggat gatcctccag cgcggggatc 900
tcatgctgga gttcttcgcc caccccaact tgtttattgc agcttataat ggttacaaat 960
aaagcaatag catcacaaat ttcacaaata aagcattttt ttcactgcat tctagttgtg 1020
gtttgtccaa actcatcaat gtatcttatc atgtctgt 1058
<210> 46
<211> 1213
<212> ДНК
<213> Искусственная последовательность
<220>
<223> Конструкция GSC6047
acgagatttc gattccaccg ccgccttcta tgaaaggttg ggcttcggaa tcgttttccg 1020
ggacgccggc tggatgatcc tccagcgcgg ggatctcatg ctggagttct tcgcccaccc 1080
caacttgttt attgcagctt ataatggtta caaataaagc aatagcatca caaatttcac 1140
aaataaagca tttttttcac tgcattctag ttgtggtttg tccaaactca tcaatgtatc 1200
ttatcatgtc tgt 1213
<210> 47
<211> 1257
<212> ДНК
<213> Искусственная последовательность
<220>
<223> Конструкция GSC6046
<211> 1738 <212> ДНК
<213> Искусственная последовательность
<220>
<223> Конструкция GSC314 <400> 48
atggagagcc ctgcccagct gctgttcctg ctgctgctgt ggctgcctga cacccaggcc 60
gaggtgcagc tggtcgagtc tggcggcgga ctggtgcagc ctggcggctc cctgcggctg 120
tcctgcgccg cctccggctt caacatcaag gacacctaca tccactgggt gcggcaggcc 180
cctggcaagg gcctggagtg ggtggcccgg atctacccta ccaacggcta caccagatac 240
gccgactccg tgaagggccg gttcaccatc tccgccgaca cctccaagaa caccgcctac 300
ctgcagatga actccctgcg ggccgaggac accgccgtgt actactgctc cagatgggga 360
ggagatggct tctacgccat ggactactgg ggccagggca ccctggtgac cgtgtcctcc 420
gcctccacca agggccccag cgtgttcccc ctggccccca gcagcaagtc taccagcggc 480
ggcacagcag ccctgggatg cctggtgaag gactacttcc ccgagcccgt gaccgtgagc 540
tggaacagcg gagccctgac ctccggcgtg cacaccttcc ccgccgtgct gcagagcagc 600
ggcctgtaca gcctgagcag cgtggtgacc gtgcccagca gcagcctggg cacccagacc 660
tacatctgca acgtgaacca caagcccagc aacaccaagg tggacaagaa ggtggagccc 720
aagagctgcg acaagaccca cacctgccct ccctgtcctg ctcctgagct gctcggcgga 780
ccctccgtgt tcctgttccc ccccaagccc aaggacaccc tgatgatcag caggaccccc 840
gaggtgacct gcgtggtggt ggacgtgagc cacgaggacc cagaggtgaa gttcaactgg 900
tacgtggacg gcgtggaggt gcacaacgcc aagaccaagc ccagagagga acagtacaac 960
agcacctaca gggtggtgtc cgtgctgacc gtgctgcacc aggactggct gaacggcaaa 1020
gagtacaagt gcaaggtctc caacaaggcc ctgccagccc ccatcgagaa aaccatcagc 1080
aaggccaagg gccagccacg ggagccccag gtgtacaccc tgcccccctc ccgcgaggag 1140
atgaccaaga accaggtgtc cctgacatgt ctggtgaaag gcttctaccc cagcgacatc 1200
gccgtggagt gggagagcaa cggccagccc gagaacaact acaagaccac ccccccagtg 1260
ctggacagcg acggcagctt cttcctgtac agcaagctga ccgtggacaa gagcaggtgg 1320
cagcagggca acgtgttcag ctgcagcgtg atgcacgagg ccctgcacaa ccactacacc 1380
cagaagagcc tgagcctgtc ccccggcaag tgatgaatct agaggtaccc ccggggggcc 1440
cctcgagttc gaaatgaccg accaagcgac gcccaacctg ccatcacgag atttcgattc 1500
caccgccgcc ttctatgaaa ggttgggctt cggaatcgtt ttccgggacg ccggctggat 1560
gatcctccag cgcggggatc tcatgctgga gttcttcgcc caccccaact tgtttattgc 1620
ttcactgcat tctagttgtg gtttgtccaa actcatcaat gtatcttatc atgtctgt 1738
<210> 49 <211> 1410 <212> ДНК
<213> Искусственная последовательность
<220>
<223> Конструкция GSC5644 <400> 49
atgcggagcc ctgcccagct gctgttcctg ctgctgctgt ggatccctgg caccaacgcc 60
caggtgcagc tgcagcagtc tggcgccgaa ctggccagac caggcgccag cgtgaagatg 120
agctgcaagg ccagcggcta caccttcacc cggtacacca tgcactgggt gaaacagcgg 180
cctggacagg gcctggaatg gatcggctac atcaacccca gccggggcta caccaactac 240
aaccagaagt tcaaggacaa ggccaccctg accaccgaca agagcagcag caccgcctac 300
atgcagctga gcagcctgac cagcgaggac agcgccgtgt actactgcgc ccggtactac 360
gacgaccact actgcctgga ctactggggc cagggcacca ccctgaccgt gagcagcgcg 420
tcgaccaagg gccccagcgt gttcccgcta gcccccagca gcaagagcac cagcggcggc 480
acagccgccc tgggctgcct ggtgaaggac tacttccccg agcccgttac cgtgtcctgg 540
aactctggag ccctgacctc cggcgtgcac accttccccg ccgtgctcca gagcagcggc 600
ctgtacagcc tgagcagcgt ggtgacagtg cccagcagca gcctgggaac ccagacctac 660
atctgcaacg tgaaccacaa gcccagcaac accaaggtgg acaagaaggt ggagcccaag 720
agctgcgaca aaactcacac ctgcccaccc tgccctgccc ctgagctgct gggcggaccc 780
tccgtgttcc tgttcccccc caagcccaag gacaccctga tgatcagccg gacccccgag 840
gtgacctgcg tggtggtgga cgtgagccac gaggaccctg aggtgaagtt caattggtac 900
gtggacggcg tggaggtgca caacgccaag accaagcccc gggaggaaca gtacaacagc 960
acctaccggg tggtgtccgt gctgaccgtg ctgcaccagg actggctgaa cggcaaggaa 1020
tacaagtgca aggtctccaa caaggccctg cctgccccca tcgaaaagac catcagcaag 1080
gccaagggcc agccgcgcga accgcaggtg tacaccctgc cccccagccg ggaagagatg 1140
accaagaacc aggtgaaact ggtgtgcctg gtgacaggct tctaccccag cgatatcgcc 1200
gtggaatggg agagcagcgg ccagcctgag aacaactact acaccacccc ccccatgctg 1260
gacagcgacg gcagcttcag cctggtgtcc tggctgaacg tggacaagag ccggtggcag 1320
cagggcaaca tcttcagctg cagcgtgatg cacgaggccc tgcacaaccg gttcacccag 1380
aagtccctga gcctgagccc gggtaaatga 1410
<210> 50 <211> 1074 <212> ДНК
<213> Искусственная последовательность
<220>
<223> Конструкция GSC5537 <400> 50
gggtaaatga tgaaagcttg gtaggtgatc ctcctgctgc tttggttcag ggttttgctt 60
gagggggggg ggtggtgatt tccttgccat gggcagactg agcagaaaag gccattggga 120
ccatgttctg aatgcctcca cctcaaccac cggccggtag gaccaaagcc accccgtgtt 180
ttctcaggat ctcttttccc agggagatcc ctcggcccaa agagggagat ggcaatgctg 240
gatgtgtgca caataattca acaggcattg gaacttcagc atcgatgctg aatgcaatta 300
acaatgctca agcagaaccc ccggctccat cagcacagtg caggaccaaa ccccatgctg 360
cagcagtggg gctgtctgta cggggtgggc aatgggaacc ggggtctgct ggggctcctg 420
ctgcttcagt gctgccatgc agccacacat cctgagagct gaaagggtcg gcgtcctcac 480
ctggtgcaca ccgtagctct gccccacagc tttaaggcac ctggctaacc tctgcgcttc 540
ttcccttccc tcctccctgg ctcagagctg caaccggtgg agagctgtgc ggaggcgcag 600
gacggggagc tggacgggct gtggacgacc atcaccatct tcatcacact cttcctgtta 660
agcgtgtgct acagtgccac cgtcaccttc ttcaaggtga agtggatctt ctcctcggtg 720
gtggacctga agcagaccat catccccgac tacaggaaca tgatcggaca gggggcctag 780
tgattcgaaa tgaccgacca agcgacgccc aacctgccat cacgagattt cgattccacc 840
gccgccttct atgaaaggtt gggcttcgga atcgttttcc gggacgccgg ctggatgatc 900
ctccagcgcg gggatctcat gctggagttc ttcgcccacc ccaacttgtt tattgcagct 960
tataatggtt acaaataaag caatagcatc acaaatttca caaataaagc atttttttca 1020
ctgcattcta gttgtggttt gtccaaactc atcaatgtat cttatcatgt ctgt 1074
<210> 51 <211> 1488 <212> ДНК
<213> Искусственная последовательность
<220>
<223> Конструкция GSC5608 <400> 51
atgcggagcc ctgcccagct gctgttcctg ctgctgctgt ggatccctgg caccaacgcc 60
gaggtgcagc tggtcgagtc tggcggcgga ctggtgcagc ctggcggctc cctgcggctg 120
tcctgcgccg cctccggctt caacatcaag gacacctaca tccactgggt gcggcaggcc 180
cctggcaagg gcctggagtg ggtggcccgg atctacccta ccaacggcta caccagatac 240
gccgactccg tgaagggccg gttcaccatc tccgccgaca cctccaagaa caccgcctac 300
ggagatggct
tctacgccat
ggactactgg
ggccagggca
ccctggtgac
cgtgtcctcc
420
ggtggcggtg
gcagcggcgg
tggtggttcc
ggaggcggcg
gttctgacat
ccagatgacc
480
cagtccccct
ccagcctgtc
tgcctccgtg
ggcgaccggg
tgaccatcac
ctgccgggcc
540
tcccaggacg
tgaacaccgc
cgtggcctgg
tatcagcaga
agcctggcaa
ggcccctaag
600
ctgctgatct
actccgcctc
cttcctgtac
tccggcgtgc
cttcccggtt
ctccggctcc
660
cggtccggca
ccgacttcac
cctgaccatc
tcctccctgc
agcctgagga
cttcgccacc
720
tactactgcc
agcagcacta
caccacccct
cctaccttcg
gccagggcac
caaggtggag
780
atcaagaggg
gaggaggagg
taccgacaaa
actcacacat
gcccaccgtg
cccagcacct
840
gaactcctgg
ggggaccgtc
agtcttcctc
ttccccccaa
aacccaagga
caccctcatg
900
atctcccgga
cccctgaggt
cacatgcgtg
gtggtggacg
tgagccacga
agaccctgag
960
gtcaagttca
actggtacgt
ggacggcgtg
gaggtgcata
atgccaagac
aaagccgcgg
1020
gaggagcagt
acaacagcac
gtaccgtgtg
gtcagcgtcc
tcaccgtcct
gcaccaggac
1080
tggctgaatg
gcaaggagta
caagtgcaag
gtctccaaca
aagccctccc
agcccccatc
1140
gagaaaacca
tctccaaagc
caaaggacag
cccagggaac
ctgaggtggc
cacattccca
1200
cctagccggg
acgagctgac
aaaaaatcag
gtcaccctcg
tctgtctcgt
gaccggcttt
1260
tacccttccg
acattgccgt
ggaatgggaa
tccaatgggc
agcccgagaa
caattacaag
1320
acagaccccc
ccctgctgga
atccgatggc
agcttcgccc
tgagcagccg
gctgcgggtg
1380
gacaagtcca
gatggcagca
ggggaatgtc
ttttcctgct
ccgtcatgca
tgaagccctc
1440
cacaatcatt
atacacagaa
aagcctgagc
ctgtctcctg
gcaagtga
1488
<210> 52
<211> 1074
<212> ДНК
<213> Искусственная последовательность
<220>
<223> Конструкция GSC5538 <400> 52
gggtaaatga tgaaagcttg gtaggtgatc ctcctgctgc tttggttcag ggttttgctt 60
gagggggggg ggtggtgatt tccttgccat gggcagactg agcagaaaag gccattggga 120
ccatgttctg aatgcctcca cctcaaccac cggccggtag gaccaaagcc accccgtgtt 180
ttctcaggat ctcttttccc agggagatcc ctcggcccaa agagggagat ggcaatgctg 240
gatgtgtgca caataattca acaggcattg gaacttcagc atcgatgctg aatgcaatta 300
acaatgctca agcagaaccc ccggctccat cagcacagtg caggaccaaa ccccatgctg 360
cagcagtggg gctgtctgta cggggtgggc aatgggaacc ggggtctgct ggggctcctg 420
ctggtgcaca ccgtagctct gccccacagc tttaaggcac ctggctaacc tctgcgcttc 540
ttcccttccc tcctccctgg ctcagagctg caaccggtgg agagctgtgc ggaggcgcag 600
gacggggagc tggacgggct gtggacgacc atcaccatct tcatcacact cttcctgtta 660
agcgtgtgct acagtgccac cgtcaccttc ttcaaggtga agtggatctt ctcctcggtg 720
gtggacctga agcagaccat catccccgac tacaggaaca tgatcggaca gggggcctag 780
tgattcgaaa tgaccgacca agcgacgccc aacctgccat cacgagattt cgattccacc 840
gccgccttct atgaaaggtt gggcttcgga atcgttttcc gggacgccgg ctggatgatc 900
ctccagcgcg gggatctcat gctggagttc ttcgcccacc ccaacttgtt tattgcagct 960
tataatggtt acaaataaag caatagcatc acaaatttca caaataaagc atttttttca 1020
ctgcattcta gttgtggttt gtccaaactc atcaatgtat cttatcatgt ctgt 1074
<210> 53 <211> 1076 <212> ДНК
<213> Искусственная последовательность
<220>
<223> Конструкция GSC7057
<400> 53
ctgtctccgg gtaaatgatg aaagcttggt aggtgatcct cctgctgctt tggttcaggg 60
ttttgcttga gggggggggg tggtgatttc cttgccatgg gcagactgag cagaaaaggc 120
cattgggacc atgttctgaa tgcctccacc tcaaccaccg gccggtagga ccaaagccac 180
cccgtgtttt ctcaggatct cttttcccag ggagatccct cggcccaaag agggagatgg 240
caatgctgga tgtgtgcaca ataattcaac aggcattgga acttcagcat cgatgctgaa 300
tgcaattaac aatgctcaag cagaaccccc ggctccatca gcacagtgca ggaccaaacc 360
ccatgctgca gcagtggggc tgtctgtacg gggtgggcaa tgggaaccgg ggtctgctgg 420
ggctcctgct gcttcagtgc tgccatgcag ccacacatcc tgagagctga aagggtcggc 480
gtcctcacct ggtgcacacc gtagctctgc cccacagctt taaggcacct ggctaaccga 540
gggaggaggg aacaggtggt ggtggatctc cccccgagga cccccctgac tccaagaata 600
ccctggtgct gttcggcgct ggcttcggcg ccgtgattac cgtggtcgtg atcgtcgtga 660
ttatcaagtg cttctgcaag caccggtcct gcttccggcg gaacgaggcc tccagagaga 720
caaacaactc cctgaccttc ggccccgagg aagccctggc tgagcagacc gtgtttctgt 780
gatgattcga aatgaccgac caagcgacgc ccaacctgcc atcacgagat ttcgattcca 840
ccgccgcctt ctatgaaagg ttgggcttcg gaatcgtttt ccgggacgcc ggctggatga 900
tcctccagcg cggggatctc atgctggagt tcttcgccca ccccaacttg tttattgcag 960
cactgcattc tagttgtggt ttgtccaaac tcatcaatgt atcttatcat gtctgt 1076
<210> 54
<211> 1231
<212> ДНК
<213> Искусственная последовательность
<220>
<223> Конструкция GSC7058
<210> 55
<211> 1094
<212> ДНК
<213> Искусственная последовательность
<220>
<223> Конструкция GSC7056
ctgtctccgg
gtaaatgatg
aaagcttggt
aggtgatcct
cctgctgctt
tggttcaggg
ttttgcttga
gggggggggg
tggtgatttc
cttgccatgg
gcagactgag
cagaaaaggc
120
cattgggacc
atgttctgaa
tgcctccacc
tcaaccaccg
gccggtagga
ccaaagccac
180
cccgtgtttt
ctcaggatct
cttttcccag
ggagatccct
cggcccaaag
agggagatgg
240
caatgctgga
tgtgtgcaca
ataattcaac
aggcattgga
acttcagcat
cgatgctgaa
300
tgcaattaac
aatgctcaag
cagaaccccc
ggctccatca
gcacagtgca
ggaccaaacc
360
ccatgctgca
gcagtggggc
tgtctgtacg
gggtgggcaa
tgggaaccgg
ggtctgctgg
420
ggctcctgct
gcttcagtgc
tgccatgcag
ccacacatcc
tgagagctga
aagggtcggc
480
gtcctcacct
ggtgcacacc
gtagctctgc
cccacagctt
taaggcacct
ggctaacctc
540
tgcgcttctt
cccttccctc
ctccctggct
caggtggtgg
tggatctccc
cccgaggacc
600
cccctgactc
caagaatacc
ctggtgctgt
tcggcgctgg
cttcggcgcc
gtgattaccg
660
tggtcgtgat
cgtcgtgatt
atcaagtgct
tctgcaagca
ccggtcctgc
ttccggcgga
720
acgaggcctc
cagagagaca
aacaactccc
tgaccttcgg
ccccgaggaa
gccctggctg
780
agcagaccgt
gtttctgtga
tgattcgaaa
tgaccgacca
agcgacgccc
aacctgccat
840
cacgagattt
cgattccacc
gccgccttct
atgaaaggtt
gggcttcgga
atcgttttcc
900
gggacgccgg
ctggatgatc
ctccagcgcg
gggatctcat
gctggagttc
ttcgcccacc
960
ccaacttgtt
tattgcagct
tataatggtt
acaaataaag
caatagcatc
acaaatttca
1020
caaataaagc
atttttttca
ctgcattcta
gttgtggttt
gtccaaactc
atcaatgtat
1080
cttatcatgt
ctgt
1094
<210> 56
<211> 1275
<212> ДНК
<213> Искусственная последовательность
<220>
<223> Конструкция GSC7059 <400> 56
ctgtctccgg gtaaatgatg aaagcttggt aggtgatcct cctgctgctt tggttcaggg 60
ttttgcttga gggggggggg tggtgatttc cttgccatgg gcagactgag cagaaaaggc 120
cattgggacc atgttctgaa tgcctccacc tcaaccaccg gccggtagga ccaaagccac 180
cccgtgtttt ctcaggatct cttttcccag ggagatccct cggcccaaag agggagatgg 240
caatgctgga tgtgtgcaca ataattcaac aggcattgga acttcagcat cgatgctgaa 300
tgcaattaac aatgctcaag cagaaccccc ggctccatca gcacagtgca ggaccaaacc 360
ccatgctgca gcagtggggc tgtctgtacg gggtgggcaa tgggaaccgg ggtctgctgg 420
gtcctcacct ggtgcacacc gtagctctgc cccacagctt taaggcacct ggctaacctc 540
tgcgcttctt cccttccctc ctccctggct caggtggtgg tggatctccc cccgaggacc 600
cccctgactc caagaatacc ctggtgctgt tcggcgctgg cttcggcgcc gtgattaccg 660
tggtcgtgat cgtcgtgatt atcaagtgct tctgcaagca ccggtcctgc ttccggcgga 720
acgaggcctc cagagagaca aacaactccc tgaccttcgg ccccgaggaa gccctggctg 780
agcagaccgt gtttctgtga tgattcgaaa tgaccgacca agcgacgccc aacctgccat 840
cacgagattt cgattccacc gccgccttct atgaaaggtt gggcttcgga atcgttttcc 900
gggacgccgg ctggatgatc ctccagcgcg gggatctcat gctggagttc ttcgcccacc 960
ccaacttgtt tattgcagct tataatggtt acaaataaag caatagcatc acaaatttca 1020
caaataaagc atttttttca ctgcattcta gttgtggttt gtccaaactc atcaatgtat 1080
cttatcatgt ctgtataccg tcgacctcta gctagagctt ggcgtaatca tggtcatagc 1140
tgtttcctgt gtgaaattgt tatccgctca caattccaca caacatacga gccggggcag 1200
gataatatat ggtagggttc atagccagag taaccttttt ttttaatttt tattttattt 1260
tatttttgag atcag 1275
<210> 57 <211> 1094 <212> ДНК
<213> Искусственная последовательность
<220>
<223> GSC9765 <400> 57
ctgtctccgg gcaaatgatg aaagcttggt aggtgatcct cctgctgctt tggttcaggg 60
ttttgcttga gggggggggg tggtgatttc cttgccatgg gcagactgag cagaaaaggc 120
cattgggacc atgttctgaa tgcctccacc tcaaccaccg gccggtagga ccaaagccac 180
cccgtgtttt ctcaggatct cttttcccag ggagatccct cggcccaaag agggagatgg 240
caatgctgga tgtgtgcaca ataattcaac aggcattgga acttcagcat cgatgctgaa 300
tgcaattaac aatgctcaag cagaaccccc ggctccatca gcacagtgca ggaccaaacc 360
ccatgctgca gcagtggggc tgtctgtacg gggtgggcaa tgggaaccgg ggtctgctgg 420
ggctcctgct gcttcagtgc tgccatgcag ccacacatcc tgagagctga aagggtcggc 480
gtcctcacct ggtgcacacc gtagctctgc cccacagctt taaggcacct ggctaacctc 540
tgcgcttctt cccttccctc ctccctggct caggtggtgg tggatctccc cccgaggacc 600
cccctgactc caagaatacc ctggtgctgt tcggcgctgg cttcggcgcc gtgattaccg 660
tggtcgtgat cgtcgtgatt atcaagtgct tctgcaagca ccggtcctgc ttccggcgga 720
agcagaccgt gtttctgtga tgattcgaaa tgaccgacca agcgacgccc aacctgccat 840
cacgagattt cgattccacc gccgccttct atgaaaggtt gggcttcgga atcgttttcc 900
gggacgccgg ctggatgatc ctccagcgcg gggatctcat gctggagttc ttcgcccacc 960
ccaacttgtt tattgcagct tataatggtt acaaataaag caatagcatc acaaatttca 1020
caaataaagc atttttttca ctgcattcta gttgtggttt gtccaaactc atcaatgtat 1080
cttatcatgt ctgt 1094
<210> 58
<211> 1094
<212> ДНК
<213> Искусственная последовательность
<220>
<223> GSC9764
<400> 58
ctgtctcccg
gtaaatgatg
aaagcttggt
aggtgatcct
cctgctgctt
tggttcaggg
ttttgcttga
gggggggggg
tggtgatttc
cttgccatgg
gcagactgag
cagaaaaggc
120
cattgggacc
atgttctgaa
tgcctccacc
tcaaccaccg
gccggtagga
ccaaagccac
180
cccgtgtttt
ctcaggatct
cttttcccag
ggagatccct
cggcccaaag
agggagatgg
240
caatgctgga
tgtgtgcaca
ataattcaac
aggcattgga
acttcagcat
cgatgctgaa
300
tgcaattaac
aatgctcaag
cagaaccccc
ggctccatca
gcacagtgca
ggaccaaacc
360
ccatgctgca
gcagtggggc
tgtctgtacg
gggtgggcaa
tgggaaccgg
ggtctgctgg
420
ggctcctgct
gcttcagtgc
tgccatgcag
ccacacatcc
tgagagctga
aagggtcggc
480
gtcctcacct
ggtgcacacc
gtagctctgc
cccacagctt
taaggcacct
ggctaacctc
540
tgcgcttctt
cccttccctc
ctccctggct
caggtggtgg
tggatctccc
cccgaggacc
600
cccctgactc
caagaatacc
ctggtgctgt
tcggcgctgg
cttcggcgcc
gtgattaccg
660
tggtcgtgat
cgtcgtgatt
atcaagtgct
tctgcaagca
ccggtcctgc
ttccggcgga
720
acgaggcctc
cagagagaca
aacaactccc
tgaccttcgg
ccccgaggaa
gccctggctg
780
agcagaccgt
gtttctgtga
tgattcgaaa
tgaccgacca
agcgacgccc
aacctgccat
840
cacgagattt
cgattccacc
gccgccttct
atgaaaggtt
gggcttcgga
atcgttttcc
900
gggacgccgg
ctggatgatc
ctccagcgcg
gggatctcat
gctggagttc
ttcgcccacc
960
ccaacttgtt
tattgcagct
tataatggtt
acaaataaag
caatagcatc
acaaatttca
1020
caaataaagc
atttttttca
ctgcattcta
gttgtggttt
gtccaaactc
atcaatgtat
1080
cttatcatgt
ctgt
1094
<210> 59 <211> 1076 <212> ДНК
<213> Искусственная последовательность
<220>
<223> GSC9949 <400> 59
ctgtctccgg gtaaatgatg aaagcttggt aggtgatcct cctgctgctt tggttcaggg 60
ttttgcttga gggggggggg tggtgatttc cttgccatgg gcagactgag cagaaaaggc 120
cattgggacc atgttctgaa tgcctccacc tcaaccaccg gccggtagga ccaaagccac 180
cccgtgtttt ctcaggatct cttttcccag ggagatccct cggcccaaag agggagatgg 240
caatgctgga tgtgtgcaca ataattcaac aggcattgga acttcagcat cgatgctgaa 300
tgcaattaac aatgctcaag cagaaccccc ggctccatca gcacagtgca ggaccaaacc 360
ccatgctgca gcagtggggc tgtctgtacg gggtgggcaa tgggaaccgg ggtctgctgg 420
ggctcctgct gcttcagtgc tgccatgcag ccacacatcc tgagagctga aagggtcggc 480
gtcctcacct ggtgcacacc gtagctctgc cccacagctt taaggcacct ggctaaccgt 540
ctccttctgg gacaggtggt ggtggatctc cccccgagga cccccctgac tccaagaata 600
ccctggtgct gttcggcgct ggcttcggcg ccgtgattac cgtggtcgtg atcgtcgtga 660
ttatcaagtg cttctgcaag caccggtcct gcttccggcg gaacgaggcc tccagagaga 720
caaacaactc cctgaccttc ggccccgagg aagccctggc tgagcagacc gtgtttctgt 780
gatgattcga aatgaccgac caagcgacgc ccaacctgcc atcacgagat ttcgattcca 840
ccgccgcctt ctatgaaagg ttgggcttcg gaatcgtttt ccgggacgcc ggctggatga 900
tcctccagcg cggggatctc atgctggagt tcttcgccca ccccaacttg tttattgcag 960
cttataatgg ttacaaataa agcaatagca tcacaaattt cacaaataaa gcattttttt 1020
cactgcattc tagttgtggt ttgtccaaac tcatcaatgt atcttatcat gtctgt 1076
<210> 60 <211> 1076 <212> ДНК
<213> Искусственная последовательность
<220>
<223> GSC9768 <400> 60
ctgtctccgg gtaaatgatg aaagcttggt aggtgatcct cctgctgctt tggttcaggg 60
ttttgcttga gggggggggg tggtgatttc cttgccatgg gcagactgag cagaaaaggc 120
cattgggacc atgttctgaa tgcctccacc tcaaccaccg gccggtagga ccaaagccac 180
cccgtgtttt ctcaggatct cttttcccag ggagatccct cggcccaaag agggagatgg 240
caatgctgga tgtgtgcaca ataattcaac aggcattgga acttcagcat cgatgctgaa 300
ccatgctgca gcagtggggc tgtctgtacg gggtgggcaa tgggaaccgg ggtctgctgg 420
ggctcctgct gcttcagtgc tgccatgcag ccacacatcc tgagagctga aagggtcggc 480
gtcctcacct ggtgcacacc gtagctctgc cccacagctt taaggcacct ggctaaccct 540
gggaggattg cacaggtggt ggtggatctc cccccgagga cccccctgac tccaagaata 600
ccctggtgct gttcggcgct ggcttcggcg ccgtgattac cgtggtcgtg atcgtcgtga 660
ttatcaagtg cttctgcaag caccggtcct gcttccggcg gaacgaggcc tccagagaga 720
caaacaactc cctgaccttc ggccccgagg aagccctggc tgagcagacc gtgtttctgt 780
gatgattcga aatgaccgac caagcgacgc ccaacctgcc atcacgagat ttcgattcca 840
ccgccgcctt ctatgaaagg ttgggcttcg gaatcgtttt ccgggacgcc ggctggatga 900
tcctccagcg cggggatctc atgctggagt tcttcgccca ccccaacttg tttattgcag 960
cttataatgg ttacaaataa agcaatagca tcacaaattt cacaaataaa gcattttttt 1020
cactgcattc tagttgtggt ttgtccaaac tcatcaatgt atcttatcat gtctgt 1076
<210> 61 <211> 1076 <212> ДНК
<213> Искусственная последовательность
<220>
<223> GSC9763 <400> 61
ctgtctccgg gtaaatgatg aaagcttggt aggtgatcct cctgctgctt tggttcaggg 60
ttttgcttga gggggggggg tggtgatttc cttgccatgg gcagactgag cagaaaaggc 120
cattgggacc atgttctgaa tgcctccacc tcaaccaccg gccggtagga ccaaagccac 180
cccgtgtttt ctcaggatct cttttcccag ggagatccct cggcccaaag agggagatgg 240
caatgctgga tgtgtgcaca ataattcaac aggcattgga acttcagcat cgatgctgaa 300
tgcaattaac aatgctcaag cagaaccccc ggctccatca gcacagtgca ggaccaaacc 360
ccatgctgca gcagtggggc tgtctgtacg gggtgggcaa tgggaaccgg ggtctgctgg 420
ggctcctgct gcttcagtgc tgccatgcag ccacacatcc tgagagctga aagggtcggc 480
gtcctcacct ggtgcacacc gtagctctgc cccacagctt taaggcacct ggctaaccct 540
gtccttattg cacaggtggt ggtggatctc cccccgagga cccccctgac tccaagaata 600
ccctggtgct gttcggcgct ggcttcggcg ccgtgattac cgtggtcgtg atcgtcgtga 660
ttatcaagtg cttctgcaag caccggtcct gcttccggcg gaacgaggcc tccagagaga 720
caaacaactc cctgaccttc ggccccgagg aagccctggc tgagcagacc gtgtttctgt 780
gatgattcga aatgaccgac caagcgacgc ccaacctgcc atcacgagat ttcgattcca 840
tcctccagcg cggggatctc atgctggagt tcttcgccca ccccaacttg tttattgcag 960
cttataatgg ttacaaataa agcaatagca tcacaaattt cacaaataaa gcattttttt 1020
cactgcattc tagttgtggt ttgtccaaac tcatcaatgt atcttatcat gtctgt 1076
<210> 62 <211> 1076 <212> ДНК
<213> Искусственная последовательность
<220>
<223> GSC9770 <400> 62
ctgtctccgg gtaaatgatg aaagcttggt aggtgatcct cctgctgctt tggttcaggg 60
ttttgcttga gggggggggg tggtgatttc cttgccatgg gcagactgag cagaaaaggc 120
cattgggacc atgttctgaa tgcctccacc tcaaccaccg gccggtagga ccaaagccac 180
cccgtgtttt ctcaggatct cttttcccag ggagatccct cggcccaaag agggagatgg 240
caatgctgga tgtgtgcaca ataattcaac aggcattgga acttcagcat cgatgctgaa 300
tgcaattaac aatgctcaag cagaaccccc ggctccatca gcacagtgca ggaccaaacc 360
ccatgctgca gcagtggggc tgtctgtacg gggtgggcaa tgggaaccgg ggtctgctgg 420
ggctcctgct gcttcagtgc tgccatgcag ccacacatcc tgagagctga aagggtcggc 480
gtcctcacct ggtgcacacc gtagctctgc cccacagctt taaggcacct ggctaaccga 540
gacctgaggg gacaggtggt ggtggatctc cccccgagga cccccctgac tccaagaata 600
ccctggtgct gttcggcgct ggcttcggcg ccgtgattac cgtggtcgtg atcgtcgtga 660
ttatcaagtg cttctgcaag caccggtcct gcttccggcg gaacgaggcc tccagagaga 720
caaacaactc cctgaccttc ggccccgagg aagccctggc tgagcagacc gtgtttctgt 780
gatgattcga aatgaccgac caagcgacgc ccaacctgcc atcacgagat ttcgattcca 840
ccgccgcctt ctatgaaagg ttgggcttcg gaatcgtttt ccgggacgcc ggctggatga 900
tcctccagcg cggggatctc atgctggagt tcttcgccca ccccaacttg tttattgcag 960
cttataatgg ttacaaataa agcaatagca tcacaaattt cacaaataaa gcattttttt 1020
cactgcattc tagttgtggt ttgtccaaac tcatcaatgt atcttatcat gtctgt 1076
<210> 63
<211> 1094
<212> ДНК
<213> Искусственная последовательность
<220>
<223> GSC9950
ttttgcttga
gggggggggg
tggtgatttc
cttgccatgg
gcagactgag
cagaaaaggc
120
cattgggacc
atgttctgaa
tgcctccacc
tcaaccaccg
gccggtagga
ccaaagccac
180
cccgtgtttt
ctcaggatct
cttttcccag
ggagatccct
cggcccaaag
agggagatgg
240
caatgctgga
tgtgtgcaca
ataattcaac
aggcattgga
acttcagcat
cgatgctgaa
300
tgcaattaac
aatgctcaag
cagaaccccc
ggctccatca
gcacagtgca
ggaccaaacc
360
ccatgctgca
gcagtggggc
tgtctgtacg
gggtgggcaa
tgggaaccgg
ggtctgctgg
420
ggctcctgct
gcttcagtgc
tgccatgcag
ccacacatcc
tgagagctga
aagggtcggc
480
gtcctcacct
ggtgcacacc
gtagctctgc
cccacagctt
taaggcacct
ggctaacctc
540
tgcgcttctt
cccttccctg
ctacctggct
caggtggtgg
tggatctccc
cccgaggacc
600
cccctgactc
caagaatacc
ctggtgctgt
tcggcgctgg
cttcggcgcc
gtgattaccg
660
tggtcgtgat
cgtcgtgatt
atcaagtgct
tctgcaagca
ccggtcctgc
ttccggcgga
720
acgaggcctc
cagagagaca
aacaactccc
tgaccttcgg
ccccgaggaa
gccctggctg
780
agcagaccgt
gtttctgtga
tgattcgaaa
tgaccgacca
agcgacgccc
aacctgccat
840
cacgagattt
cgattccacc
gccgccttct
atgaaaggtt
gggcttcgga
atcgttttcc
900
gggacgccgg
ctggatgatc
ctccagcgcg
gggatctcat
gctggagttc
ttcgcccacc
960
ccaacttgtt
tattgcagct
tataatggtt
acaaataaag
caatagcatc
acaaatttca
1020
caaataaagc
atttttttca
ctgcattcta
gttgtggttt
gtccaaactc
atcaatgtat
1080
cttatcatgt
ctgt
1094
<210> 64
<211> 211
<212> ДНК
<213> Искусственная последовательность
<220>
<223> GeneArt_Seq32
<400> 64
accggtggag agctgtgcgg aggcgcagga cggggagctg gacgccctgt ggctgggcgt 60
gctgagactg ctgctgttca agctgctcct gttcgacctg ctcctcacct tcttcaaggt 120
gaagtggatc ttctcctcgg tggtggacct gaagcagacc atcatccccg actacaggaa 180
catgatcgga cagggggcct agtgattcga a 211
<210> 65 <211> 2009 <212> ДНК
<213> Homo sapiens
<400> 65
agctttctgg ggcaggccag gcctgacctt ggctttgggg cagggagggg gctaaggtga 60 ggcaggtggc gccagcaggt gcacacccaa tgcccatgag cccagacact ggacgctgaa 120
gcggtcacat ggcaccacct ctcttgcagc ctccaccaag ggcccatcgg tcttccccct 240
ggcaccctcc tccaagagca cctctggggg cacagcggcc ctgggctgcc tggtcaagga 300
ctacttcccc gaaccggtga cggtgtcgtg gaactcaggc gccctgacca gcggcgtgca 360
caccttcccg gctgtcctac agtcctcagg actctactcc ctcagcagcg tggtgaccgt 420
gccctccagc agcttgggca cccagaccta catctgcaac gtgaatcaca agcccagcaa 480
caccaaggtg gacaagaaag ttggtgagag gccagcacag ggagggaggg tgtctgctgg 540
aagcaggctc agcgctcctg cctggacgca tcccggctat gcagccccag tccagggcag 600
caaggcaggc cccgtctgcc tcttcacccg gagcctctgc ccgccccact catgctcagg 660
gagagggtct tctggctttt tcccaggctc tgggcaggca caggctaggt gcccctaacc 720
caggccctgc acacaaaggg gcaggtgctg ggctcagacc tgccaagagc catatccggg 780
aggaccctgc ccctgaccta agcccacccc aaaggccaaa ctctccactc cctcagctcg 840
gacaccttct ctcctcccag attccagtaa ctcccaatct tctctctgca gagcccaaat 900
cttgtgacaa aactcacaca tgcccaccgt gcccaggtaa gccagcccag gcctcgccct 960
ccagctcaag gcgggacagg tgccctagag tagcctgcat ccagggacag gccccagccg 1020
ggtgctgaca cgtccacctc catctcttcc tcagcacctg aactcctggg gggaccgtca 1080
gtcttcctct tccccccaaa acccaaggac accctcatga tctcccggac ccctgaggtc 1140
acatgcgtgg tggtggacgt gagccacgaa gaccctgagg tcaagttcaa ctggtacgtg 1200
gacggcgtgg aggtgcataa tgccaagaca aagccgcggg aggagcagta caacagcacg 1260
taccgggtgg tcagcgtcct caccgtcctg caccaggact ggctgaatgg caaggagtac 1320
aagtgcaagg tctccaacaa agccctccca gcccccatcg agaaaaccat ctccaaagcc 1380
aaaggtggga cccgtggggt gcgagggcca catggacaga ggccggctcg gcccaccctc 1440
tgccctgaga gtgaccgctg taccaacctc tgtcctacag ggcagccccg agaaccacag 1500
gtgtacaccc tgcccccatc ccgggatgag ctgaccaaga accaggtcag cctgacctgc 1560
ctggtcaaag gcttctatcc cagcgacatc gccgtggagt gggagagcaa tgggcagccg 1620
gagaacaact acaagaccac gcctcccgtg ctggactccg acggctcctt cttcctctac 1680
agcaagctca ccgtggacaa gagcaggtgg cagcagggga acgtcttctc atgctccgtg 1740
atgcatgagg ctctgcacaa ccactacacg cagaagagcc tctccctgtc tccgggtaaa 1800
tgagtgcgac ggccggcaag ccccgctccc cgggctctcg cggtcgcacg aggatgcttg 1860
gcacgtaccc cctgtacata cttcccgggc gcccagcatg gaaataaagc acccagcgct 1920
gccctgggcc cctgcgagac tgtgatggtt ctttccacgg gtcaggccga gtctgaggcc 1980
<210> 66
<211> 216
<212> ДНК
<213> Искусственная последовательность
<220>
<223> GeneArt_Seq43 <400> 66
ccccccgagg acccccctga ctccaagaat accctggtgc tgttcggcgc tggcttcggc 60 gccgtgatta ccgtggtcgt gatcgtcgtg attatcaagt gcttctgcaa gcaccggtcc 120 tgcttccggc ggaacgaggc ctccagagag acaaacaact ccctgacctt cggccccgag 180 gaagccctgg ctgagcagac cgtgtttctg tgatga 216
<210> 67
<211> 546
<212> ДНК
<213> Искусственная последовательность
<220>
<223> Конструкция GSC2819
<400> 67
ggtaggtgat cctcctgctg ctttggttca gggttttgct tgaggggggg gggtggtgat 60
ttccttgcca tgggcagact gagcagaaaa ggccattggg accatgttct gaatgcctcc 120
acctcaacca ccggccggta ggaccaaagc caccccgtgt tttctcagga tctcttttcc 180
cagggagatc cctcggccca aagagggaga tggcaatgct ggatgtgtgc acaataattc 240
aacaggcatt ggaacttcag catcgatgct gaatgcaatt aacaatgctc aagcagaacc 300
cccggctcca tcagcacagt gcaggaccaa accccatgct gcagcagtgg ggctgtctgt 360
acggggtggg caatgggaac cggggtctgc tggggctcct gctgcttcag tgctgccatg 420
cagccacaca tcctgagagc tgaaagggtc ggcgtcctca cctggtgcac accgtagctc 480
tgccccacag ctttaaggca cctggctaac ctctgcgctt cttcccttcc ctcctccctg 540
gctcag 546
<210> 68
<211> 528
<212> ДНК
<213> Искусственная последовательность
<220>
<223> Конструкция GSC3469 <400> 68
ggtaggtgat cctcctgctg ctttggttca gggttttgct tgaggggggg gggtggtgat 60 ttccttgcca tgggcagact gagcagaaaa ggccattggg accatgttct gaatgcctcc 120 acctcaacca ccggccggta ggaccaaagc caccccgtgt tttctcagga tctcttttcc 180
cagggagatc
cctcggccca
aagagggaga
tggcaatgct
ggatgtgtgc
acaataattc
240
aacaggcatt
ggaacttcag
catcgatgct
gaatgcaatt
aacaatgctc
aagcagaacc
300
cccggctcca
tcagcacagt
gcaggaccaa
accccatgct
gcagcagtgg
ggctgtctgt
360
acggggtggg
caatgggaac
cggggtctgc
tggggctcct
gctgcttcag
tgctgccatg
420
cagccacaca
tcctgagagc
tgaaagggtc
ggcgtcctca
cctggtgcac
accgtagctc
480
tgccccacag
ctttaaggca
cctggctaac
cgagggagga
gggaacag
528
<210> 69 <211> 563 <212> ДНК
<213> Искусственная последовательность
<220>
<223> Интрон cTNT-I4
<400> 69
gtaaatgatg
aaagcttggt
aggtgatcct
cctgctgctt
tggttcaggg
ttttgcttga
gggggggggg
tggtgatttc
cttgccatgg
gcagactgag
cagaaaaggc
cattgggacc
120
atgttctgaa
tgcctccacc
tcaaccaccg
gccggtagga
ccaaagccac
cccgtgtttt
180
ctcaggatct
cttttcccag
ggagatccct
cggcccaaag
agggagatgg
caatgctgga
240
tgtgtgcaca
ataattcaac
aggcattgga
acttcagcat
cgatgctgaa
tgcaattaac
300
aatgctcaag
cagaaccccc
ggctccatca
gcacagtgca
ggaccaaacc
ccatgctgca
360
gcagtggggc
tgtctgtacg
gggtgggcaa
tgggaaccgg
ggtctgctgg
ggctcctgct
420
gcttcagtgc
tgccatgcag
ccacacatcc
tgagagctga
aagggtcggc
gtcctcacct
480
ggtgcacacc
gtagctctgc
cccacagctt
taaggcacct
ggctaacctc
tgcgcttctt
540
cccttccctc
ctccctggct
cag
563
<210> 70 <211> 545 <212> ДНК
<213> Искусственная последовательность
<220>
<223> Интрон I4(0Y)
<400> 70
gtaaatgatg
aaagcttggt
aggtgatcct
cctgctgctt
tggttcaggg
ttttgcttga
gggggggggg
tggtgatttc
cttgccatgg
gcagactgag
cagaaaaggc
cattgggacc
120
atgttctgaa
tgcctccacc
tcaaccaccg
gccggtagga
ccaaagccac
cccgtgtttt
180
ctcaggatct
cttttcccag
ggagatccct
cggcccaaag
agggagatgg
caatgctgga
240
tgtgtgcaca
ataattcaac
aggcattgga
acttcagcat
cgatgctgaa
tgcaattaac
300
aatgctcaag
cagaaccccc
ggctccatca
gcacagtgca
ggaccaaacc
ccatgctgca
360
gcagtggggc
tgtctgtacg
gggtgggcaa
tgggaaccgg
ggtctgctgg
ggctcctgct
420
gcttcagtgc
tgccatgcag
ccacacatcc
tgagagctga
aagggtcggc
gtcctcacct
480
ggtgcacacc
gtagctctgc
cccacagctt
taaggcacct
ggctaaccga
gggaggaggg
540
aacag
545
<210> 71 <211> 700 <212> ДНК
<213> Искусственная последовательность
<220>
<223> Интрон I4(polyA)
<400> 71
gtaaatgatg
aaagcttggt
aggtgatcct
cctgctgctt
tggttcaggg
ttttgcttga
gggggggggg
tggtgatttc
cttgccatgg
gcagactgag
cagaaaaggc
cattgggacc
120
atgttctgaa
tgcctccacc
tcaaccaccg
gccggtagga
ccaaagccac
cccgtgtttt
180
ctcaggatct
cttttcccag
ggagatccct
cggcccaaag
agggagatgg
caatgctgga
240
tgtgtgcaca
ataattcaac
aggcattgga
acttcagcat
cgatacttgt
ttattgcagc
300
ttataatggt
tacaaataaa
gcaatagcat
cacaaatttc
acaaataaag
catttttttc
360
actgcattct
agttgtggtt
tgtccaaact
catcaatgta
tcttatcatg
tctgtatcga
420
tgctgaatgc
aattaacaat
gctcaagcag
aacccccggc
tccatcagca
cagtgcagga
480
ccaaacccca
tgctgcagca
gtggggctgt
ctgtacgggg
tgggcaatgg
gaaccggggt
540
ctgctggggc
tcctgctgct
tcagtgctgc
catgcagcca
cacatcctga
gagctgaaag
600
ggtcggcgtc
ctcacctggt
gcacaccgta
gctctgcccc
acagctttaa
ggcacctggc
660
taacctctgc
gcttcttccc
ttccctcctc
cctggctcag
700
<210> 72 <211> 545 <212> ДНК
<213> Искусственная последовательность
<220>
<223> Интрон I4(3Y)
<400> 72
gtaaatgatg
aaagcttggt
aggtgatcct
cctgctgctt
tggttcaggg
ttttgcttga
gggggggggg
tggtgatttc
cttgccatgg
gcagactgag
cagaaaaggc
cattgggacc
120
atgttctgaa
tgcctccacc
tcaaccaccg
gccggtagga
ccaaagccac
cccgtgtttt
180
ctcaggatct
cttttcccag
ggagatccct
cggcccaaag
agggagatgg
caatgctgga
240
tgtgtgcaca
ataattcaac
aggcattgga
acttcagcat
cgatgctgaa
tgcaattaac
300
aatgctcaag
cagaaccccc
ggctccatca
gcacagtgca
ggaccaaacc
ccatgctgca
360
gcagtggggc
tgtctgtacg
gggtgggcaa
tgggaaccgg
ggtctgctgg
ggctcctgct
420
gcttcagtgc
tgccatgcag
ccacacatcc
tgagagctga
aagggtcggc
gtcctcacct
480
ggtgcacacc
gtagctctgc
cccacagctt
taaggcacct
ggctaaccga
gacctgaggg
540
gacag
545
<210> 73 <211> 545 <212> ДНК
<213> Искусственная последовательность
<220>
<223> Интрон I4(5Y)
<400> 73
gtaaatgatg
aaagcttggt
aggtgatcct
cctgctgctt
tggttcaggg
ttttgcttga
gggggggggg
tggtgatttc
cttgccatgg
gcagactgag
cagaaaaggc
cattgggacc
120
atgttctgaa
tgcctccacc
tcaaccaccg
gccggtagga
ccaaagccac
cccgtgtttt
180
ctcaggatct
cttttcccag
ggagatccct
cggcccaaag
agggagatgg
caatgctgga
240
tgtgtgcaca
ataattcaac
aggcattgga
acttcagcat
cgatgctgaa
tgcaattaac
300
aatgctcaag
cagaaccccc
ggctccatca
gcacagtgca
ggaccaaacc
ccatgctgca
360
gcagtggggc
tgtctgtacg
gggtgggcaa
tgggaaccgg
ggtctgctgg
ggctcctgct
420
gcttcagtgc
tgccatgcag
ccacacatcc
tgagagctga
aagggtcggc
gtcctcacct
480
ggtgcacacc
gtagctctgc
cccacagctt
taaggcacct
ggctaaccct
gtccttattg
540
cacag
545
<210> 74 <211> 545 <212> ДНК
<213> Искусственная последовательность
<220>
<223> Интрон I4(5Y-5)
<400> 74
gtaaatgatg
aaagcttggt
aggtgatcct
cctgctgctt
tggttcaggg
ttttgcttga
gggggggggg
tggtgatttc
cttgccatgg
gcagactgag
cagaaaaggc
cattgggacc
120
atgttctgaa
tgcctccacc
tcaaccaccg
gccggtagga
ccaaagccac
cccgtgtttt
180
ctcaggatct
cttttcccag
ggagatccct
cggcccaaag
agggagatgg
caatgctgga
240
tgtgtgcaca
ataattcaac
aggcattgga
acttcagcat
cgatgctgaa
tgcaattaac
300
aatgctcaag
cagaaccccc
ggctccatca
gcacagtgca
ggaccaaacc
ccatgctgca
360
gcagtggggc
tgtctgtacg
gggtgggcaa
tgggaaccgg
ggtctgctgg
ggctcctgct
420
gcttcagtgc
tgccatgcag
ccacacatcc
tgagagctga
aagggtcggc
gtcctcacct
480
ggtgcacacc gtagctctgc cccacagctt taaggcacct ggctaaccct gggaggattg 540 cacag 545
<210> 75
<211> 545
<212> ДНК
<213> Искусственная последовательность
<220>
<223> Интрон I4(9Y) <400> 75
gtaaatgatg aaagcttggt aggtgatcct cctgctgctt tggttcaggg ttttgcttga 60
gggggggggg tggtgatttc cttgccatgg gcagactgag cagaaaaggc cattgggacc 120
atgttctgaa tgcctccacc tcaaccaccg gccggtagga ccaaagccac cccgtgtttt 180
ctcaggatct cttttcccag ggagatccct cggcccaaag agggagatgg caatgctgga 240
tgtgtgcaca ataattcaac aggcattgga acttcagcat cgatgctgaa tgcaattaac 300
aatgctcaag cagaaccccc ggctccatca gcacagtgca ggaccaaacc ccatgctgca 360
gcagtggggc tgtctgtacg gggtgggcaa tgggaaccgg ggtctgctgg ggctcctgct 420
gcttcagtgc tgccatgcag ccacacatcc tgagagctga aagggtcggc gtcctcacct 480
ggtgcacacc gtagctctgc cccacagctt taaggcacct ggctaaccgt ctccttctgg 540
gacag 545
<210> 76
<211> 563
<212> ДНК
<213> Искусственная последовательность
<220>
<223> Интрон I4(15Y-3')
<210> 77
<211> 1035
<212> ДНК
<213> Искусственная последовательность
<220>
<223> Интрон I4(SV40ter)
<210> 78
<211> 563
<212> ДНК
<213> Искусственная последовательность
<220>
<223> Интрон I4(SD_GGC)
<400> 78
gcaaatgatg aaagcttggt aggtgatcct cctgctgctt tggttcaggg ttttgcttga 60
gggggggggg tggtgatttc cttgccatgg gcagactgag cagaaaaggc cattgggacc 120
atgttctgaa tgcctccacc tcaaccaccg gccggtagga ccaaagccac cccgtgtttt 180
aatgctcaag cagaaccccc ggctccatca gcacagtgca ggaccaaacc ccatgctgca 360
gcagtggggc tgtctgtacg gggtgggcaa tgggaaccgg ggtctgctgg ggctcctgct 420
gcttcagtgc tgccatgcag ccacacatcc tgagagctga aagggtcggc gtcctcacct 480
ggtgcacacc gtagctctgc cccacagctt taaggcacct ggctaacctc tgcgcttctt 540
cccttccctc ctccctggct cag 563
<210> 79
<211> 375
<212> ДНК
<213> Искусственная последовательность
<220>
<223> GSB59abc
<400> 79
ctgtccctgg gcaagtgata gaagcttgcg gccgcgctta gcgatatcga attctctaga 60
ggtacccccg gggggcccct cgagttcgaa atgaccgacc aagcgacgcc caacctgcca 120
tcacgagatt tcgattccac cgccgccttc tatgaaaggt tgggcttcgg aatcgttttc 180
cgggacgccg gctggatgat cctccagcgc ggggatctca tgctggagtt cttcgcccac 240
cccaacttgt ttattgcagc ttataatggt tacaaataaa gcaatagcat cacaaatttc 300
acaaataaag catttttttc actgcattct agttgtggtt tgtccaaact catcaatgta 360
tcttatcatg tctgt 375
<210> 80
<211> 1094
<212> ДНК
<213> Искусственная последовательность
<220>
<223> GSC11218 <400> 80
ctgtctccgg gtaaatgatg aaagcttggt aggtgatcct cctgctgctt tggttcaggg 60
ttttgcttga gggggggggg tggtgatttc cttgccatgg gcagactgag cagaaaaggc 120
cattgggacc atgttctgaa tgcctccacc tcaaccaccg gccggtagga ccaaagccac 180
cccgtgtttt ctcaggatct cttttcccag ggagatccct cggcccaaag agggagatgg 240
caatgctgga tgtgtgcaca ataattcaac aggcattgga acttcagcat cgatgctgaa 300
tgcaattaac aatgctcaag cagaaccccc ggctccatca gcacagtgca ggaccaaacc 360
ccatgctgca gcagtggggc tgtctgtacg gggtgggcaa tgggaaccgg ggtctgctgg 420
ggctcctgct gcttcagtgc tgccatgcag ccacacatcc tgagagctga aagggtcggc 480
cccctgactc caagaatacc ctggtgctgt tcggcgctgg cttcggcgcc gtgattaccg 660
tggtcgtgat cgtcgtgatt atcaagtgct tctgcaagca ccggtcctgc ttccggcgga 720
acgaggcctc cagagagaca aacaactccc tgaccttcgg ccccgaggaa gccctggctg 780
agcagaccgt gtttctgtga tgattcgaaa tgaccgacca agcgacgccc aacctgccat 840
cacgagattt cgattccacc gccgccttct atgaaaggtt gggcttcgga atcgttttcc 900
gggacgccgg ctggatgatc ctccagcgcg gggatctcat gctggagttc ttcgcccacc 960
ccaacttgtt tattgcagct tataatggtt acaaataaag caatagcatc acaaatttca 1020
caaataaagc atttttttca ctgcattcta gttgtggttt gtccaaactc atcaatgtat 1080
cttatcatgt ctgt 1094
<210> 81
<211> 1097
<212> ДНК
<213> Искусственная последовательность
<220>
<223> GSC11213
<400> 81
ctgtctccgg
gtaaatgatg
aaagcttggt
aggtgatcct
cctgctgctt
tggttcaggg
ttttgcttga
gggggggggg
tggtgatttc
cttgccatgg
gcagactgag
cagaaaaggc
120
cattgggacc
atgttctgaa
tgcctccacc
tcaaccaccg
gccggtagga
ccaaagccac
180
cccgtgtttt
ctcaggatct
cttttcccag
ggagatccct
cggcccaaag
agggagatgg
240
caatgctgga
tgtgtgcaca
ataattcaac
aggcattgga
acttcagcat
cgatgctgaa
300
tgcaattaac
aatgctcaag
cagaaccccc
ggctccatca
gcacagtgca
ggaccaaacc
360
ccatgctgca
gcagtggggc
tgtctgtacg
gggtgggcaa
tgggaaccgg
ggtctgctgg
420
ggctcctgct
gcttcagtgc
tgccatgcag
ccacacatcc
tgagagctga
aagggtcggc
480
gtcctcacct
ggtgcacacc
gtagctctgc
cccacagctt
taaggcacct
ggctaacctc
540
tgcgcttctt
cccttccctc
ctccctggct
caggtggtgg
tggatctccc
cccgaggacc
600
cccctgactc
caagaatctg
gctctgatcc
tgggacctgt
gctggctctg
ctggcactgg
660
tggctctggg
agtgctggga
ctgtggaagt
gcttctgcaa
gcaccggtcc
tgcttccggc
720
ggaacgaggc
ctccagagag
acaaacaact
ccctgacctt
cggccccgag
gaagccctgg
780
ctgagcagac
cgtgtttctg
tgatgattcg
aaatgaccga
ccaagcgacg
cccaacctgc
840
catcacgaga
tttcgattcc
accgccgcct
tctatgaaag
gttgggcttc
ggaatcgttt
900
tccgggacgc
cggctggatg
atcctccagc
gcggggatct
catgctggag
ttcttcgccc
960
accccaactt
gtttattgca
gcttataatg
gttacaaata
aagcaatagc
atcacaaatt
1020
tcacaaataa agcatttttt tcactgcatt ctagttgtgg tttgtccaaa ctcatcaatg 1080 tatcttatca tgtctgt 1097
<210> 82
<211> 1097
<212> ДНК
<213> Искусственная последовательность
<220>
<223> GSC11214
<400> 82
ctgtctccgg
gtaaatgatg
aaagcttggt
aggtgatcct
cctgctgctt
tggttcaggg
ttttgcttga
gggggggggg
tggtgatttc
cttgccatgg
gcagactgag
cagaaaaggc
120
cattgggacc
atgttctgaa
tgcctccacc
tcaaccaccg
gccggtagga
ccaaagccac
180
cccgtgtttt
ctcaggatct
cttttcccag
ggagatccct
cggcccaaag
agggagatgg
240
caatgctgga
tgtgtgcaca
ataattcaac
aggcattgga
acttcagcat
cgatgctgaa
300
tgcaattaac
aatgctcaag
cagaaccccc
ggctccatca
gcacagtgca
ggaccaaacc
360
ccatgctgca
gcagtggggc
tgtctgtacg
gggtgggcaa
tgggaaccgg
ggtctgctgg
420
ggctcctgct
gcttcagtgc
tgccatgcag
ccacacatcc
tgagagctga
aagggtcggc
480
gtcctcacct
ggtgcacacc
gtagctctgc
cccacagctt
taaggcacct
ggctaacctc
540
tgcgcttctt
cccttccctc
ctccctggct
caggtggtgg
tggatctccc
cccgaggacc
600
cccctgactc
caagaatatc
gccgccatca
tcgtgatcct
ggtgttgctc
ctgctgctgg
660
gcatcggcct
gatgtggtgg
ttctggaagt
gcttctgcaa
gcaccggtcc
tgcttccggc
720
ggaacgaggc
ctccagagag
acaaacaact
ccctgacctt
cggccccgag
gaagccctgg
780
ctgagcagac
cgtgtttctg
tgatgattcg
aaatgaccga
ccaagcgacg
cccaacctgc
840
catcacgaga
tttcgattcc
accgccgcct
tctatgaaag
gttgggcttc
ggaatcgttt
900
tccgggacgc
cggctggatg
atcctccagc
gcggggatct
catgctggag
ttcttcgccc
960
accccaactt
gtttattgca
gcttataatg
gttacaaata
aagcaatagc
atcacaaatt
1020
tcacaaataa
agcatttttt
tcactgcatt
ctagttgtgg
tttgtccaaa
ctcatcaatg
1080
tatcttatca
tgtctgt
1097
<210> 83
<211> 1094
<212> ДНК
<213> Искусственная последовательность
<220>
<223> GSC11210
ttttgcttga
gggggggggg
tggtgatttc
cttgccatgg
gcagactgag
cagaaaaggc
120
cattgggacc
atgttctgaa
tgcctccacc
tcaaccaccg
gccggtagga
ccaaagccac
180
cccgtgtttt
ctcaggatct
cttttcccag
ggagatccct
cggcccaaag
agggagatgg
240
caatgctgga
tgtgtgcaca
ataattcaac
aggcattgga
acttcagcat
cgatgctgaa
300
tgcaattaac
aatgctcaag
cagaaccccc
ggctccatca
gcacagtgca
ggaccaaacc
360
ccatgctgca
gcagtggggc
tgtctgtacg
gggtgggcaa
tgggaaccgg
ggtctgctgg
420
ggctcctgct
gcttcagtgc
tgccatgcag
ccacacatcc
tgagagctga
aagggtcggc
480
gtcctcacct
ggtgcacacc
gtagctctgc
cccacagctt
taaggcacct
ggctaacctc
540
tgcgcttctt
cccttccctc
ctccctggct
caggtggtgg
tggatctccc
cccgaggacc
600
cccctgactc
caagaatatg
gccctgattg
tgctgggcgg
agtggctggc
ctgctgctgt
660
ttatcggcct
gggcatcttc
ttcaagtgct
tctgcaagca
ccggtcctgc
ttccggcgga
720
acgaggcctc
cagagagaca
aacaactccc
tgaccttcgg
ccccgaggaa
gccctggctg
780
agcagaccgt
gtttctgtga
tgattcgaaa
tgaccgacca
agcgacgccc
aacctgccat
840
cacgagattt
cgattccacc
gccgccttct
atgaaaggtt
gggcttcgga
atcgttttcc
900
gggacgccgg
ctggatgatc
ctccagcgcg
gggatctcat
gctggagttc
ttcgcccacc
960
ccaacttgtt
tattgcagct
tataatggtt
acaaataaag
caatagcatc
acaaatttca
1020
caaataaagc
atttttttca
ctgcattcta
gttgtggttt
gtccaaactc
atcaatgtat
1080
cttatcatgt
ctgt
1094
<210> 84
<211> 1094
<212> ДНК
<213> Искусственная последовательность
<220>
<223> GSC11205 <400> 84
ctgtctccgg gtaaatgatg aaagcttggt aggtgatcct cctgctgctt tggttcaggg 60
ttttgcttga gggggggggg tggtgatttc cttgccatgg gcagactgag cagaaaaggc 120
cattgggacc atgttctgaa tgcctccacc tcaaccaccg gccggtagga ccaaagccac 180
cccgtgtttt ctcaggatct cttttcccag ggagatccct cggcccaaag agggagatgg 240
caatgctgga tgtgtgcaca ataattcaac aggcattgga acttcagcat cgatgctgaa 300
tgcaattaac aatgctcaag cagaaccccc ggctccatca gcacagtgca ggaccaaacc 360
ccatgctgca gcagtggggc tgtctgtacg gggtgggcaa tgggaaccgg ggtctgctgg 420
ggctcctgct gcttcagtgc tgccatgcag ccacacatcc tgagagctga aagggtcggc 480
cccctgactc caagaatatc gctggcgtga tcgctggcat cctgctgttc gtgatcatct 660
tcctgggcgt ggtgctcgtg atgaagtgct tctgcaagca ccggtcctgc ttccggcgga 720
acgaggcctc cagagagaca aacaactccc tgaccttcgg ccccgaggaa gccctggctg 780
agcagaccgt gtttctgtga tgattcgaaa tgaccgacca agcgacgccc aacctgccat 840
cacgagattt cgattccacc gccgccttct atgaaaggtt gggcttcgga atcgttttcc 900
gggacgccgg ctggatgatc ctccagcgcg gggatctcat gctggagttc ttcgcccacc 960
ccaacttgtt tattgcagct tataatggtt acaaataaag caatagcatc acaaatttca 1020
caaataaagc atttttttca ctgcattcta gttgtggttt gtccaaactc atcaatgtat 1080
cttatcatgt ctgt 1094
<210> 85
<211> 1094
<212> ДНК
<213> Искусственная последовательность
<220>
<223> GSC11217
<400> 85
ctgtctccgg
gtaaatgatg
aaagcttggt
aggtgatcct
cctgctgctt
tggttcaggg
ttttgcttga
gggggggggg
tggtgatttc
cttgccatgg
gcagactgag
cagaaaaggc
120
cattgggacc
atgttctgaa
tgcctccacc
tcaaccaccg
gccggtagga
ccaaagccac
180
cccgtgtttt
ctcaggatct
cttttcccag
ggagatccct
cggcccaaag
agggagatgg
240
caatgctgga
tgtgtgcaca
ataattcaac
aggcattgga
acttcagcat
cgatgctgaa
300
tgcaattaac
aatgctcaag
cagaaccccc
ggctccatca
gcacagtgca
ggaccaaacc
360
ccatgctgca
gcagtggggc
tgtctgtacg
gggtgggcaa
tgggaaccgg
ggtctgctgg
420
ggctcctgct
gcttcagtgc
tgccatgcag
ccacacatcc
tgagagctga
aagggtcggc
480
gtcctcacct
ggtgcacacc
gtagctctgc
cccacagctt
taaggcacct
ggctaacctc
540
tgcgcttctt
cccttccctc
ctccctggct
caggtggtgg
tggatctccc
cccgaggacc
600
cccctgactc
caagaatgct
ctggtcgtga
tccccatcat
cttcggcatc
ctgttcgcca
660
tcctgctggt
gctggtgttc
atcaagtgct
tctgcaagca
ccggtcctgc
ttccggcgga
720
acgaggcctc
cagagagaca
aacaactccc
tgaccttcgg
ccccgaggaa
gccctggctg
780
agcagaccgt
gtttctgtga
tgattcgaaa
tgaccgacca
agcgacgccc
aacctgccat
840
cacgagattt
cgattccacc
gccgccttct
atgaaaggtt
gggcttcgga
atcgttttcc
900
gggacgccgg
ctggatgatc
ctccagcgcg
gggatctcat
gctggagttc
ttcgcccacc
960
ccaacttgtt
tattgcagct
tataatggtt
acaaataaag
caatagcatc
acaaatttca
1020
caaataaagc atttttttca ctgcattcta gttgtggttt gtccaaactc atcaatgtat 1080 cttatcatgt ctgt 1094
<210> 86
<211> 1097
<212> ДНК
<213> Искусственная последовательность
<220>
<223> GSC11756
<400> 86
ctgtctccgg
gtaaatgatg
aaagcttggt
aggtgatcct
cctgctgctt
tggttcaggg
ttttgcttga
gggggggggg
tggtgatttc
cttgccatgg
gcagactgag
cagaaaaggc
120
cattgggacc
atgttctgaa
tgcctccacc
tcaaccaccg
gccggtagga
ccaaagccac
180
cccgtgtttt
ctcaggatct
cttttcccag
ggagatccct
cggcccaaag
agggagatgg
240
caatgctgga
tgtgtgcaca
ataattcaac
aggcattgga
acttcagcat
cgatgctgaa
300
tgcaattaac
aatgctcaag
cagaaccccc
ggctccatca
gcacagtgca
ggaccaaacc
360
ccatgctgca
gcagtggggc
tgtctgtacg
gggtgggcaa
tgggaaccgg
ggtctgctgg
420
ggctcctgct
gcttcagtgc
tgccatgcag
ccacacatcc
tgagagctga
aagggtcggc
480
gtcctcacct
ggtgcacacc
gtagctctgc
cccacagctt
taaggcacct
ggctaacctc
540
tgcgcttctt
cccttccctc
ctccctggct
caggtggtgg
tggatctccc
cccgaggacc
600
cccctgactc
caagaatatc
atccctatcg
tggccggcgt
ggtggctggc
atcgtgctga
660
ttggactggc
cctgctgctg
atctggaagt
gcttctgcaa
gcaccggtcc
tgcttccggc
720
ggaacgaggc
ctccagagag
acaaacaact
ccctgacctt
cggccccgag
gaagccctgg
780
ctgagcagac
cgtgtttctg
tgatgattcg
aaatgaccga
ccaagcgacg
cccaacctgc
840
catcacgaga
tttcgattcc
accgccgcct
tctatgaaag
gttgggcttc
ggaatcgttt
900
tccgggacgc
cggctggatg
atcctccagc
gcggggatct
catgctggag
ttcttcgccc
960
accccaactt
gtttattgca
gcttataatg
gttacaaata
aagcaatagc
atcacaaatt
1020
tcacaaataa
agcatttttt
tcactgcatt
ctagttgtgg
tttgtccaaa
ctcatcaatg
1080
tatcttatca
tgtctgt
1097
<210> 87
<211> 1100
<212> ДНК
<213> Искусственная последовательность
<220>
<223> GSC11296
ttttgcttga
gggggggggg
tggtgatttc
cttgccatgg
gcagactgag
cagaaaaggc
120
cattgggacc
atgttctgaa
tgcctccacc
tcaaccaccg
gccggtagga
ccaaagccac
180
cccgtgtttt
ctcaggatct
cttttcccag
ggagatccct
cggcccaaag
agggagatgg
240
caatgctgga
tgtgtgcaca
ataattcaac
aggcattgga
acttcagcat
cgatgctgaa
300
tgcaattaac
aatgctcaag
cagaaccccc
ggctccatca
gcacagtgca
ggaccaaacc
360
ccatgctgca
gcagtggggc
tgtctgtacg
gggtgggcaa
tgggaaccgg
ggtctgctgg
420
ggctcctgct
gcttcagtgc
tgccatgcag
ccacacatcc
tgagagctga
aagggtcggc
480
gtcctcacct
ggtgcacacc
gtagctctgc
cccacagctt
taaggcacct
ggctaacctc
540
tgcgcttctt
cccttccctc
ctccctggct
caggtggtgg
tggatctccc
cccgaggacc
600
cccctgactc
caagaatgga
atcgtggctg
gactggctgt
gctggccgtg
gtcgtgattg
660
gagctgtggt
ggccgccgtg
atgtgcagaa
agtgcttctg
caagcaccgg
tcctgcttcc
720
ggcggaacga
ggcctccaga
gagacaaaca
actccctgac
cttcggcccc
gaggaagccc
780
tggctgagca
gaccgtgttt
ctgtgatgat
tcgaaatgac
cgaccaagcg
acgcccaacc
840
tgccatcacg
agatttcgat
tccaccgccg
ccttctatga
aaggttgggc
ttcggaatcg
900
ttttccggga
cgccggctgg
atgatcctcc
agcgcgggga
tctcatgctg
gagttcttcg
960
cccaccccaa
cttgtttatt
gcagcttata
atggttacaa
ataaagcaat
agcatcacaa
1020
atttcacaaa
taaagcattt
ttttcactgc
attctagttg
tggtttgtcc
aaactcatca
1080
atgtatctta
tcatgtctgt
1100
<210> 88
<211> 1100
<212> ДНК
<213> Искусственная последовательность
<220>
<223> GSC11295 <400> 88
ctgtctccgg gtaaatgatg aaagcttggt aggtgatcct cctgctgctt tggttcaggg 60
ttttgcttga gggggggggg tggtgatttc cttgccatgg gcagactgag cagaaaaggc 120
cattgggacc atgttctgaa tgcctccacc tcaaccaccg gccggtagga ccaaagccac 180
cccgtgtttt ctcaggatct cttttcccag ggagatccct cggcccaaag agggagatgg 240
caatgctgga tgtgtgcaca ataattcaac aggcattgga acttcagcat cgatgctgaa 300
tgcaattaac aatgctcaag cagaaccccc ggctccatca gcacagtgca ggaccaaacc 360
ccatgctgca gcagtggggc tgtctgtacg gggtgggcaa tgggaaccgg ggtctgctgg 420
ggctcctgct gcttcagtgc tgccatgcag ccacacatcc tgagagctga aagggtcggc 480
cccctgactc caagaatctg atcattgccc tgcctgtggc cgtgctgctg atcgtgggag 660
gcctcgtgat catgctgtac gtgttccaca agtgcttctg caagcaccgg tcctgcttcc 720
ggcggaacga ggcctccaga gagacaaaca actccctgac cttcggcccc gaggaagccc 780
tggctgagca gaccgtgttt ctgtgatgat tcgaaatgac cgaccaagcg acgcccaacc 840
tgccatcacg agatttcgat tccaccgccg ccttctatga aaggttgggc ttcggaatcg 900
ttttccggga cgccggctgg atgatcctcc agcgcgggga tctcatgctg gagttcttcg 960
cccaccccaa cttgtttatt gcagcttata atggttacaa ataaagcaat agcatcacaa 1020
atttcacaaa taaagcattt ttttcactgc attctagttg tggtttgtcc aaactcatca 1080
atgtatctta tcatgtctgt 1100
<210> 89
<211> 1100
<212> ДНК
<213> Искусственная последовательность
<220>
<223> GSC11390
<400> 89
ctgtctccgg
gtaaatgatg
aaagcttggt
aggtgatcct
cctgctgctt
tggttcaggg
ttttgcttga
gggggggggg
tggtgatttc
cttgccatgg
gcagactgag
cagaaaaggc
120
cattgggacc
atgttctgaa
tgcctccacc
tcaaccaccg
gccggtagga
ccaaagccac
180
cccgtgtttt
ctcaggatct
cttttcccag
ggagatccct
cggcccaaag
agggagatgg
240
caatgctgga
tgtgtgcaca
ataattcaac
aggcattgga
acttcagcat
cgatgctgaa
300
tgcaattaac
aatgctcaag
cagaaccccc
ggctccatca
gcacagtgca
ggaccaaacc
360
ccatgctgca
gcagtggggc
tgtctgtacg
gggtgggcaa
tgggaaccgg
ggtctgctgg
420
ggctcctgct
gcttcagtgc
tgccatgcag
ccacacatcc
tgagagctga
aagggtcggc
480
gtcctcacct
ggtgcacacc
gtagctctgc
cccacagctt
taaggcacct
ggctaacctc
540
tgcgcttctt
cccttccctc
ctccctggct
caggtggtgg
tggatctccc
cccgaggacc
600
cccctgactc
caagaatggc
ctgctgatcg
gcatctccat
cgcctccctg
tgcctggtgg
660
tggccctgct
ggccctgctg
tgccacctga
agtgcttctg
caagcaccgg
tcctgcttcc
720
ggcggaacga
ggcctccaga
gagacaaaca
actccctgac
cttcggcccc
gaggaagccc
780
tggctgagca
gaccgtgttt
ctgtgatgat
tcgaaatgac
cgaccaagcg
acgcccaacc
840
tgccatcacg
agatttcgat
tccaccgccg
ccttctatga
aaggttgggc
ttcggaatcg
900
ttttccggga
cgccggctgg
atgatcctcc
agcgcgggga
tctcatgctg
gagttcttcg
960
cccaccccaa
cttgtttatt
gcagcttata
atggttacaa
ataaagcaat
agcatcacaa
1020
atttcacaaa taaagcattt ttttcactgc attctagttg tggtttgtcc aaactcatca 1080 atgtatctta tcatgtctgt 1100
<210> 90
<211> 1100
<212> ДНК
<213> Искусственная последовательность
<220>
<223> GSC11391
<400> 90
ctgtctccgg
gtaaatgatg
aaagcttggt
aggtgatcct
cctgctgctt
tggttcaggg
ttttgcttga
gggggggggg
tggtgatttc
cttgccatgg
gcagactgag
cagaaaaggc
120
cattgggacc
atgttctgaa
tgcctccacc
tcaaccaccg
gccggtagga
ccaaagccac
180
cccgtgtttt
ctcaggatct
cttttcccag
ggagatccct
cggcccaaag
agggagatgg
240
caatgctgga
tgtgtgcaca
ataattcaac
aggcattgga
acttcagcat
cgatgctgaa
300
tgcaattaac
aatgctcaag
cagaaccccc
ggctccatca
gcacagtgca
ggaccaaacc
360
ccatgctgca
gcagtggggc
tgtctgtacg
gggtgggcaa
tgggaaccgg
ggtctgctgg
420
ggctcctgct
gcttcagtgc
tgccatgcag
ccacacatcc
tgagagctga
aagggtcggc
480
gtcctcacct
ggtgcacacc
gtagctctgc
cccacagctt
taaggcacct
ggctaacctc
540
tgcgcttctt
cccttccctc
ctccctggct
caggtggtgg
tggatctccc
cccgaggacc
600
cccctgactc
caagaatctg
ctgctgggcg
tgtccgtgtc
ctgcatcgtg
atcctggccg
660
tgtgcctgct
gtgctacgtg
tccatcacca
agtgcttctg
caagcaccgg
tcctgcttcc
720
ggcggaacga
ggcctccaga
gagacaaaca
actccctgac
cttcggcccc
gaggaagccc
780
tggctgagca
gaccgtgttt
ctgtgatgat
tcgaaatgac
cgaccaagcg
acgcccaacc
840
tgccatcacg
agatttcgat
tccaccgccg
ccttctatga
aaggttgggc
ttcggaatcg
900
ttttccggga
cgccggctgg
atgatcctcc
agcgcgggga
tctcatgctg
gagttcttcg
960
cccaccccaa
cttgtttatt
gcagcttata
atggttacaa
ataaagcaat
agcatcacaa
1020
atttcacaaa
taaagcattt
ttttcactgc
attctagttg
tggtttgtcc
aaactcatca
1080
atgtatctta
tcatgtctgt
1100
<210> 91
<211> 1097
<212> ДНК
<213> Искусственная последовательность
<220>
<223> GSC11392
ttttgcttga
gggggggggg
tggtgatttc
cttgccatgg
gcagactgag
cagaaaaggc
120
cattgggacc
atgttctgaa
tgcctccacc
tcaaccaccg
gccggtagga
ccaaagccac
180
cccgtgtttt
ctcaggatct
cttttcccag
ggagatccct
cggcccaaag
agggagatgg
240
caatgctgga
tgtgtgcaca
ataattcaac
aggcattgga
acttcagcat
cgatgctgaa
300
tgcaattaac
aatgctcaag
cagaaccccc
ggctccatca
gcacagtgca
ggaccaaacc
360
ccatgctgca
gcagtggggc
tgtctgtacg
gggtgggcaa
tgggaaccgg
ggtctgctgg
420
ggctcctgct
gcttcagtgc
tgccatgcag
ccacacatcc
tgagagctga
aagggtcggc
480
gtcctcacct
ggtgcacacc
gtagctctgc
cccacagctt
taaggcacct
ggctaacctc
540
tgcgcttctt
cccttccctc
ctccctggct
caggtggtgg
tggatctccc
cccgaggacc
600
cccctgactc
caagaatacc
aacaccgtgg
gctccgtgat
cggcgtgatc
gtgaccatct
660
tcgtgtccgg
caccgtgtac
ttcatcaagt
gcttctgcaa
gcaccggtcc
tgcttccggc
720
ggaacgaggc
ctccagagag
acaaacaact
ccctgacctt
cggccccgag
gaagccctgg
780
ctgagcagac
cgtgtttctg
tgatgattcg
aaatgaccga
ccaagcgacg
cccaacctgc
840
catcacgaga
tttcgattcc
accgccgcct
tctatgaaag
gttgggcttc
ggaatcgttt
900
tccgggacgc
cggctggatg
atcctccagc
gcggggatct
catgctggag
ttcttcgccc
960
accccaactt
gtttattgca
gcttataatg
gttacaaata
aagcaatagc
atcacaaatt
1020
tcacaaataa
agcatttttt
tcactgcatt
ctagttgtgg
tttgtccaaa
ctcatcaatg
1080
tatcttatca
tgtctgt
1097
<210> 92
<211> 1097
<212> ДНК
<213> Искусственная последовательность
<220>
<223> GSC11397 <400> 92
ctgtctccgg gtaaatgatg aaagcttggt aggtgatcct cctgctgctt tggttcaggg 60
ttttgcttga gggggggggg tggtgatttc cttgccatgg gcagactgag cagaaaaggc 120
cattgggacc atgttctgaa tgcctccacc tcaaccaccg gccggtagga ccaaagccac 180
cccgtgtttt ctcaggatct cttttcccag ggagatccct cggcccaaag agggagatgg 240
caatgctgga tgtgtgcaca ataattcaac aggcattgga acttcagcat cgatgctgaa 300
tgcaattaac aatgctcaag cagaaccccc ggctccatca gcacagtgca ggaccaaacc 360
ccatgctgca gcagtggggc tgtctgtacg gggtgggcaa tgggaaccgg ggtctgctgg 420
ggctcctgct gcttcagtgc tgccatgcag ccacacatcc tgagagctga aagggtcggc 480
cccctgactc caagaatatc accctgatca tcttcggcgt gatggccggc gtgatcggca 660
ccatcctgct gatctcctac ggcatcaagt gcttctgcaa gcaccggtcc tgcttccggc 720
ggaacgaggc ctccagagag acaaacaact ccctgacctt cggccccgag gaagccctgg 780
ctgagcagac cgtgtttctg tgatgattcg aaatgaccga ccaagcgacg cccaacctgc 840
catcacgaga tttcgattcc accgccgcct tctatgaaag gttgggcttc ggaatcgttt 900
tccgggacgc cggctggatg atcctccagc gcggggatct catgctggag ttcttcgccc 960
accccaactt gtttattgca gcttataatg gttacaaata aagcaatagc atcacaaatt 1020
tcacaaataa agcatttttt tcactgcatt ctagttgtgg tttgtccaaa ctcatcaatg 1080
tatcttatca tgtctgt 1097
<210> 93
<211> 1091
<212> ДНК
<213> Искусственная последовательность
<220>
<223> GSC11204
<400> 93
ctgtctccgg
gtaaatgatg
aaagcttggt
aggtgatcct
cctgctgctt
tggttcaggg
ttttgcttga
gggggggggg
tggtgatttc
cttgccatgg
gcagactgag
cagaaaaggc
120
cattgggacc
atgttctgaa
tgcctccacc
tcaaccaccg
gccggtagga
ccaaagccac
180
cccgtgtttt
ctcaggatct
cttttcccag
ggagatccct
cggcccaaag
agggagatgg
240
caatgctgga
tgtgtgcaca
ataattcaac
aggcattgga
acttcagcat
cgatgctgaa
300
tgcaattaac
aatgctcaag
cagaaccccc
ggctccatca
gcacagtgca
ggaccaaacc
360
ccatgctgca
gcagtggggc
tgtctgtacg
gggtgggcaa
tgggaaccgg
ggtctgctgg
420
ggctcctgct
gcttcagtgc
tgccatgcag
ccacacatcc
tgagagctga
aagggtcggc
480
gtcctcacct
ggtgcacacc
gtagctctgc
cccacagctt
taaggcacct
ggctaacctc
540
tgcgcttctt
cccttccctc
ctccctggct
caggtggtgg
tggatctccc
cccgaggacc
600
cccctgactc
caagaatgcc
ctgtggctgg
gcgtgctgag
actgctgctg
ttcaagctgc
660
tcctgttcga
cctgctcctc
aagtgcttct
gcaagcaccg
gtcctgcttc
cggcggaacg
720
aggcctccag
agagacaaac
aactccctga
ccttcggccc
cgaggaagcc
ctggctgagc
780
agaccgtgtt
tctgtgatga
ttcgaaatga
ccgaccaagc
gacgcccaac
ctgccatcac
840
gagatttcga
ttccaccgcc
gccttctatg
aaaggttggg
cttcggaatc
gttttccggg
900
acgccggctg
gatgatcctc
cagcgcgggg
atctcatgct
ggagttcttc
gcccacccca
960
acttgtttat
tgcagcttat
aatggttaca
aataaagcaa
tagcatcaca
aatttcacaa
1020
atcatgtctg t 1091
<210> 94
<211> 1091
<212> ДНК
<213> Искусственная последовательность
<220>
<223> GSC11216
<400> 94
ctgtctccgg
gtaaatgatg
aaagcttggt
aggtgatcct
cctgctgctt
tggttcaggg
ttttgcttga
gggggggggg
tggtgatttc
cttgccatgg
gcagactgag
cagaaaaggc
120
cattgggacc
atgttctgaa
tgcctccacc
tcaaccaccg
gccggtagga
ccaaagccac
180
cccgtgtttt
ctcaggatct
cttttcccag
ggagatccct
cggcccaaag
agggagatgg
240
caatgctgga
tgtgtgcaca
ataattcaac
aggcattgga
acttcagcat
cgatgctgaa
300
tgcaattaac
aatgctcaag
cagaaccccc
ggctccatca
gcacagtgca
ggaccaaacc
360
ccatgctgca
gcagtggggc
tgtctgtacg
gggtgggcaa
tgggaaccgg
ggtctgctgg
420
ggctcctgct
gcttcagtgc
tgccatgcag
ccacacatcc
tgagagctga
aagggtcggc
480
gtcctcacct
ggtgcacacc
gtagctctgc
cccacagctt
taaggcacct
ggctaacctc
540
tgcgcttctt
cccttccctc
ctccctggct
caggtggtgg
tggatctccc
cccgaggacc
600
cccctgactc
caagaatgcc
ctgtggctgg
gcgtgctggt
actgctgctg
ttcaagctgc
660
tcctgttcga
cctgctcctc
aagtgcttct
gcaagcaccg
gtcctgcttc
cggcggaacg
720
aggcctccag
agagacaaac
aactccctga
ccttcggccc
cgaggaagcc
ctggctgagc
780
agaccgtgtt
tctgtgatga
ttcgaaatga
ccgaccaagc
gacgcccaac
ctgccatcac
840
gagatttcga
ttccaccgcc
gccttctatg
aaaggttggg
cttcggaatc
gttttccggg
900
acgccggctg
gatgatcctc
cagcgcgggg
atctcatgct
ggagttcttc
gcccacccca
960
acttgtttat
tgcagcttat
aatggttaca
aataaagcaa
tagcatcaca
aatttcacaa
1020
ataaagcatt
tttttcactg
cattctagtt
gtggtttgtc
caaactcatc
aatgtatctt
1080
atcatgtctg
1091
<210> 95
<211> 1091
<212> ДНК
<213> Искусственная последовательность
<220>
<223> GSC11203
ttttgcttga
gggggggggg
tggtgatttc
cttgccatgg
gcagactgag
cagaaaaggc
120
cattgggacc
atgttctgaa
tgcctccacc
tcaaccaccg
gccggtagga
ccaaagccac
180
cccgtgtttt
ctcaggatct
cttttcccag
ggagatccct
cggcccaaag
agggagatgg
240
caatgctgga
tgtgtgcaca
ataattcaac
aggcattgga
acttcagcat
cgatgctgaa
300
tgcaattaac
aatgctcaag
cagaaccccc
ggctccatca
gcacagtgca
ggaccaaacc
360
ccatgctgca
gcagtggggc
tgtctgtacg
gggtgggcaa
tgggaaccgg
ggtctgctgg
420
ggctcctgct
gcttcagtgc
tgccatgcag
ccacacatcc
tgagagctga
aagggtcggc
480
gtcctcacct
ggtgcacacc
gtagctctgc
cccacagctt
taaggcacct
ggctaacctc
540
tgcgcttctt
cccttccctc
ctccctggct
caggtggtgg
tggatctccc
cccgaggacc
600
cccctgactc
caagaatgcc
ctgtggctgg
gcgtgctgag
actgctgctg
ttcgtgctgc
660
tcctgttcga
cctgctcctc
aagtgcttct
gcaagcaccg
gtcctgcttc
cggcggaacg
720
aggcctccag
agagacaaac
aactccctga
ccttcggccc
cgaggaagcc
ctggctgagc
780
agaccgtgtt
tctgtgatga
ttcgaaatga
ccgaccaagc
gacgcccaac
ctgccatcac
840
gagatttcga
ttccaccgcc
gccttctatg
aaaggttggg
cttcggaatc
gttttccggg
900
acgccggctg
gatgatcctc
cagcgcgggg
atctcatgct
ggagttcttc
gcccacccca
960
acttgtttat
tgcagcttat
aatggttaca
aataaagcaa
tagcatcaca
aatttcacaa
1020
ataaagcatt
tttttcactg
cattctagtt
gtggtttgtc
caaactcatc
aatgtatctt
1080
atcatgtctg
1091
<210> 96
<211> 1091
<212> ДНК
<213> Искусственная последовательность
<220>
<223> GSC11211
<400> 96
ctgtctccgg gtaaatgatg aaagcttggt aggtgatcct cctgctgctt tggttcaggg 60
ttttgcttga gggggggggg tggtgatttc cttgccatgg gcagactgag cagaaaaggc 120
cattgggacc atgttctgaa tgcctccacc tcaaccaccg gccggtagga ccaaagccac 180
cccgtgtttt ctcaggatct cttttcccag ggagatccct cggcccaaag agggagatgg 240
caatgctgga tgtgtgcaca ataattcaac aggcattgga acttcagcat cgatgctgaa 300
tgcaattaac aatgctcaag cagaaccccc ggctccatca gcacagtgca ggaccaaacc 360
ccatgctgca gcagtggggc tgtctgtacg gggtgggcaa tgggaaccgg ggtctgctgg 420
ggctcctgct gcttcagtgc tgccatgcag ccacacatcc tgagagctga aagggtcggc 480
cccctgactc caagaatgcc ctgtggctgg gcgtgctgag actgctgctg ttcaagctgc 660
tcctgttcgt cctgctcctc aagtgcttct gcaagcaccg gtcctgcttc cggcggaacg 720
aggcctccag agagacaaac aactccctga ccttcggccc cgaggaagcc ctggctgagc 780
agaccgtgtt tctgtgatga ttcgaaatga ccgaccaagc gacgcccaac ctgccatcac 840
gagatttcga ttccaccgcc gccttctatg aaaggttggg cttcggaatc gttttccggg 900
acgccggctg gatgatcctc cagcgcgggg atctcatgct ggagttcttc gcccacccca 960
acttgtttat tgcagcttat aatggttaca aataaagcaa tagcatcaca aatttcacaa 1020
ataaagcatt tttttcactg cattctagtt gtggtttgtc caaactcatc aatgtatctt 1080
atcatgtctg t 1091
<210> 97
<211> 1091
<212> ДНК
<213> Искусственная последовательность
<220>
<223> GSC11212
<400> 97
ctgtctccgg
gtaaatgatg
aaagcttggt
aggtgatcct
cctgctgctt
tggttcaggg
ttttgcttga
gggggggggg
tggtgatttc
cttgccatgg
gcagactgag
cagaaaaggc
120
cattgggacc
atgttctgaa
tgcctccacc
tcaaccaccg
gccggtagga
ccaaagccac
180
cccgtgtttt
ctcaggatct
cttttcccag
ggagatccct
cggcccaaag
agggagatgg
240
caatgctgga
tgtgtgcaca
ataattcaac
aggcattgga
acttcagcat
cgatgctgaa
300
tgcaattaac
aatgctcaag
cagaaccccc
ggctccatca
gcacagtgca
ggaccaaacc
360
ccatgctgca
gcagtggggc
tgtctgtacg
gggtgggcaa
tgggaaccgg
ggtctgctgg
420
ggctcctgct
gcttcagtgc
tgccatgcag
ccacacatcc
tgagagctga
aagggtcggc
480
gtcctcacct
ggtgcacacc
gtagctctgc
cccacagctt
taaggcacct
ggctaacctc
540
tgcgcttctt
cccttccctc
ctccctggct
caggtggtgg
tggatctccc
cccgaggacc
600
cccctgactc
caagaatgcc
ctgtggctgg
gcgtgctggt
actgctgctg
ttcgtgctgc
660
tcctgttcga
cctgctcctc
aagtgcttct
gcaagcaccg
gtcctgcttc
cggcggaacg
720
aggcctccag
agagacaaac
aactccctga
ccttcggccc
cgaggaagcc
ctggctgagc
780
agaccgtgtt
tctgtgatga
ttcgaaatga
ccgaccaagc
gacgcccaac
ctgccatcac
840
gagatttcga
ttccaccgcc
gccttctatg
aaaggttggg
cttcggaatc
gttttccggg
900
acgccggctg
gatgatcctc
cagcgcgggg
atctcatgct
ggagttcttc
gcccacccca
960
acttgtttat
tgcagcttat
aatggttaca
aataaagcaa
tagcatcaca
aatttcacaa
1020
atcatgtctg t 1091
<210> 98
<211> 1091
<212> ДНК
<213> Искусственная последовательность
<220>
<223> GSC11398
<400> 98
ctgtctccgg
gtaaatgatg
aaagcttggt
aggtgatcct
cctgctgctt
tggttcaggg
ttttgcttga
gggggggggg
tggtgatttc
cttgccatgg
gcagactgag
cagaaaaggc
120
cattgggacc
atgttctgaa
tgcctccacc
tcaaccaccg
gccggtagga
ccaaagccac
180
cccgtgtttt
ctcaggatct
cttttcccag
ggagatccct
cggcccaaag
agggagatgg
240
caatgctgga
tgtgtgcaca
ataattcaac
aggcattgga
acttcagcat
cgatgctgaa
300
tgcaattaac
aatgctcaag
cagaaccccc
ggctccatca
gcacagtgca
ggaccaaacc
360
ccatgctgca
gcagtggggc
tgtctgtacg
gggtgggcaa
tgggaaccgg
ggtctgctgg
420
ggctcctgct
gcttcagtgc
tgccatgcag
ccacacatcc
tgagagctga
aagggtcggc
480
gtcctcacct
ggtgcacacc
gtagctctgc
cccacagctt
taaggcacct
ggctaacctc
540
tgcgcttctt
cccttccctc
ctccctggct
caggtggtgg
tggatctccc
cccgaggacc
600
cccctgactc
caagaatgcc
ctgtggctgg
gcgtgctggt
actgctgctg
ttcaagctgc
660
tcctgttcgt
cctgctcctc
aagtgcttct
gcaagcaccg
gtcctgcttc
cggcggaacg
720
aggcctccag
agagacaaac
aactccctga
ccttcggccc
cgaggaagcc
ctggctgagc
780
agaccgtgtt
tctgtgatga
ttcgaaatga
ccgaccaagc
gacgcccaac
ctgccatcac
840
gagatttcga
ttccaccgcc
gccttctatg
aaaggttggg
cttcggaatc
gttttccggg
900
acgccggctg
gatgatcctc
cagcgcgggg
atctcatgct
ggagttcttc
gcccacccca
960
acttgtttat
tgcagcttat
aatggttaca
aataaagcaa
tagcatcaca
aatttcacaa
1020
ataaagcatt
tttttcactg
cattctagtt
gtggtttgtc
caaactcatc
aatgtatctt
1080
atcatgtctg
1091
<210> 99
<211> 1091
<212> ДНК
<213> Искусственная последовательность
<220>
<223> GSC11208
ttttgcttga
gggggggggg
tggtgatttc
cttgccatgg
gcagactgag
cagaaaaggc
120
cattgggacc
atgttctgaa
tgcctccacc
tcaaccaccg
gccggtagga
ccaaagccac
180
cccgtgtttt
ctcaggatct
cttttcccag
ggagatccct
cggcccaaag
agggagatgg
240
caatgctgga
tgtgtgcaca
ataattcaac
aggcattgga
acttcagcat
cgatgctgaa
300
tgcaattaac
aatgctcaag
cagaaccccc
ggctccatca
gcacagtgca
ggaccaaacc
360
ccatgctgca
gcagtggggc
tgtctgtacg
gggtgggcaa
tgggaaccgg
ggtctgctgg
420
ggctcctgct
gcttcagtgc
tgccatgcag
ccacacatcc
tgagagctga
aagggtcggc
480
gtcctcacct
ggtgcacacc
gtagctctgc
cccacagctt
taaggcacct
ggctaacctc
540
tgcgcttctt
cccttccctc
ctccctggct
caggtggtgg
tggatctccc
cccgaggacc
600
cccctgactc
caagaatgcc
ctgtggctgg
gcgtgctgag
actgctgctg
ttcgtgctgc
660
tcctgttcgt
cctgctcctc
aagtgcttct
gcaagcaccg
gtcctgcttc
cggcggaacg
720
aggcctccag
agagacaaac
aactccctga
ccttcggccc
cgaggaagcc
ctggctgagc
780
agaccgtgtt
tctgtgatga
ttcgaaatga
ccgaccaagc
gacgcccaac
ctgccatcac
840
gagatttcga
ttccaccgcc
gccttctatg
aaaggttggg
cttcggaatc
gttttccggg
900
acgccggctg
gatgatcctc
cagcgcgggg
atctcatgct
ggagttcttc
gcccacccca
960
acttgtttat
tgcagcttat
aatggttaca
aataaagcaa
tagcatcaca
aatttcacaa
1020
ataaagcatt
tttttcactg
cattctagtt
gtggtttgtc
caaactcatc
aatgtatctt
1080
atcatgtctg
1091
<210> 100
<211> 1091
<212> ДНК
<213> Искусственная последовательность
<220>
<223> GSC11291 <400> 100
ctgtctccgg gtaaatgatg aaagcttggt aggtgatcct cctgctgctt tggttcaggg 60
ttttgcttga gggggggggg tggtgatttc cttgccatgg gcagactgag cagaaaaggc 120
cattgggacc atgttctgaa tgcctccacc tcaaccaccg gccggtagga ccaaagccac 180
cccgtgtttt ctcaggatct cttttcccag ggagatccct cggcccaaag agggagatgg 240
caatgctgga tgtgtgcaca ataattcaac aggcattgga acttcagcat cgatgctgaa 300
tgcaattaac aatgctcaag cagaaccccc ggctccatca gcacagtgca ggaccaaacc 360
ccatgctgca gcagtggggc tgtctgtacg gggtgggcaa tgggaaccgg ggtctgctgg 420
ggctcctgct gcttcagtgc tgccatgcag ccacacatcc tgagagctga aagggtcggc 480
cccctgactc caagaatgcc ctgtggctgg gcgtgctggt actgctgctg ttcgtgctgc 660
tcctgttcgt cctgctcctc aagtgcttct gcaagcaccg gtcctgcttc cggcggaacg 720
aggcctccag agagacaaac aactccctga ccttcggccc cgaggaagcc ctggctgagc 780
agaccgtgtt tctgtgatga ttcgaaatga ccgaccaagc gacgcccaac ctgccatcac 840
gagatttcga ttccaccgcc gccttctatg aaaggttggg cttcggaatc gttttccggg 900
acgccggctg gatgatcctc cagcgcgggg atctcatgct ggagttcttc gcccacccca 960
acttgtttat tgcagcttat aatggttaca aataaagcaa tagcatcaca aatttcacaa 1020
ataaagcatt tttttcactg cattctagtt gtggtttgtc caaactcatc aatgtatctt 1080
atcatgtctg t 1091
<210> 101
<211> 1085
<212> ДНК
<213> Искусственная последовательность
<220>
<223> GSC11297
<400> 101
ctgtctccgg
gtaaatgatg
aaagcttggt
aggtgatcct
cctgctgctt
tggttcaggg
ttttgcttga
gggggggggg
tggtgatttc
cttgccatgg
gcagactgag
cagaaaaggc
120
cattgggacc
atgttctgaa
tgcctccacc
tcaaccaccg
gccggtagga
ccaaagccac
180
cccgtgtttt
ctcaggatct
cttttcccag
ggagatccct
cggcccaaag
agggagatgg
240
caatgctgga
tgtgtgcaca
ataattcaac
aggcattgga
acttcagcat
cgatgctgaa
300
tgcaattaac
aatgctcaag
cagaaccccc
ggctccatca
gcacagtgca
ggaccaaacc
360
ccatgctgca
gcagtggggc
tgtctgtacg
gggtgggcaa
tgggaaccgg
ggtctgctgg
420
ggctcctgct
gcttcagtgc
tgccatgcag
ccacacatcc
tgagagctga
aagggtcggc
480
gtcctcacct
ggtgcacacc
gtagctctgc
cccacagctt
taaggcacct
ggctaacctc
540
tgcgcttctt
cccttccctc
ctccctggct
caggtggtgg
tggatctccc
cccgaggacc
600
cccctgactc
caagaatttc
ttcatccccc
tgctggtggt
gatcctgttc
gccgtggaca
660
ccggcctgtt
catcaagtgc
ttctgcaagc
accggtcctg
cttccggcgg
aacgaggcct
720
ccagagagac
aaacaactcc
ctgaccttcg
gccccgagga
agccctggct
gagcagaccg
780
tgtttctgtg
atgattcgaa
atgaccgacc
aagcgacgcc
caacctgcca
tcacgagatt
840
tcgattccac
cgccgccttc
tatgaaaggt
tgggcttcgg
aatcgttttc
cgggacgccg
900
gctggatgat
cctccagcgc
ggggatctca
tgctggagtt
cttcgcccac
cccaacttgt
960
ttattgcagc
ttataatggt
tacaaataaa
gcaatagcat
cacaaatttc
acaaataaag
1020
tctgt 1085
<210> 102
<211> 1085
<212> ДНК
<213> Искусственная последовательность
<220>
<223> GSC11298 <400> 102
ctgtctccgg gtaaatgatg aaagcttggt aggtgatcct cctgctgctt tggttcaggg 60
ttttgcttga gggggggggg tggtgatttc cttgccatgg gcagactgag cagaaaaggc 120
cattgggacc atgttctgaa tgcctccacc tcaaccaccg gccggtagga ccaaagccac 180
cccgtgtttt ctcaggatct cttttcccag ggagatccct cggcccaaag agggagatgg 240
caatgctgga tgtgtgcaca ataattcaac aggcattgga acttcagcat cgatgctgaa 300
tgcaattaac aatgctcaag cagaaccccc ggctccatca gcacagtgca ggaccaaacc 360
ccatgctgca gcagtggggc tgtctgtacg gggtgggcaa tgggaaccgg ggtctgctgg 420
ggctcctgct gcttcagtgc tgccatgcag ccacacatcc tgagagctga aagggtcggc 480
gtcctcacct ggtgcacacc gtagctctgc cccacagctt taaggcacct ggctaacctc 540
tgcgcttctt cccttccctc ctccctggct caggtggtgg tggatctccc cccgaggacc 600
cccctgactc caagaatatc ctgatcggca cctccgtggt gatcatcctg ttcatcctgc 660
tgttcttcct gctgaagtgc ttctgcaagc accggtcctg cttccggcgg aacgaggcct 720
ccagagagac aaacaactcc ctgaccttcg gccccgagga agccctggct gagcagaccg 780
tgtttctgtg atgattcgaa atgaccgacc aagcgacgcc caacctgcca tcacgagatt 840
tcgattccac cgccgccttc tatgaaaggt tgggcttcgg aatcgttttc cgggacgccg 900
gctggatgat cctccagcgc ggggatctca tgctggagtt cttcgcccac cccaacttgt 960
ttattgcagc ttataatggt tacaaataaa gcaatagcat cacaaatttc acaaataaag 1020
catttttttc actgcattct agttgtggtt tgtccaaact catcaatgta tcttatcatg 1080
tctgt 1085
<210> 103
<211> 1079
<212> ДНК
<213> Искусственная последовательность
<220>
<223> GSC11393 <400> 103
ctgtctccgg gtaaatgatg aaagcttggt aggtgatcct cctgctgctt tggttcaggg 60
cattgggacc atgttctgaa tgcctccacc tcaaccaccg gccggtagga ccaaagccac 180
cccgtgtttt ctcaggatct cttttcccag ggagatccct cggcccaaag agggagatgg 240
caatgctgga tgtgtgcaca ataattcaac aggcattgga acttcagcat cgatgctgaa 300
tgcaattaac aatgctcaag cagaaccccc ggctccatca gcacagtgca ggaccaaacc 360
ccatgctgca gcagtggggc tgtctgtacg gggtgggcaa tgggaaccgg ggtctgctgg 420
ggctcctgct gcttcagtgc tgccatgcag ccacacatcc tgagagctga aagggtcggc 480
gtcctcacct ggtgcacacc gtagctctgc cccacagctt taaggcacct ggctaacctc 540
tgcgcttctt cccttccctc ctccctggct caggtggtgg tggatctccc cccgaggacc 600
cccctgactc caagaatgtg ctggccctga tcgtgatctt cctgaccatc gccgtgctgc 660
tggccctgaa gtgcttctgc aagcaccggt cctgcttccg gcggaacgag gcctccagag 720
agacaaacaa ctccctgacc ttcggccccg aggaagccct ggctgagcag accgtgtttc 780
tgtgatgatt cgaaatgacc gaccaagcga cgcccaacct gccatcacga gatttcgatt 840
ccaccgccgc cttctatgaa aggttgggct tcggaatcgt tttccgggac gccggctgga 900
tgatcctcca gcgcggggat ctcatgctgg agttcttcgc ccaccccaac ttgtttattg 960
cagcttataa tggttacaaa taaagcaata gcatcacaaa tttcacaaat aaagcatttt 1020
tttcactgca ttctagttgt ggtttgtcca aactcatcaa tgtatcttat catgtctgt 1079
<210> 104 <211> 1106 <212> ДНК
<213> Искусственная последовательность
<220>
<223> GSC11394 <400> 104
ctgtctccgg gtaaatgatg aaagcttggt aggtgatcct cctgctgctt tggttcaggg 60
ttttgcttga gggggggggg tggtgatttc cttgccatgg gcagactgag cagaaaaggc 120
cattgggacc atgttctgaa tgcctccacc tcaaccaccg gccggtagga ccaaagccac 180
cccgtgtttt ctcaggatct cttttcccag ggagatccct cggcccaaag agggagatgg 240
caatgctgga tgtgtgcaca ataattcaac aggcattgga acttcagcat cgatgctgaa 300
tgcaattaac aatgctcaag cagaaccccc ggctccatca gcacagtgca ggaccaaacc 360
ccatgctgca gcagtggggc tgtctgtacg gggtgggcaa tgggaaccgg ggtctgctgg 420
ggctcctgct gcttcagtgc tgccatgcag ccacacatcc tgagagctga aagggtcggc 480
gtcctcacct ggtgcacacc gtagctctgc cccacagctt taaggcacct ggctaacctc 540
ccggcggcct gctgctgctg gtgtactact ggtccaagtg cttctgcaag caccggtcct 720
gcttccggcg gaacgaggcc tccagagaga caaacaactc cctgaccttc ggccccgagg 780
aagccctggc tgagcagacc gtgtttctgt gatgattcga aatgaccgac caagcgacgc 840
ccaacctgcc atcacgagat ttcgattcca ccgccgcctt ctatgaaagg ttgggcttcg 900
gaatcgtttt ccgggacgcc ggctggatga tcctccagcg cggggatctc atgctggagt 960
tcttcgccca ccccaacttg tttattgcag cttataatgg ttacaaataa agcaatagca 1020
tcacaaattt cacaaataaa gcattttttt cactgcattc tagttgtggt ttgtccaaac 1080
tcatcaatgt atcttatcat gtctgt 1106
<210> 105
<211> 1106
<212> ДНК
<213> Искусственная последовательность
<220>
<223> GSC11395
<400> 105
ctgtctccgg
gtaaatgatg
aaagcttggt
aggtgatcct
cctgctgctt
tggttcaggg
ttttgcttga
gggggggggg
tggtgatttc
cttgccatgg
gcagactgag
cagaaaaggc
120
cattgggacc
atgttctgaa
tgcctccacc
tcaaccaccg
gccggtagga
ccaaagccac
180
cccgtgtttt
ctcaggatct
cttttcccag
ggagatccct
cggcccaaag
agggagatgg
240
caatgctgga
tgtgtgcaca
ataattcaac
aggcattgga
acttcagcat
cgatgctgaa
300
tgcaattaac
aatgctcaag
cagaaccccc
ggctccatca
gcacagtgca
ggaccaaacc
360
ccatgctgca
gcagtggggc
tgtctgtacg
gggtgggcaa
tgggaaccgg
ggtctgctgg
420
ggctcctgct
gcttcagtgc
tgccatgcag
ccacacatcc
tgagagctga
aagggtcggc
480
gtcctcacct
ggtgcacacc
gtagctctgc
cccacagctt
taaggcacct
ggctaacctc
540
tgcgcttctt
cccttccctc
ctccctggct
caggtggtgg
tggatctccc
cccgaggacc
600
cccctgactc
caagaatgcc
atccccatct
ggtgggtgct
ggtgggcgtg
ctgggcggcc
660
tgctgctgct
gaccatcctg
gtgctggcca
tgtggaagtg
cttctgcaag
caccggtcct
720
gcttccggcg
gaacgaggcc
tccagagaga
caaacaactc
cctgaccttc
ggccccgagg
780
aagccctggc
tgagcagacc
gtgtttctgt
gatgattcga
aatgaccgac
caagcgacgc
840
ccaacctgcc
atcacgagat
ttcgattcca
ccgccgcctt
ctatgaaagg
ttgggcttcg
900
gaatcgtttt
ccgggacgcc
ggctggatga
tcctccagcg
cggggatctc
atgctggagt
960
tcttcgccca
ccccaacttg
tttattgcag
cttataatgg
ttacaaataa
agcaatagca
1020
tcacaaattt
cacaaataaa
gcattttttt
cactgcattc
tagttgtggt
ttgtccaaac
1080
<210> 106
<211> 1109
<212> ДНК
<213> Искусственная последовательность
<220>
<223> GSC11396
<400> 106
ctgtctccgg
gtaaatgatg
aaagcttggt
aggtgatcct
cctgctgctt
tggttcaggg
ttttgcttga
gggggggggg
tggtgatttc
cttgccatgg
gcagactgag
cagaaaaggc
120
cattgggacc
atgttctgaa
tgcctccacc
tcaaccaccg
gccggtagga
ccaaagccac
180
cccgtgtttt
ctcaggatct
cttttcccag
ggagatccct
cggcccaaag
agggagatgg
240
caatgctgga
tgtgtgcaca
ataattcaac
aggcattgga
acttcagcat
cgatgctgaa
300
tgcaattaac
aatgctcaag
cagaaccccc
ggctccatca
gcacagtgca
ggaccaaacc
360
ccatgctgca
gcagtggggc
tgtctgtacg
gggtgggcaa
tgggaaccgg
ggtctgctgg
420
ggctcctgct
gcttcagtgc
tgccatgcag
ccacacatcc
tgagagctga
aagggtcggc
480
gtcctcacct
ggtgcacacc
gtagctctgc
cccacagctt
taaggcacct
ggctaacctc
540
tgcgcttctt
cccttccctc
ctccctggct
caggtggtgg
tggatctccc
cccgaggacc
600
cccctgactc
caagaatttc
tgggtgctgg
tggtggtggg
cggcgtgctg
gcctgctact
660
ccctgctggt
gaccgtggcc
ttcatcatct
tctgggtgaa
gtgcttctgc
aagcaccggt
720
cctgcttccg
gcggaacgag
gcctccagag
agacaaacaa
ctccctgacc
ttcggccccg
780
aggaagccct
ggctgagcag
accgtgtttc
tgtgatgatt
cgaaatgacc
gaccaagcga
840
cgcccaacct
gccatcacga
gatttcgatt
ccaccgccgc
cttctatgaa
aggttgggct
900
tcggaatcgt
tttccgggac
gccggctgga
tgatcctcca
gcgcggggat
ctcatgctgg
960
agttcttcgc
ccaccccaac
ttgtttattg
cagcttataa
tggttacaaa
taaagcaata
1020
gcatcacaaa
tttcacaaat
aaagcatttt
tttcactgca
ttctagttgt
ggtttgtcca
1080
aactcatcaa
tgtatcttat
catgtctgt
1109
<210> 107
<211> 1109
<212> ДНК
<213> Искусственная последовательность
<220>
<223> GSC11389 <400> 107
ctgtctccgg gtaaatgatg aaagcttggt aggtgatcct cctgctgctt tggttcaggg 60 ttttgcttga gggggggggg tggtgatttc cttgccatgg gcagactgag cagaaaaggc 120
cattgggacc
atgttctgaa
tgcctccacc
tcaaccaccg
gccggtagga
ccaaagccac
180
cccgtgtttt
ctcaggatct
cttttcccag
ggagatccct
cggcccaaag
agggagatgg
240
caatgctgga
tgtgtgcaca
ataattcaac
aggcattgga
acttcagcat
cgatgctgaa
300
tgcaattaac
aatgctcaag
cagaaccccc
ggctccatca
gcacagtgca
ggaccaaacc
360
ccatgctgca
gcagtggggc
tgtctgtacg
gggtgggcaa
tgggaaccgg
ggtctgctgg
420
ggctcctgct
gcttcagtgc
tgccatgcag
ccacacatcc
tgagagctga
aagggtcggc
480
gtcctcacct
ggtgcacacc
gtagctctgc
cccacagctt
taaggcacct
ggctaacctc
540
tgcgcttctt
cccttccctc
ctccctggct
caggtggtgg
tggatctccc
cccgaggacc
600
cccctgactc
caagaatctg
tggacgacca
tcaccatctt
catcacactc
ttcctgttaa
660
gcgtgtgcta
cagtgccacc
gtcaccttct
tcaaggtgaa
gtgcttctgc
aagcaccggt
720
cctgcttccg
gcggaacgag
gcctccagag
agacaaacaa
ctccctgacc
ttcggccccg
780
aggaagccct
ggctgagcag
accgtgtttc
tgtgatgatt
cgaaatgacc
gaccaagcga
840
cgcccaacct
gccatcacga
gatttcgatt
ccaccgccgc
cttctatgaa
aggttgggct
900
tcggaatcgt
tttccgggac
gccggctgga
tgatcctcca
gcgcggggat
ctcatgctgg
960
agttcttcgc
ccaccccaac
ttgtttattg
cagcttataa
tggttacaaa
taaagcaata
1020
gcatcacaaa
tttcacaaat
aaagcatttt
tttcactgca
ttctagttgt
ggtttgtcca
1080
aactcatcaa
tgtatcttat
catgtctgt
1109
<210> 108
<211> 1082
<212> ДНК
<213> Искусственная последовательность
<220>
<223> GSC11677
<400> 108
ctgtctccgg
gtaaatgatg
aaagcttggt
aggtgatcct
cctgctgctt
tggttcaggg
ttttgcttga
gggggggggg
tggtgatttc
cttgccatgg
gcagactgag
cagaaaaggc
120
cattgggacc
atgttctgaa
tgcctccacc
tcaaccaccg
gccggtagga
ccaaagccac
180
cccgtgtttt
ctcaggatct
cttttcccag
ggagatccct
cggcccaaag
agggagatgg
240
caatgctgga
tgtgtgcaca
ataattcaac
aggcattgga
acttcagcat
cgatgctgaa
300
tgcaattaac
aatgctcaag
cagaaccccc
ggctccatca
gcacagtgca
ggaccaaacc
360
ccatgctgca
gcagtggggc
tgtctgtacg
gggtgggcaa
tgggaaccgg
ggtctgctgg
420
ggctcctgct
gcttcagtgc
tgccatgcag
ccacacatcc
tgagagctga
aagggtcggc
480
gtcctcacct
ggtgcacacc
gtagctctgc
cccacagctt
taaggcacct
ggctaacctc
540
tgcgcttctt
cccttccctc
ctccctggct
caggtggtgg
tggatctccc
cccgaggacc
600
tcgtgattat caagtgcttc tgcaagcacc ggtcctgctt ccggcggaac gaggcctcca 720
gagagacaaa caactccctg accttcggcc ccgaggaagc cctggctgag cagaccgtgt 780
ttctgtgatg attcgaaatg accgaccaag cgacgcccaa cctgccatca cgagatttcg 840
attccaccgc cgccttctat gaaaggttgg gcttcggaat cgttttccgg gacgccggct 900
ggatgatcct ccagcgcggg gatctcatgc tggagttctt cgcccacccc aacttgttta 960
ttgcagctta taatggttac aaataaagca atagcatcac aaatttcaca aataaagcat 1020
ttttttcact gcattctagt tgtggtttgt ccaaactcat caatgtatct tatcatgtct 1080
gt 1082
<210> 109
<211> 1088
<212> ДНК
<213> Искусственная последовательность
<220>
<223> GSC11679
<400> 109
ctgtctccgg
gtaaatgatg
aaagcttggt
aggtgatcct
cctgctgctt
tggttcaggg
ttttgcttga
gggggggggg
tggtgatttc
cttgccatgg
gcagactgag
cagaaaaggc
120
cattgggacc
atgttctgaa
tgcctccacc
tcaaccaccg
gccggtagga
ccaaagccac
180
cccgtgtttt
ctcaggatct
cttttcccag
ggagatccct
cggcccaaag
agggagatgg
240
caatgctgga
tgtgtgcaca
ataattcaac
aggcattgga
acttcagcat
cgatgctgaa
300
tgcaattaac
aatgctcaag
cagaaccccc
ggctccatca
gcacagtgca
ggaccaaacc
360
ccatgctgca
gcagtggggc
tgtctgtacg
gggtgggcaa
tgggaaccgg
ggtctgctgg
420
ggctcctgct
gcttcagtgc
tgccatgcag
ccacacatcc
tgagagctga
aagggtcggc
480
gtcctcacct
ggtgcacacc
gtagctctgc
cccacagctt
taaggcacct
ggctaacctc
540
tgcgcttctt
cccttccctc
ctccctggct
caggtggtgg
tggatctccc
cccgaggacc
600
cccctgactc
caagaatacc
ctggtgctgt
tcggcgctgg
cttcggcgcc
accgtggtcg
660
tgatcgtcgt
gattatcaag
tgcttctgca
agcaccggtc
ctgcttccgg
cggaacgagg
720
cctccagaga
gacaaacaac
tccctgacct
tcggccccga
ggaagccctg
gctgagcaga
780
ccgtgtttct
gtgatgattc
gaaatgaccg
accaagcgac
gcccaacctg
ccatcacgag
840
atttcgattc
caccgccgcc
ttctatgaaa
ggttgggctt
cggaatcgtt
ttccgggacg
900
ccggctggat
gatcctccag
cgcggggatc
tcatgctgga
gttcttcgcc
caccccaact
960
tgtttattgc
agcttataat
ggttacaaat
aaagcaatag
catcacaaat
ttcacaaata
1020
aagcattttt
ttcactgcat
tctagttgtg
gtttgtccaa
actcatcaat
gtatcttatc
1080
<210> 110
<211> 1100
<212> ДНК
<213> Искусственная последовательность
<220>
<223> GSC11484
<400> 110
ctgtctccgg
gtaaatgatg
aaagcttggt
aggtgatcct
cctgctgctt
tggttcaggg
ttttgcttga
gggggggggg
tggtgatttc
cttgccatgg
gcagactgag
cagaaaaggc
120
cattgggacc
atgttctgaa
tgcctccacc
tcaaccaccg
gccggtagga
ccaaagccac
180
cccgtgtttt
ctcaggatct
cttttcccag
ggagatccct
cggcccaaag
agggagatgg
240
caatgctgga
tgtgtgcaca
ataattcaac
aggcattgga
acttcagcat
cgatgctgaa
300
tgcaattaac
aatgctcaag
cagaaccccc
ggctccatca
gcacagtgca
ggaccaaacc
360
ccatgctgca
gcagtggggc
tgtctgtacg
gggtgggcaa
tgggaaccgg
ggtctgctgg
420
ggctcctgct
gcttcagtgc
tgccatgcag
ccacacatcc
tgagagctga
aagggtcggc
480
gtcctcacct
ggtgcacacc
gtagctctgc
cccacagctt
taaggcacct
ggctaacctc
540
tgcgcttctt
cccttccctc
ctccctggct
caggtggtgg
tggatctccc
cccgaggacc
600
cccctgactc
caagaatacc
ctggtgctgt
tcggcgctgg
cttcggcgcc
gtggtcattg
660
taaccgtggt
cgtgatcgtc
gtgattatca
agtgcttctg
caagcaccgg
tcctgcttcc
720
ggcggaacga
ggcctccaga
gagacaaaca
actccctgac
cttcggcccc
gaggaagccc
780
tggctgagca
gaccgtgttt
ctgtgatgat
tcgaaatgac
cgaccaagcg
acgcccaacc
840
tgccatcacg
agatttcgat
tccaccgccg
ccttctatga
aaggttgggc
ttcggaatcg
900
ttttccggga
cgccggctgg
atgatcctcc
agcgcgggga
tctcatgctg
gagttcttcg
960
cccaccccaa
cttgtttatt
gcagcttata
atggttacaa
ataaagcaat
agcatcacaa
1020
atttcacaaa
taaagcattt
ttttcactgc
attctagttg
tggtttgtcc
aaactcatca
1080
atgtatctta
tcatgtctgt
1100
<210> 111
<211> 1106
<212> ДНК
<213> Искусственная последовательность
<220>
<223> GSC11292 <400> 111
ctgtctccgg gtaaatgatg aaagcttggt aggtgatcct cctgctgctt tggttcaggg 60 ttttgcttga gggggggggg tggtgatttc cttgccatgg gcagactgag cagaaaaggc 120
cccgtgtttt ctcaggatct cttttcccag ggagatccct cggcccaaag agggagatgg 240
caatgctgga tgtgtgcaca ataattcaac aggcattgga acttcagcat cgatgctgaa 300
tgcaattaac aatgctcaag cagaaccccc ggctccatca gcacagtgca ggaccaaacc 360
ccatgctgca gcagtggggc tgtctgtacg gggtgggcaa tgggaaccgg ggtctgctgg 420
ggctcctgct gcttcagtgc tgccatgcag ccacacatcc tgagagctga aagggtcggc 480
gtcctcacct ggtgcacacc gtagctctgc cccacagctt taaggcacct ggctaacctc 540
tgcgcttctt cccttccctc ctccctggct caggtggtgg tggatctccc cccgaggacc 600
cccctgactc caagaatacc ctggtgctgt tcggcgctgg cttcggcgcc gtggtcattg 660
tagtcgtaac cgtggtcgtg atcgtcgtga ttatcaagtg cttctgcaag caccggtcct 720
gcttccggcg gaacgaggcc tccagagaga caaacaactc cctgaccttc ggccccgagg 780
aagccctggc tgagcagacc gtgtttctgt gatgattcga aatgaccgac caagcgacgc 840
ccaacctgcc atcacgagat ttcgattcca ccgccgcctt ctatgaaagg ttgggcttcg 900
gaatcgtttt ccgggacgcc ggctggatga tcctccagcg cggggatctc atgctggagt 960
tcttcgccca ccccaacttg tttattgcag cttataatgg ttacaaataa agcaatagca 1020
tcacaaattt cacaaataaa gcattttttt cactgcattc tagttgtggt ttgtccaaac 1080
tcatcaatgt atcttatcat gtctgt 1106
<210> 112
<211> 1007
<212> ДНК
<213> Искусственная последовательность
<220>
<223> GSC11207
<400> 112
ctgtctccgg
gtaaatgatg
aaagcttggt
aggtgatcct
cctgctgctt
tggttcaggg
ttttgcttga
gggggggggg
tggtgatttc
cttgccatgg
gcagactgag
cagaaaaggc
120
cattgggacc
atgttctgaa
tgcctccacc
tcaaccaccg
gccggtagga
ccaaagccac
180
cccgtgtttt
ctcaggatct
cttttcccag
ggagatccct
cggcccaaag
agggagatgg
240
caatgctgga
tgtgtgcaca
ataattcaac
aggcattgga
acttcagcat
cgatgctgaa
300
tgcaattaac
aatgctcaag
cagaaccccc
ggctccatca
gcacagtgca
ggaccaaacc
360
ccatgctgca
gcagtggggc
tgtctgtacg
gggtgggcaa
tgggaaccgg
ggtctgctgg
420
ggctcctgct
gcttcagtgc
tgccatgcag
ccacacatcc
tgagagctga
aagggtcggc
480
gtcctcacct
ggtgcacacc
gtagctctgc
cccacagctt
taaggcacct
ggctaacctc
540
tgcgcttctt
cccttccctc
ctccctggct
caggtggtgg
tggatctccc
cccgaggacc
600
tggtcgtgat cgtcgtgatt atcgccagcg cccatcacca ccaccatcat tgatgattcg 720
aaatgaccga ccaagcgacg cccaacctgc catcacgaga tttcgattcc accgccgcct 780
tctatgaaag gttgggcttc ggaatcgttt tccgggacgc cggctggatg atcctccagc 840
gcggggatct catgctggag ttcttcgccc accccaactt gtttattgca gcttataatg 900
gttacaaata aagcaatagc atcacaaatt tcacaaataa agcatttttt tcactgcatt 960
ctagttgtgg tttgtccaaa ctcatcaatg tatcttatca tgtctgt 1007
<210> 113
<211> 995
<212> ДНК
<213> Искусственная последовательность
<220>
<223> GSC11209
<400> 113
ctgtctccgg
gtaaatgatg
aaagcttggt
aggtgatcct
cctgctgctt
tggttcaggg
ttttgcttga
gggggggggg
tggtgatttc
cttgccatgg
gcagactgag
cagaaaaggc
120
cattgggacc
atgttctgaa
tgcctccacc
tcaaccaccg
gccggtagga
ccaaagccac
180
cccgtgtttt
ctcaggatct
cttttcccag
ggagatccct
cggcccaaag
agggagatgg
240
caatgctgga
tgtgtgcaca
ataattcaac
aggcattgga
acttcagcat
cgatgctgaa
300
tgcaattaac
aatgctcaag
cagaaccccc
ggctccatca
gcacagtgca
ggaccaaacc
360
ccatgctgca
gcagtggggc
tgtctgtacg
gggtgggcaa
tgggaaccgg
ggtctgctgg
420
ggctcctgct
gcttcagtgc
tgccatgcag
ccacacatcc
tgagagctga
aagggtcggc
480
gtcctcacct
ggtgcacacc
gtagctctgc
cccacagctt
taaggcacct
ggctaacctc
540
tgcgcttctt
cccttccctc
ctccctggct
caggtggtgg
tggatctccc
cccgaggacc
600
cccctgactc
caagaatacc
ctggtgctgt
tcggcgctgg
cttcggcgcc
gtgattaccg
660
tggtcgtgat
cgtcgtgatt
atcaagtgct
tctgcaagtg
atgattcgaa
atgaccgacc
720
aagcgacgcc
caacctgcca
tcacgagatt
tcgattccac
cgccgccttc
tatgaaaggt
780
tgggcttcgg
aatcgttttc
cgggacgccg
gctggatgat
cctccagcgc
ggggatctca
840
tgctggagtt
cttcgcccac
cccaacttgt
ttattgcagc
ttataatggt
tacaaataaa
900
gcaatagcat
cacaaatttc
acaaataaag
catttttttc
actgcattct
agttgtggtt
960
tgtccaaact
catcaatgta
tcttatcatg
tctgt
995
<210> 114
<211> 1058
<212> ДНК
<213> Искусственная последовательность
<210> 115
<211> 1016
<212> Белок
<213> Искусственная последовательность
<220>
<223> GSC11764
<400> 115
Cys Thr Gly Thr Cys Thr Cys Cys Gly Gly Gly Thr Ala Ala Ala Thr
1 5 10 15
Gly Ala Thr Gly Ala Ala Ala Gly Cys Thr Thr Gly Gly Thr Ala Gly
20 25 30
Gly Thr Gly Ala Thr Cys Cys Thr Cys Cys Thr Gly Cys Thr Gly Cys
35 40 45
Thr Thr Thr Gly Gly Thr Thr Cys Ala Gly Gly Gly Thr Thr Thr Thr
50 55 60
Gly Cys Thr Thr Gly Ala Gly Gly Gly Gly Gly Gly Gly Gly Gly Gly
65 70 75 80
Thr Gly Gly Thr Gly Ala Thr Thr Thr Cys Cys Thr Thr Gly Cys Cys
85 90 95
Ala Thr Gly Gly Gly Cys Ala Gly Ala Cys Thr Gly Ala Gly Cys Ala
100 105 110
Gly Ala Ala Ala Ala Gly Gly Cys Cys Ala Thr Thr Gly Gly Gly Ala
115 120 125
Cys Cys Ala Thr Gly Thr Thr Cys Thr Gly Ala Ala Thr Gly Cys Cys
130 135 140
Thr Cys Cys Ala Cys Cys Thr Cys Ala Ala Cys Cys Ala Cys Cys Gly
145 150 155 160
Gly Cys Cys Gly Gly Thr Ala Gly Gly Ala Cys Cys Ala Ala Ala Gly
165 170 175
Cys Cys Ala Cys Cys Cys Cys Gly Thr Gly Thr Thr Thr Thr Cys Thr
180 185 190
Cys Ala Gly Gly Ala Thr Cys Thr Cys Thr Thr Thr Thr Cys Cys Cys
195 200 205
Ala Gly Gly Gly Ala Gly Ala Thr Cys Cys Cys Thr Cys Gly Gly Cys
210 215 220
Cys Cys Ala Ala Ala Gly Ala Gly Gly Gly Ala Gly Ala Thr Gly Gly
225 230 235 240
Cys Ala Ala Thr Gly Cys Thr Gly Gly Ala Thr Gly Thr Gly Thr Gly
245 250 255
Cys Ala Cys Ala Ala Thr Ala Ala Thr Thr Cys Ala Ala Cys Ala Gly
260 265 270
Gly Cys Ala Thr Thr Gly Gly Ala Ala Cys Thr Thr Cys Ala Gly Cys
275 280 285
Ala Thr Cys Gly Ala Thr Gly Cys Thr Gly Ala Ala Thr Gly Cys Ala
290 295 300
Ala Thr Thr Ala Ala Cys Ala Ala Thr Gly Cys Thr Cys Ala Ala Gly
305 310 315 320
Cys Ala Gly Ala Ala Cys Cys Cys Cys Cys Gly Gly Cys Thr Cys Cys
325 330 335
Ala Thr Cys Ala Gly Cys Ala Cys Ala Gly Thr Gly Cys Ala Gly Gly
340 345 350
Ala Cys Cys Ala Ala Ala Cys Cys Cys Cys Ala Thr Gly Cys Thr Gly
355 360 365
Cys Ala Gly Cys Ala Gly Thr Gly Gly Gly Gly Cys Thr Gly Thr Cys
370 375 380
Thr Gly Thr Ala Cys Gly Gly Gly Gly Thr Gly Gly Gly Cys Ala Ala
385 390 395 400
Thr Gly Gly Gly Ala Ala Cys Cys Gly Gly Gly Gly Thr Cys Thr Gly
405 410 415
Cys Thr Gly Gly Gly Gly Cys Thr Cys Cys Thr Gly Cys Thr Gly Cys
420 425 430
Thr Thr Cys Ala Gly Thr Gly Cys Thr Gly Cys Cys Ala Thr Gly Cys
435 440 445
Ala Gly Cys Cys Ala Cys Ala Cys Ala Thr Cys Cys Thr Gly Ala Gly
450 455 460
Ala Gly Cys Thr Gly Ala Ala Ala Gly Gly Gly Thr Cys Gly Gly Cys
465 470 475 480
Gly Thr Cys Cys Thr Cys Ala Cys Cys Thr Gly Gly Thr Gly Cys Ala
485 490 495
Cys Ala Cys Cys Gly Thr Ala Gly Cys Thr Cys Thr Gly Cys Cys Cys
500 505 510
Cys Ala Cys Ala Gly Cys Thr Thr Thr Ala Ala Gly Gly Cys Ala Cys
515 520 525
Cys Thr Gly Gly Cys Thr Ala Ala Cys Cys Thr Cys Thr Gly Cys Gly
530 535 540
Cys Thr Thr Cys Thr Thr Cys Cys Cys Thr Thr Cys Cys Cys Thr Cys
545 550 555 560
Cys Thr Cys Cys Cys Thr Gly Gly Cys Thr Cys Ala Gly Gly Thr Gly
565 570 575
Gly Thr Gly Gly Thr Gly Gly Ala Thr Cys Thr Cys Cys Cys Cys Cys
580 585 590
Cys Gly Ala Gly Gly Ala Cys Cys Cys Cys Cys Cys Thr Gly Ala Cys
595 600 605
Thr Cys Cys Ala Ala Gly Ala Ala Thr Ala Cys Cys Cys Thr Gly Gly
610 615 620
Thr Gly Cys Thr Gly Thr Thr Cys Gly Gly Cys Gly Cys Thr Gly Gly
625 630 635 640
Cys Thr Thr Cys Gly Gly Cys Gly Cys Cys Gly Thr Gly Ala Thr Thr
645 650 655
Ala Cys Cys Gly Thr Gly Gly Thr Cys Gly Thr Gly Ala Thr Cys Gly
660 665 670
Thr Cys Gly Thr Gly Ala Thr Thr Ala Thr Cys Ala Gly Gly Thr Cys
675 680 685
Cys Cys Ala Gly Cys Ala Gly Gly Ala Gly Gly Cys Cys Gly Cys Cys
690 695 700
Gly Cys Cys Ala Ala Gly Ala Ala Gly Thr Thr Cys Thr Thr Cys Thr
705 710 715 720
Gly Ala Thr Gly Ala Thr Thr Cys Gly Ala Ala Ala Thr Gly Ala Cys
725 730 735
Cys Gly Ala Cys Cys Ala Ala Gly Cys Gly Ala Cys Gly Cys Cys Cys
740 745 750
Ala Ala Cys Cys Thr Gly Cys Cys Ala Thr Cys Ala Cys Gly Ala Gly
755 760 765
Ala Thr Thr Thr Cys Gly Ala Thr Thr Cys Cys Ala Cys Cys Gly Cys
770 775 780
Cys Gly Cys Cys Thr Thr Cys Thr Ala Thr Gly Ala Ala Ala Gly Gly
785 790 795 800
Thr Thr Gly Gly Gly Cys Thr Thr Cys Gly Gly Ala Ala Thr Cys Gly
805 810 815
Thr Thr Thr Thr Cys Cys Gly Gly Gly Ala Cys Gly Cys Cys Gly Gly
820 825 830
Cys Thr Gly Gly Ala Thr Gly Ala Thr Cys Cys Thr Cys Cys Ala Gly
835 840 845
Cys Gly Cys Gly Gly Gly Gly Ala Thr Cys Thr Cys Ala Thr Gly Cys
850 855 860
Thr Gly Gly Ala Gly Thr Thr Cys Thr Thr Cys Gly Cys Cys Cys Ala
865 870 875 880
Cys Cys Cys Cys Ala Ala Cys Thr Thr Gly Thr Thr Thr Ala Thr Thr
885 890 895
Gly Cys Ala Gly Cys Thr Thr Ala Thr Ala Ala Thr Gly Gly Thr Thr
900 905 910
Ala Cys Ala Ala Ala Thr Ala Ala Ala Gly Cys Ala Ala Thr Ala Gly
915 920 925
Cys Ala Thr Cys Ala Cys Ala Ala Ala Thr Thr Thr Cys Ala Cys Ala
930 935 940
Ala Ala Thr Ala Ala Ala Gly Cys Ala Thr Thr Thr Thr Thr Thr Thr
945 950 955 960
Cys Ala Cys Thr Gly Cys Ala Thr Thr Cys Thr Ala Gly Thr Thr Gly
965 970 975
Thr Gly Gly Thr Thr Thr Gly Thr Cys Cys Ala Ala Ala Cys Thr Cys
980 985 990
Ala Thr Cys Ala Ala Thr Gly Thr Ala Thr Cys Thr Thr Ala Thr Cys
995 1000 1005
Ala Thr Gly Thr Cys Thr Gly Thr 1010 1015
<213> Искусственная последовательность
<220>
<223> GSC11678 <400> 116
ctgtctccgg gtaaatgatg aaagcttggt aggtgatcct cctgctgctt tggttcaggg 60
cccgtgtttt ctcaggatct cttttcccag ggagatccct cggcccaaag agggagatgg 240
caatgctgga tgtgtgcaca ataattcaac aggcattgga acttcagcat cgatgctgaa 300
tgcaattaac aatgctcaag cagaaccccc ggctccatca gcacagtgca ggaccaaacc 360
ccatgctgca gcagtggggc tgtctgtacg gggtgggcaa tgggaaccgg ggtctgctgg 420
ggctcctgct gcttcagtgc tgccatgcag ccacacatcc tgagagctga aagggtcggc 480
gtcctcacct ggtgcacacc gtagctctgc cccacagctt taaggcacct ggctaacctc 540
tgcgcttctt cccttccctc ctccctggct caggtggtgg tggatctccc cccgaggacc 600
cccctgactc caagaatacc ctggtgctgt tcggcgctgg cttcggcgcc gtgattaccg 660
tggtcgtgat cgtcgtgatt atcaggtccc agcaggaggc cgccgccaag aagtggtggt 720
gatgattcga aatgaccgac caagcgacgc ccaacctgcc atcacgagat ttcgattcca 780
ccgccgcctt ctatgaaagg ttgggcttcg gaatcgtttt ccgggacgcc ggctggatga 840
tcctccagcg cggggatctc atgctggagt tcttcgccca ccccaacttg tttattgcag 900
cttataatgg ttacaaataa agcaatagca tcacaaattt cacaaataaa gcattttttt 960
cactgcattc tagttgtggt ttgtccaaac tcatcaatgt atcttatcat gtctgt 1016
<210> 117 <211> 1115 <212> ДНК
<213> Искусственная последовательность
<220>
<223> GSC11759 <400> 117
ctgtctccgg gtaaatgatg aaagcttggt aggtgatcct cctgctgctt tggttcaggg 60
ttttgcttga gggggggggg tggtgatttc cttgccatgg gcagactgag cagaaaaggc 120
cattgggacc atgttctgaa tgcctccacc tcaaccaccg gccggtagga ccaaagccac 180
cccgtgtttt ctcaggatct cttttcccag ggagatccct cggcccaaag agggagatgg 240
caatgctgga tgtgtgcaca ataattcaac aggcattgga acttcagcat cgatgctgaa 300
tgcaattaac aatgctcaag cagaaccccc ggctccatca gcacagtgca ggaccaaacc 360
ccatgctgca gcagtggggc tgtctgtacg gggtgggcaa tgggaaccgg ggtctgctgg 420
ggctcctgct gcttcagtgc tgccatgcag ccacacatcc tgagagctga aagggtcggc 480
gtcctcacct ggtgcacacc gtagctctgc cccacagctt taaggcacct ggctaacctc 540
tgcgcttctt cccttccctc ctccctggct caggtggtgg tggatctccc cccgaggacc 600
cccctgactc caagaatacc ctggtgctgt tcggcgctgg cttcggcgcc gtgattaccg 660
cccaggccgg ctcctccgcc tccaaggagg cctacatctg atgattcgaa atgaccgacc 840
aagcgacgcc caacctgcca tcacgagatt tcgattccac cgccgccttc tatgaaaggt 900
tgggcttcgg aatcgttttc cgggacgccg gctggatgat cctccagcgc ggggatctca 960
tgctggagtt cttcgcccac cccaacttgt ttattgcagc ttataatggt tacaaataaa 1020
gcaatagcat cacaaatttc acaaataaag catttttttc actgcattct agttgtggtt 1080
tgtccaaact catcaatgta tcttatcatg tctgt 1115
<210> 118
<211> 1004
<212> ДНК
<213> Искусственная последовательность
<220>
<223> GSC11483
<400> 118
ctgtctccgg
gtaaatgatg
aaagcttggt
aggtgatcct
cctgctgctt
tggttcaggg
ttttgcttga
gggggggggg
tggtgatttc
cttgccatgg
gcagactgag
cagaaaaggc
120
cattgggacc
atgttctgaa
tgcctccacc
tcaaccaccg
gccggtagga
ccaaagccac
180
cccgtgtttt
ctcaggatct
cttttcccag
ggagatccct
cggcccaaag
agggagatgg
240
caatgctgga
tgtgtgcaca
ataattcaac
aggcattgga
acttcagcat
cgatgctgaa
300
tgcaattaac
aatgctcaag
cagaaccccc
ggctccatca
gcacagtgca
ggaccaaacc
360
ccatgctgca
gcagtggggc
tgtctgtacg
gggtgggcaa
tgggaaccgg
ggtctgctgg
420
ggctcctgct
gcttcagtgc
tgccatgcag
ccacacatcc
tgagagctga
aagggtcggc
480
gtcctcacct
ggtgcacacc
gtagctctgc
cccacagctt
taaggcacct
ggctaacctc
540
tgcgcttctt
cccttccctc
ctccctggct
caggtggtgg
tggatctccc
cccgaggacc
600
cccctgactc
caagaatacc
ctggtgctgt
tcggcgctgg
cttcggcgcc
gtgattaccg
660
tggtcgtgat
cgtcgtgatt
atcatgttcc
tgaccctgaa
gggctcctga
tgattcgaaa
720
tgaccgacca
agcgacgccc
aacctgccat
cacgagattt
cgattccacc
gccgccttct
780
atgaaaggtt
gggcttcgga
atcgttttcc
gggacgccgg
ctggatgatc
ctccagcgcg
840
gggatctcat
gctggagttc
ttcgcccacc
ccaacttgtt
tattgcagct
tataatggtt
900
acaaataaag
caatagcatc
acaaatttca
caaataaagc
atttttttca
ctgcattcta
960
gttgtggttt
gtccaaactc
atcaatgtat
cttatcatgt
ctgt
1004
<210> 119
<211> 1115
<212> ДНК
<213> Искусственная последовательность
<220>
<223> GSC11760
<400> 119
ctgtctccgg
gtaaatgatg
aaagcttggt
aggtgatcct
cctgctgctt
tggttcaggg
ttttgcttga
gggggggggg
tggtgatttc
cttgccatgg
gcagactgag
cagaaaaggc
120
cattgggacc
atgttctgaa
tgcctccacc
tcaaccaccg
gccggtagga
ccaaagccac
180
cccgtgtttt
ctcaggatct
cttttcccag
ggagatccct
cggcccaaag
agggagatgg
240
caatgctgga
tgtgtgcaca
ataattcaac
aggcattgga
acttcagcat
cgatgctgaa
300
tgcaattaac
aatgctcaag
cagaaccccc
ggctccatca
gcacagtgca
ggaccaaacc
360
ccatgctgca
gcagtggggc
tgtctgtacg
gggtgggcaa
tgggaaccgg
ggtctgctgg
420
ggctcctgct
gcttcagtgc
tgccatgcag
ccacacatcc
tgagagctga
aagggtcggc
480
gtcctcacct
ggtgcacacc
gtagctctgc
cccacagctt
taaggcacct
ggctaacctc
540
tgcgcttctt
cccttccctc
ctccctggct
caggtggtgg
tggatctccc
cccgaggacc
600
cccctgactc
caagaatacc
ctggtgctgt
tcggcgctgg
cttcggcgcc
gtgattaccg
660
tggtcgtgat
cgtcgtgatt
atctgcttcg
tgggcaacag
gttccagcag
aagctgaggt
720
ccgtgttcag
ggtgcccatc
acctggctgc
agggcaagag
ggagaccatg
tcctgcagga
780
agtcctcctc
cctgagggag
atggacacct
tcgtgtcctg
atgattcgaa
atgaccgacc
840
aagcgacgcc
caacctgcca
tcacgagatt
tcgattccac
cgccgccttc
tatgaaaggt
900
tgggcttcgg
aatcgttttc
cgggacgccg
gctggatgat
cctccagcgc
ggggatctca
960
tgctggagtt
cttcgcccac
cccaacttgt
ttattgcagc
ttataatggt
tacaaataaa
1020
gcaatagcat
cacaaatttc
acaaataaag
catttttttc
actgcattct
agttgtggtt
1080
tgtccaaact
catcaatgta
tcttatcatg
tctgt
1115
<210> 120
<211> 1094
<212> ДНК
<213> Искусственная последовательность
<220>
<223> GSC11761 <400> 120
ctgtctccgg gtaaatgatg aaagcttggt aggtgatcct cctgctgctt tggttcaggg 60
ttttgcttga gggggggggg tggtgatttc cttgccatgg gcagactgag cagaaaaggc 120
cattgggacc atgttctgaa tgcctccacc tcaaccaccg gccggtagga ccaaagccac 180
cccgtgtttt ctcaggatct cttttcccag ggagatccct cggcccaaag agggagatgg 240
caatgctgga tgtgtgcaca ataattcaac aggcattgga acttcagcat cgatgctgaa 300
ccatgctgca
gcagtggggc
tgtctgtacg
gggtgggcaa
tgggaaccgg
ggtctgctgg
420
ggctcctgct
gcttcagtgc
tgccatgcag
ccacacatcc
tgagagctga
aagggtcggc
480
gtcctcacct
ggtgcacacc
gtagctctgc
cccacagctt
taaggcacct
ggctaacctc
540
tgcgcttctt
cccttccctc
ctccctggct
caggtggtgg
tggatctccc
cccgaggacc
600
cccctgactc
caagaatacc
ctggtgctgt
tcggcgctgg
cttcggcgcc
gtgattaccg
660
tggtcgtgat
cgtcgtgatt
atctgcttcg
tgggcaacag
gttccagcag
aagctgaggt
720
ccgtgttcag
ggtgcccatc
acctggctgc
agggcaagag
ggagaccatg
tcctgcagga
780
agtcctcctc
cctgaggtga
tgattcgaaa
tgaccgacca
agcgacgccc
aacctgccat
840
cacgagattt
cgattccacc
gccgccttct
atgaaaggtt
gggcttcgga
atcgttttcc
900
gggacgccgg
ctggatgatc
ctccagcgcg
gggatctcat
gctggagttc
ttcgcccacc
960
ccaacttgtt
tattgcagct
tataatggtt
acaaataaag
caatagcatc
acaaatttca
1020
caaataaagc
atttttttca
ctgcattcta
gttgtggttt
gtccaaactc
atcaatgtat
1080
cttatcatgt
ctgt
1094
<210> 121
<211> 1229
<212> ДНК
<213> Искусственная последовательность
<220>
<223> GSC11762
<400> 121
ctgtctccgg
gtaaatgatg
aaagcttggt
aggtgatcct
cctgctgctt
tggttcaggg
ttttgcttga
gggggggggg
tggtgatttc
cttgccatgg
gcagactgag
cagaaaaggc
120
cattgggacc
atgttctgaa
tgcctccacc
tcaaccaccg
gccggtagga
ccaaagccac
180
cccgtgtttt
ctcaggatct
cttttcccag
ggagatccct
cggcccaaag
agggagatgg
240
caatgctgga
tgtgtgcaca
ataattcaac
aggcattgga
acttcagcat
cgatgctgaa
300
tgcaattaac
aatgctcaag
cagaaccccc
ggctccatca
gcacagtgca
ggaccaaacc
360
ccatgctgca
gcagtggggc
tgtctgtacg
gggtgggcaa
tgggaaccgg
ggtctgctgg
420
ggctcctgct
gcttcagtgc
tgccatgcag
ccacacatcc
tgagagctga
aagggtcggc
480
gtcctcacct
ggtgcacacc
gtagctctgc
cccacagctt
taaggcacct
ggctaacctc
540
tgcgcttctt
cccttccctc
ctccctggct
caggtggtgg
tggatctccc
cccgaggacc
600
cccctgactc
caagaatacc
ctggtgctgt
tcggcgctgg
cttcggcgcc
gtgattaccg
660
tggtcgtgat
cgtcgtgatt
atcaactccc
acctgctgcc
caggcccctg
aggcacctgg
720
cctgctgcgg
cggcccccag
cccaggatga
ggaggaggct
gtccgacggc
tccctgtcct
780
ccaggcacac
caccctgctg
accaggtcct
cctgccccgc
caccctgtcc
ctgtccctgt
840
acggcgaggg caccgccgag accatcatct tctgatgatt cgaaatgacc gaccaagcga 960
cgcccaacct gccatcacga gatttcgatt ccaccgccgc cttctatgaa aggttgggct 1020
tcggaatcgt tttccgggac gccggctgga tgatcctcca gcgcggggat ctcatgctgg 1080
agttcttcgc ccaccccaac ttgtttattg cagcttataa tggttacaaa taaagcaata 1140
gcatcacaaa tttcacaaat aaagcatttt tttcactgca ttctagttgt ggtttgtcca 1200
aactcatcaa tgtatcttat catgtctgt 1229
<210> 122
<211> 1052
<212> ДНК
<213> Искусственная последовательность
<220>
<223> GSC11765
<400> 122
ctgtctccgg
gtaaatgatg
aaagcttggt
aggtgatcct
cctgctgctt
tggttcaggg
ttttgcttga
gggggggggg
tggtgatttc
cttgccatgg
gcagactgag
cagaaaaggc
120
cattgggacc
atgttctgaa
tgcctccacc
tcaaccaccg
gccggtagga
ccaaagccac
180
cccgtgtttt
ctcaggatct
cttttcccag
ggagatccct
cggcccaaag
agggagatgg
240
caatgctgga
tgtgtgcaca
ataattcaac
aggcattgga
acttcagcat
cgatgctgaa
300
tgcaattaac
aatgctcaag
cagaaccccc
ggctccatca
gcacagtgca
ggaccaaacc
360
ccatgctgca
gcagtggggc
tgtctgtacg
gggtgggcaa
tgggaaccgg
ggtctgctgg
420
ggctcctgct
gcttcagtgc
tgccatgcag
ccacacatcc
tgagagctga
aagggtcggc
480
gtcctcacct
ggtgcacacc
gtagctctgc
cccacagctt
taaggcacct
ggctaacctc
540
tgcgcttctt
cccttccctc
ctccctggct
caggtggtgg
tggatctccc
cccgaggacc
600
cccctgactc
caagaatacc
ctggtgctgt
tcggcgctgg
cttcggcgcc
gtgattaccg
660
tggtcgtgat
cgtcgtgatt
atcaactccc
acgaggagtc
ccccagggac
ctggagctgg
720
ccgacggcga
gggcaccgcc
gagaccatca
tcttctgatg
attcgaaatg
accgaccaag
780
cgacgcccaa
cctgccatca
cgagatttcg
attccaccgc
cgccttctat
gaaaggttgg
840
gcttcggaat
cgttttccgg
gacgccggct
ggatgatcct
ccagcgcggg
gatctcatgc
900
tggagttctt
cgcccacccc
aacttgttta
ttgcagctta
taatggttac
aaataaagca
960
atagcatcac
aaatttcaca
aataaagcat
ttttttcact
gcattctagt
tgtggtttgt
1020
ccaaactcat
caatgtatct
tatcatgtct
1052
<212> ДНК
<213> Искусственная последовательность
<220>
<223> GSC11766
<400> 123 ctgtctccgg
gtaaatgatg
aaagcttggt
aggtgatcct
cctgctgctt
tggttcaggg
ttttgcttga
gggggggggg
tggtgatttc
cttgccatgg
gcagactgag
cagaaaaggc
120
cattgggacc
atgttctgaa
tgcctccacc
tcaaccaccg
gccggtagga
ccaaagccac
180
cccgtgtttt
ctcaggatct
cttttcccag
ggagatccct
cggcccaaag
agggagatgg
240
caatgctgga
tgtgtgcaca
ataattcaac
aggcattgga
acttcagcat
cgatgctgaa
300
tgcaattaac
aatgctcaag
cagaaccccc
ggctccatca
gcacagtgca
ggaccaaacc
360
ccatgctgca
gcagtggggc
tgtctgtacg
gggtgggcaa
tgggaaccgg
ggtctgctgg
420
ggctcctgct
gcttcagtgc
tgccatgcag
ccacacatcc
tgagagctga
aagggtcggc
480
gtcctcacct
ggtgcacacc
gtagctctgc
cccacagctt
taaggcacct
ggctaacctc
540
tgcgcttctt
cccttccctc
ctccctggct
caggtggtgg
tggatctccc
cccgaggacc
600
cccctgactc
caagaatacc
ctggtgctgt
tcggcgctgg
cttcggcgcc
gtgattaccg
660
tggtcgtgat
cgtcgtgatt
atctgcatca
agctgaagca
caccaagaag
aggcagatct
720
acaccgacat
cgagatgaac
aggctgggca
agtgatgatt
cgaaatgacc
gaccaagcga
780
cgcccaacct
gccatcacga
gatttcgatt
ccaccgccgc
cttctatgaa
aggttgggct
840
tcggaatcgt
tttccgggac
gccggctgga
tgatcctcca
gcgcggggat
ctcatgctgg
900
agttcttcgc
ccaccccaac
ttgtttattg
cagcttataa
tggttacaaa
taaagcaata
960
gcatcacaaa
tttcacaaat
aaagcatttt
tttcactgca
ttctagttgt
ggtttgtcca
1020
aactcatcaa
tgtatcttat
catgtctgt
1049
<210> 124
<211> 1049
<212> ДНК
<213> Искусственная последовательность
<220>
<223> GSC11763 <400> 124
ctgtctccgg gtaaatgatg aaagcttggt aggtgatcct cctgctgctt tggttcaggg 60
ttttgcttga gggggggggg tggtgatttc cttgccatgg gcagactgag cagaaaaggc 120
cattgggacc atgttctgaa tgcctccacc tcaaccaccg gccggtagga ccaaagccac 180
cccgtgtttt ctcaggatct cttttcccag ggagatccct cggcccaaag agggagatgg 240
caatgctgga tgtgtgcaca ataattcaac aggcattgga acttcagcat cgatgctgaa 300
ggctcctgct gcttcagtgc tgccatgcag ccacacatcc tgagagctga aagggtcggc 480
gtcctcacct ggtgcacacc gtagctctgc cccacagctt taaggcacct ggctaacctc 540
tgcgcttctt cccttccctc ctccctggct caggtggtgg tggatctccc cccgaggacc 600
cccctgactc caagaatacc ctggtgctgt tcggcgctgg cttcggcgcc gtgattaccg 660
tggtcgtgat cgtcgtgatt atctgcatca agctgaagca caccaagaag aggcagatcg 720
ccgccgccgc cgccgccaac aggctgggca agtgatgatt cgaaatgacc gaccaagcga 780
cgcccaacct gccatcacga gatttcgatt ccaccgccgc cttctatgaa aggttgggct 840
tcggaatcgt tttccgggac gccggctgga tgatcctcca gcgcggggat ctcatgctgg 900
agttcttcgc ccaccccaac ttgtttattg cagcttataa tggttacaaa taaagcaata 960
gcatcacaaa tttcacaaat aaagcatttt tttcactgca ttctagttgt ggtttgtcca 1020
aactcatcaa tgtatcttat catgtctgt 1049
<210> 125 <211> 1118
<212> ДНК
<213> Искусственная последовательность
<220>
<223> GSC11294 <400> 125
ctgtctccgg gtaaatgatg aaagcttggt aggtgatcct cctgctgctt tggttcaggg 60
ttttgcttga gggggggggg tggtgatttc cttgccatgg gcagactgag cagaaaaggc 120
cattgggacc atgttctgaa tgcctccacc tcaaccaccg gccggtagga ccaaagccac 180
cccgtgtttt ctcaggatct cttttcccag ggagatccct cggcccaaag agggagatgg 240
caatgctgga tgtgtgcaca ataattcaac aggcattgga acttcagcat cgatgctgaa 300
tgcaattaac aatgctcaag cagaaccccc ggctccatca gcacagtgca ggaccaaacc 360
ccatgctgca gcagtggggc tgtctgtacg gggtgggcaa tgggaaccgg ggtctgctgg 420
ggctcctgct gcttcagtgc tgccatgcag ccacacatcc tgagagctga aagggtcggc 480
gtcctcacct ggtgcacacc gtagctctgc cccacagctt taaggcacct ggctaacctc 540
tgcgcttctt cccttccctc ctccctggct cagagctgca accggtggag agctgtgcgg 600
aggcgcagga cggggagctg gacgggctgt ggacgaccat caccatcttc atcacactct 660
tcctgttaag cgtgtgctac agtgccaccg tcaccttctt caaggtgaag tgcttctgca 720
agcaccggtc ctgcttccgg cggaacgagg cctccagaga gacaaacaac tccctgacct 780
tcggccccga ggaagccctg gctgagcaga ccgtgtttct gtagtgattc gaaatgaccg 840
ggttgggctt
cggaatcgtt
ttccgggacg
ccggctggat
gatcctccag
cgcggggatc
960
tcatgctgga
gttcttcgcc
caccccaact
tgtttattgc
agcttataat
ggttacaaat
1020
aaagcaatag
catcacaaat
ttcacaaata
aagcattttt
ttcactgcat
tctagttgtg
1080
gtttgtccaa
actcatcaat
gtatcttatc
atgtctgt
1118
<210> 126
<211> 466
<212> Белок
<213> Искусственная последовательность
<220>
<223> GSB59abc
<400> 126
Met Glu Ser Pro Ala Gln Leu Leu Phe Leu Leu Leu Leu Trp Leu Pro
1 5 10 15
Asp Gly Val His Ala Gln Val Thr Leu Lys Glu Ser Gly Pro Ala Leu
20 25 30
Val Lys Pro Thr Gln Thr Leu Thr Leu Thr Cys Ser Phe Ser Gly Phe
35 40 45
Ser Leu Ser Thr Ser Gly Met Gly Val Gly Trp Ile Arg Gln Pro Pro
50 55 60
Gly Lys Ala Leu Glu Trp Ile Ala His Ile Trp Trp Asp Asp Asp Lys
65 70 75 80
Tyr Tyr Asn Thr Ala Leu Lys Thr Arg Leu Thr Ile Ser Lys Asp Thr
85 90 95
Ser Lys Asn Gln Val Val Leu Thr Met Thr Asn Met Asp Pro Val Asp
100 105 110
Thr Ala Thr Tyr Tyr Cys Ala Arg Ile Asp Trp Asp Gly Phe Ala Tyr
115 120 125
Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly
130 135 140
Pro Ser Val Phe Pro Leu Ala Pro Cys Ser Arg Ser Thr Ser Glu Ser
145 150 155 160
Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val
165 170 175
Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe
180 185 190
Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val
195 200 205
Thr Val Pro Ser Ser Ser Leu Gly Thr Lys Thr Tyr Thr Cys Asn Val
210 215 220
Asp His Lys Pro Ser Asn Thr Lys Val Asp Lys Arg Val Glu Ser Lys
225 230 235 240
Tyr Gly Pro Pro Cys Pro Pro Cys Pro Ala Pro Glu Phe Leu Gly Gly
245 250 255
Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile
260 265 270
Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser Gln Glu
275 280 285
Asp Pro Glu Val Gln Phe Asn Trp Tyr Val Asp Gly Val Glu Val His
290 295 300
Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Phe Asn Ser Thr Tyr Arg
305 310 315 320
Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys
325 330 335
Glu Tyr Lys Cys Lys Val Ser Asn Lys Gly Leu Pro Ser Ser Ile Glu
340 345 350
Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr
355 360 365
Thr Leu Pro Pro Ser Gln Glu Glu Met Thr Lys Asn Gln Val Ser Leu
370 375 380
Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp
385 390 395 400
Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val
405 410 415
Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Arg Leu Thr Val Asp
420 425 430
Lys Ser Arg Trp Gln Glu Gly Asn Val Phe Ser Cys Ser Val Met His
435 440 445
Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Leu
450 455 460
Gly Lys
465
<210> 127
<211> 80
<212> Белок
<213> Искусственная последовательность
<220>
<223> GSC11218
<400> 127
Leu Ser Leu Ser Pro Gly Gly Gly Gly Ser Pro Pro Glu Asp Pro Pro
1 5 10 15
Asp Ser Lys Asn Thr Leu Val Leu Phe Gly Ala Gly Phe Gly Ala Val
20 25 30
Ile Thr Val Val Val Ile Val Val Ile Ile Lys Cys Phe Cys Lys His
35 40 45
Arg Ser Cys Phe Arg Arg Asn Glu Ala Ser Arg Glu Thr Asn Asn Ser
50 55 60
Leu Thr Phe Gly Pro Glu Glu Ala Leu Ala Glu Gln Thr Val Phe Leu
65 70 75 80
<210> 128
<211> 81
<212> Белок
<213> Искусственная последовательность
<220>
<223> GSC11213
<400> 128
Leu Ser Leu Ser Pro Gly Gly Gly Gly Ser Pro Pro Glu Asp Pro Pro
1 5 10 15
Asp Ser Lys Asn Leu Ala Leu Ile Leu Gly Pro Val Leu Ala Leu Leu
20 25 30
Ala Leu Val Ala Leu Gly Val Leu Gly Leu Trp Lys Cys Phe Cys Lys
35 40 45
His Arg Ser Cys Phe Arg Arg Asn Glu Ala Ser Arg Glu Thr Asn Asn
50 55 60
Ser Leu Thr Phe Gly Pro Glu Glu Ala Leu Ala Glu Gln Thr Val Phe
65 70 75 80
Leu
<210> 129
<211> 81
<212> Белок
<213> Искусственная последовательность
<220>
<223> GSC11214
<400> 129
Leu Ser Leu Ser Pro Gly Gly Gly Gly Ser Pro Pro Glu Asp Pro Pro
1 5 10 15
Asp Ser Lys Asn Ile Ala Ala Ile Ile Val Ile Leu Val Leu Leu Leu
20 25 30
Leu Leu Gly Ile Gly Leu Met Trp Trp Phe Trp Lys Cys Phe Cys Lys
35 40 45
His Arg Ser Cys Phe Arg Arg Asn Glu Ala Ser Arg Glu Thr Asn Asn
50 55 60
Ser Leu Thr Phe Gly Pro Glu Glu Ala Leu Ala Glu Gln Thr Val Phe
65 70 75 80
Leu
<210> 130
<211> 80
<212> Белок
<213> Искусственная последовательность
<220>
<223> GSC11210
<400> 130
Leu Ser Leu Ser Pro Gly Gly Gly Gly Ser Pro Pro Glu Asp Pro Pro
1 5 10 15
Asp Ser Lys Asn Met Ala Leu Ile Val Leu Gly Gly Val Ala Gly Leu
20 25 30
Leu Leu Phe Ile Gly Leu Gly Ile Phe Phe Lys Cys Phe Cys Lys His
35 40 45
Arg Ser Cys Phe Arg Arg Asn Glu Ala Ser Arg Glu Thr Asn Asn Ser
50 55 60
Leu Thr Phe Gly Pro Glu Glu Ala Leu Ala Glu Gln Thr Val Phe Leu
65 70 75 80
<210> 131
<211> 80
<212> Белок
<213> Искусственная последовательность
<220>
<223> GSC11205
<400> 131
Leu Ser Leu Ser Pro Gly Gly Gly Gly Ser Pro Pro Glu Asp Pro Pro
1 5 10 15
Asp Ser Lys Asn Ile Ala Gly Val Ile Ala Gly Ile Leu Leu Phe Val
20 25 30
Ile Ile Phe Leu Gly Val Val Leu Val Met Lys Cys Phe Cys Lys His
35 40 45
Arg Ser Cys Phe Arg Arg Asn Glu Ala Ser Arg Glu Thr Asn Asn Ser
50 55 60
Leu Thr Phe Gly Pro Glu Glu Ala Leu Ala Glu Gln Thr Val Phe Leu
65 70 75 80
<210> 132
<211> 80
<212> Белок
<213> Искусственная последовательность
<220>
<223> GSC11217
<400> 132
Leu Ser Leu Ser Pro Gly Gly Gly Gly Ser Pro Pro Glu Asp Pro Pro
1 5 10 15
Asp Ser Lys Asn Ala Leu Val Val Ile Pro Ile Ile Phe Gly Ile Leu
20 25 30
Phe Ala Ile Leu Leu Val Leu Val Phe Ile Lys Cys Phe Cys Lys His
35 40 45
Arg Ser Cys Phe Arg Arg Asn Glu Ala Ser Arg Glu Thr Asn Asn Ser
50 55 60
Leu Thr Phe Gly Pro Glu Glu Ala Leu Ala Glu Gln Thr Val Phe Leu
65 70 75 80
<210> 133
<211> 81
<212> Белок
<213> Искусственная последовательность
<220>
<223> GSC11756
<400> 133
Leu Ser Leu Ser Pro Gly Gly Gly Gly Ser Pro Pro Glu Asp Pro Pro
1 5 10 15
Asp Ser Lys Asn Ile Ile Pro Ile Val Ala Gly Val Val Ala Gly Ile
20 25 30
Val Leu Ile Gly Leu Ala Leu Leu Leu Ile Trp Lys Cys Phe Cys Lys
35 40 45
His Arg Ser Cys Phe Arg Arg Asn Glu Ala Ser Arg Glu Thr Asn Asn
50 55 60
Ser Leu Thr Phe Gly Pro Glu Glu Ala Leu Ala Glu Gln Thr Val Phe
65 70 75 80
Leu
<210> 134
<211> 82
<212> Белок
<213> Искусственная последовательность
<220>
<223> GSC11296
<400> 134
Leu Ser Leu Ser Pro Gly Gly Gly Gly Ser Pro Pro Glu Asp Pro Pro
1 5 10 15
Asp Ser Lys Asn Gly Ile Val Ala Gly Leu Ala Val Leu Ala Val Val
20 25 30
Val Ile Gly Ala Val Val Ala Ala Val Met Cys Arg Lys Cys Phe Cys
35 40 45
Lys His Arg Ser Cys Phe Arg Arg Asn Glu Ala Ser Arg Glu Thr Asn
50 55 60
Asn Ser Leu Thr Phe Gly Pro Glu Glu Ala Leu Ala Glu Gln Thr Val
65 70 75 80
Phe Leu
<210> 135
<211> 82
<212> Белок
<213> Искусственная последовательность
<220>
<223> GSC11295
<400> 135
Leu Ser Leu Ser Pro Gly Gly Gly Gly Ser Pro Pro Glu Asp Pro Pro
1 5 10 15
Asp Ser Lys Asn Leu Ile Ile Ala Leu Pro Val Ala Val Leu Leu Ile
20 25 30
Val Gly Gly Leu Val Ile Met Leu Tyr Val Phe His Lys Cys Phe Cys
35 40 45
Lys His Arg Ser Cys Phe Arg Arg Asn Glu Ala Ser Arg Glu Thr Asn
50 55 60
Asn Ser Leu Thr Phe Gly Pro Glu Glu Ala Leu Ala Glu Gln Thr Val
65 70 75 80
Phe Leu
<210> 136
<211> 82
<212> Белок
<213> Искусственная последовательность
<220>
<223> GSC11390
<400> 136
Leu Ser Leu Ser Pro Gly Gly Gly Gly Ser Pro Pro Glu Asp Pro Pro
1 5 10 15
Asp Ser Lys Asn Gly Leu Leu Ile Gly Ile Ser Ile Ala Ser Leu Cys
20 25 30
Leu Val Val Ala Leu Leu Ala Leu Leu Cys His Leu Lys Cys Phe Cys
35 40 45
Lys His Arg Ser Cys Phe Arg Arg Asn Glu Ala Ser Arg Glu Thr Asn
50 55 60
Asn Ser Leu Thr Phe Gly Pro Glu Glu Ala Leu Ala Glu Gln Thr Val
65 70 75 80
Phe Leu
<210> 137
<211> 82
<212> Белок
<213> Искусственная последовательность
<220>
<223> GSC11391
<400> 137
Leu Ser Leu Ser Pro Gly Gly Gly Gly Ser Pro Pro Glu Asp Pro Pro
1 5 10 15
Asp Ser Lys Asn Leu Leu Leu Gly Val Ser Val Ser Cys Ile Val Ile
20 25 30
Leu Ala Val Cys Leu Leu Cys Tyr Val Ser Ile Thr Lys Cys Phe Cys
35 40 45
Lys His Arg Ser Cys Phe Arg Arg Asn Glu Ala Ser Arg Glu Thr Asn
50 55 60
Asn Ser Leu Thr Phe Gly Pro Glu Glu Ala Leu Ala Glu Gln Thr Val
65 70 75 80
Phe Leu
<210> 138
<211> 81
<212> Белок
<213> Искусственная последовательность
<220>
<223> GSC11392
<400> 138
Asp Ser Lys Asn Thr Asn Thr Val Gly Ser Val Ile Gly Val Ile Val
20 25 30
Thr Ile Phe Val Ser Gly Thr Val Tyr Phe Ile Lys Cys Phe Cys Lys
35 40 45
His Arg Ser Cys Phe Arg Arg Asn Glu Ala Ser Arg Glu Thr Asn Asn
50 55 60
Ser Leu Thr Phe Gly Pro Glu Glu Ala Leu Ala Glu Gln Thr Val Phe
65 70 75 80
Leu
<210> 139
<211> 81
<212> Белок
<213> Искусственная последовательность
<220>
<223> GSC11397
<400> 139
Leu Ser Leu Ser Pro Gly Gly Gly Gly Ser Pro Pro Glu Asp Pro Pro
1 5 10 15
Asp Ser Lys Asn Ile Thr Leu Ile Ile Phe Gly Val Met Ala Gly Val
20 25 30
Ile Gly Thr Ile Leu Leu Ile Ser Tyr Gly Ile Lys Cys Phe Cys Lys
35 40 45
His Arg Ser Cys Phe Arg Arg Asn Glu Ala Ser Arg Glu Thr Asn Asn
50 55 60
Ser Leu Thr Phe Gly Pro Glu Glu Ala Leu Ala Glu Gln Thr Val Phe
65 70 75 80
Leu
<210> 140
<211> 79
<212> Белок
<213> Искусственная последовательность
<220>
<223> GSC11204
Leu Ser Leu Ser Pro Gly Gly Gly Gly Ser Pro Pro Glu Asp Pro Pro
1 5 10 15
Asp Ser Lys Asn Ala Leu Trp Leu Gly Val Leu Arg Leu Leu Leu Phe
20 25 30
Lys Leu Leu Leu Phe Asp Leu Leu Leu Lys Cys Phe Cys Lys His Arg
35 40 45
Ser Cys Phe Arg Arg Asn Glu Ala Ser Arg Glu Thr Asn Asn Ser Leu
50 55 60
Thr Phe Gly Pro Glu Glu Ala Leu Ala Glu Gln Thr Val Phe Leu
65 70 75
<210> 141
<211> 79
<212> Белок
<213> Искусственная последовательность
<220>
<223> GSC11216
<400> 141
Leu Ser Leu Ser Pro Gly Gly Gly Gly Ser Pro Pro Glu Asp Pro Pro
1 5 10 15
Asp Ser Lys Asn Ala Leu Trp Leu Gly Val Leu Val Leu Leu Leu Phe
20 25 30
Lys Leu Leu Leu Phe Asp Leu Leu Leu Lys Cys Phe Cys Lys His Arg
35 40 45
Ser Cys Phe Arg Arg Asn Glu Ala Ser Arg Glu Thr Asn Asn Ser Leu
50 55 60
Thr Phe Gly Pro Glu Glu Ala Leu Ala Glu Gln Thr Val Phe Leu
65 70 75
<210> 142
<211> 79
<212> Белок
<213> Искусственная последовательность
<220>
<223> GSC11203
<400> 142
Asp Ser Lys Asn Ala Leu Trp Leu Gly Val Leu Arg Leu Leu Leu Phe
20 25 30
Val Leu Leu Leu Phe Asp Leu Leu Leu Lys Cys Phe Cys Lys His Arg
35 40 45
Ser Cys Phe Arg Arg Asn Glu Ala Ser Arg Glu Thr Asn Asn Ser Leu
50 55 60
Thr Phe Gly Pro Glu Glu Ala Leu Ala Glu Gln Thr Val Phe Leu
65 70 75
<210> 143
<211> 79
<212> Белок
<213> Искусственная последовательность
<220>
<223> GSC11211
<400> 143
Leu Ser Leu Ser Pro Gly Gly Gly Gly Ser Pro Pro Glu Asp Pro Pro
1 5 10 15
Asp Ser Lys Asn Ala Leu Trp Leu Gly Val Leu Arg Leu Leu Leu Phe
20 25 30
Lys Leu Leu Leu Phe Val Leu Leu Leu Lys Cys Phe Cys Lys His Arg
35 40 45
Ser Cys Phe Arg Arg Asn Glu Ala Ser Arg Glu Thr Asn Asn Ser Leu
50 55 60
Thr Phe Gly Pro Glu Glu Ala Leu Ala Glu Gln Thr Val Phe Leu
65 70 75
<210> 144
<211> 79
<212> Белок
<213> Искусственная последовательность
<220>
<223> GSC11212
<400> 144
Leu Ser Leu Ser Pro Gly Gly Gly Gly Ser Pro Pro Glu Asp Pro Pro
1 5 10 15
Asp Ser Lys Asn Ala Leu Trp Leu Gly Val Leu Val Leu Leu Leu Phe
20 25 30
Val Leu Leu Leu Phe Asp Leu Leu Leu Lys Cys Phe Cys Lys His Arg
35 40 45
Ser Cys Phe Arg Arg Asn Glu Ala Ser Arg Glu Thr Asn Asn Ser Leu
50 55 60
Thr Phe Gly Pro Glu Glu Ala Leu Ala Glu Gln Thr Val Phe Leu
65 70 75
<210> 145
<211> 79
<212> Белок
<213> Искусственная последовательность
<220>
<223> GSC11398
<400> 145
Leu Ser Leu Ser Pro Gly Gly Gly Gly Ser Pro Pro Glu Asp Pro Pro
1 5 10 15
Asp Ser Lys Asn Ala Leu Trp Leu Gly Val Leu Val Leu Leu Leu Phe
20 25 30
Lys Leu Leu Leu Phe Val Leu Leu Leu Lys Cys Phe Cys Lys His Arg
35 40 45
Ser Cys Phe Arg Arg Asn Glu Ala Ser Arg Glu Thr Asn Asn Ser Leu
50 55 60
Thr Phe Gly Pro Glu Glu Ala Leu Ala Glu Gln Thr Val Phe Leu
65 70 75
<210> 146
<211> 79
<212> Белок
<213> Искусственная последовательность
<220>
<223> GSC11208
<400> 146
Leu Ser Leu Ser Pro Gly Gly Gly Gly Ser Pro Pro Glu Asp Pro Pro
1 5 10 15
Asp Ser Lys Asn Ala Leu Trp Leu Gly Val Leu Arg Leu Leu Leu Phe
20 25 30
Val Leu Leu Leu Phe Val Leu Leu Leu Lys Cys Phe Cys Lys His Arg
35 40 45
Ser Cys Phe Arg Arg Asn Glu Ala Ser Arg Glu Thr Asn Asn Ser Leu
50 55 60
Thr Phe Gly Pro Glu Glu Ala Leu Ala Glu Gln Thr Val Phe Leu
65 70 75
<210> 147 <211> 79
Белок
<213> Искусственная последовательность
<220>
<223> GSC11291 <400> 147
Leu Ser Leu Ser Pro Gly Gly Gly Gly Ser Pro Pro Glu Asp Pro Pro
1 5 10 15
Asp Ser Lys Asn Ala Leu Trp Leu Gly Val Leu Val Leu Leu Leu Phe
20 25 30
Val Leu Leu Leu Phe Val Leu Leu Leu Lys Cys Phe Cys Lys His Arg
35 40 45
Ser Cys Phe Arg Arg Asn Glu Ala Ser Arg Glu Thr Asn Asn Ser Leu
50 55 60
Thr Phe Gly Pro Glu Glu Ala Leu Ala Glu Gln Thr Val Phe Leu
65 70 75
<210> 148
<211> 77
<212> Белок
<213> Искусственная последовательность
<220>
<223> GSC11297
<400> 148
Leu Ser Leu Ser Pro Gly Gly Gly Gly Ser Pro Pro Glu Asp Pro Pro
1 5 10 15
Asp Ser Lys Asn Phe Phe Ile Pro Leu Leu Val Val Ile Leu Phe Ala
20 25 30
Val Asp Thr Gly Leu Phe Ile Lys Cys Phe Cys Lys His Arg Ser Cys
35 40 45
Phe Arg Arg Asn Glu Ala Ser Arg Glu Thr Asn Asn Ser Leu Thr Phe
50 55 60
Gly Pro Glu Glu Ala Leu Ala Glu Gln Thr Val Phe Leu
65 70 75
<210> 149
<211> 77
<212> Белок
<213> Искусственная последовательность
<220>
<223> GSC11298
<400> 149
Leu Ser Leu Ser Pro Gly Gly Gly Gly Ser Pro Pro Glu Asp Pro Pro
1 5 10 15
Asp Ser Lys Asn Ile Leu Ile Gly Thr Ser Val Val Ile Ile Leu Phe
20 25 30
Ile Leu Leu Phe Phe Leu Leu Lys Cys Phe Cys Lys His Arg Ser Cys
35 40 45
Phe Arg Arg Asn Glu Ala Ser Arg Glu Thr Asn Asn Ser Leu Thr Phe
50 55 60
Gly Pro Glu Glu Ala Leu Ala Glu Gln Thr Val Phe Leu
65 70 75
<210> 150
<211> 75
<212> Белок
<213> Искусственная последовательность
<220>
<223> GSC11393
<400> 150
Leu Ser Leu Ser Pro Gly Gly Gly Gly Ser Pro Pro Glu Asp Pro Pro
1 5 10 15
Asp Ser Lys Asn Val Leu Ala Leu Ile Val Ile Phe Leu Thr Ile Ala
20 25 30
Val Leu Leu Ala Leu Lys Cys Phe Cys Lys His Arg Ser Cys Phe Arg
35 40 45
Arg Asn Glu Ala Ser Arg Glu Thr Asn Asn Ser Leu Thr Phe Gly Pro
50 55 60
Glu Glu Ala Leu Ala Glu Gln Thr Val Phe Leu
65 70 75
<210> 151
<211> 84
<212> Белок
<213> Искусственная последовательность
<220>
<223> GSC11394
<400> 151
Leu Ser Leu Ser Pro Gly Gly Gly Gly Ser Pro Pro Glu Asp Pro Pro
1 5 10 15
Asp Ser Lys Asn Val Met Ser Val Ala Thr Ile Val Ile Val Asp Ile
20 25 30
Cys Ile Thr Gly Gly Leu Leu Leu Leu Val Tyr Tyr Trp Ser Lys Cys
35 40 45
Phe Cys Lys His Arg Ser Cys Phe Arg Arg Asn Glu Ala Ser Arg Glu
50 55 60
Thr Asn Asn Ser Leu Thr Phe Gly Pro Glu Glu Ala Leu Ala Glu Gln
65 70 75 80
Thr Val Phe Leu
<210> 152 <211> 84 <212> Бе
Белок
<213> Искусственная последовательность
<220>
<223> GSC11395 <400> 152
Leu Ser Leu Ser Pro Gly Gly Gly Gly Ser Pro Pro Glu Asp Pro Pro
1 5 10 15
Asp Ser Lys Asn Ala Ile Pro Ile Trp Trp Val Leu Val Gly Val Leu
20 25 30
Gly Gly Leu Leu Leu Leu Thr Ile Leu Val Leu Ala Met Trp Lys Cys
35 40 45
Phe Cys Lys His Arg Ser Cys Phe Arg Arg Asn Glu Ala Ser Arg Glu
50 55 60
Thr Asn Asn Ser Leu Thr Phe Gly Pro Glu Glu Ala Leu Ala Glu Gln
65 70 75 80
Thr Val Phe Leu
<210> 153 <211> 85 <212> ^-
Белок
<213> Искусственная последовательность
<220>
<223> GSC11396 <400> 153
Leu Ser Leu Ser Pro Gly Gly Gly Gly Ser Pro Pro Glu Asp Pro Pro
1 5 10 15
Asp Ser Lys Asn Phe Trp Val Leu Val Val Val Gly Gly Val Leu Ala
20 25 30
Cys Tyr Ser Leu Leu Val Thr Val Ala Phe Ile Ile Phe Trp Val Lys
35 40 45
Cys Phe Cys Lys His Arg Ser Cys Phe Arg Arg Asn Glu Ala Ser Arg
50 55 60
Glu Thr Asn Asn Ser Leu Thr Phe Gly Pro Glu Glu Ala Leu Ala Glu
65 70 75 80
Gln Thr Val Phe Leu 85
<210> 154
<211> 85
<212> Белок
<213> Искусственная последовательность
<220>
<223> GSC11389
<400> 154
Leu Ser Leu Ser Pro Gly Gly Gly Gly Ser Pro Pro Glu Asp Pro Pro
1 5 10 15
Asp Ser Lys Asn Leu Trp Thr Thr Ile Thr Ile Phe Ile Thr Leu Phe
20 25 30
Leu Leu Ser Val Cys Tyr Ser Ala Thr Val Thr Phe Phe Lys Val Lys
35 40 45
Cys Phe Cys Lys His Arg Ser Cys Phe Arg Arg Asn Glu Ala Ser Arg
50 55 60
Glu Thr Asn Asn Ser Leu Thr Phe Gly Pro Glu Glu Ala Leu Ala Glu
65 70 75 80
Gln Thr Val Phe Leu
<210> 155
<211> 76
<212> Белок
<213> Искусственная последовательность
<220>
<223> GSC11677
<400> 155
Leu Ser Leu Ser Pro Gly Gly Gly Gly Ser Pro Pro Glu Asp Pro Pro
1 5 10 15
Asp Ser Lys Asn Thr Leu Val Leu Phe Gly Ala Gly Phe Gly Ala Thr
20 25 30
Val Ile Val Val Ile Ile Lys Cys Phe Cys Lys His Arg Ser Cys Phe
35 40 45
Arg Arg Asn Glu Ala Ser Arg Glu Thr Asn Asn Ser Leu Thr Phe Gly
50 55 60
Pro Glu Glu Ala Leu Ala Glu Gln Thr Val Phe Leu
65 70 75
<210> 156
<211> 78
<212> Белок
<213> Искусственная последовательность
<220>
<223> GSC11679
<400> 156
Leu Ser Leu Ser Pro Gly Gly Gly Gly Ser Pro Pro Glu Asp Pro Pro
1 5 10 15
Asp Ser Lys Asn Thr Leu Val Leu Phe Gly Ala Gly Phe Gly Ala Thr
20 25 30
Val Val Val Ile Val Val Ile Ile Lys Cys Phe Cys Lys His Arg Ser
35 40 45
Cys Phe Arg Arg Asn Glu Ala Ser Arg Glu Thr Asn Asn Ser Leu Thr
50 55 60
Phe Gly Pro Glu Glu Ala Leu Ala Glu Gln Thr Val Phe Leu
65 70 75
<210> 157
<211> 82
<212> Белок
<213> Искусственная последовательность
<220>
<223> GSC11484
<400> 157
Leu Ser Leu Ser Pro Gly Gly Gly Gly Ser Pro Pro Glu Asp Pro Pro
1 5 10 15
Asp Ser Lys Asn Thr Leu Val Leu Phe Gly Ala Gly Phe Gly Ala Val
20 25 30
Val Ile Val Thr Val Val Val Ile Val Val Ile Ile Lys Cys Phe Cys
35 40 45
Lys His Arg Ser Cys Phe Arg Arg Asn Glu Ala Ser Arg Glu Thr Asn
50 55 60
Asn Ser Leu Thr Phe Gly Pro Glu Glu Ala Leu Ala Glu Gln Thr Val
65 70 75 80
Phe Leu
<210> 158
<211> 84
<212> Белок
<213> Искусственная последовательность
<220>
<223> GSC11292
<400> 158
Leu Ser Leu Ser Pro Gly Gly Gly Gly Ser Pro Pro Glu Asp Pro Pro
1 5 10 15
Asp Ser Lys Asn Thr Leu Val Leu Phe Gly Ala Gly Phe Gly Ala Val
20 25 30
Val Ile Val Val Val Thr Val Val Val Ile Val Val Ile Ile Lys Cys
35 40 45
Phe Cys Lys His Arg Ser Cys Phe Arg Arg Asn Glu Ala Ser Arg Glu
50 55 60
Thr Asn Asn Ser Leu Thr Phe Gly Pro Glu Glu Ala Leu Ala Glu Gln
65 70 75 80
Thr Val Phe Leu
<210> 159
<211> 51
<212> Белок
<213> Искусственная последовательность
<220>
<223> GSC11207
<400> 159
Leu Ser Leu Ser Pro Gly Gly Gly Gly Ser Pro Pro Glu Asp Pro Pro
1 5 10 15
Asp Ser Lys Asn Thr Leu Val Leu Phe Gly Ala Gly Phe Gly Ala Val
20 25 30
Ile Thr Val Val Val Ile Val Val Ile Ile Ala Ser Ala His His His
35 40 45
His His His
<210> 160
<211> 47
<212> Белок
<213> Искусственная последовательность
<220>
<223> GSC11209
<400> 160
Leu Ser Leu Ser Pro Gly Gly Gly Gly Ser Pro Pro Glu Asp Pro Pro
1 5 10 15
Asp Ser Lys Asn Thr Leu Val Leu Phe Gly Ala Gly Phe Gly Ala Val
20 25 30
Ile Thr Val Val Val Ile Val Val Ile Ile Lys Cys Phe Cys Lys
35 40 45
<210> 161
<211> 68
<212> Белок
<213> Искусственная последовательность
<400> 161
Leu Ser Leu Ser Pro Gly Gly Gly 1 5
Gly Ser Pro Pro Glu Asp Pro Pro
10 15
Asp Ser Lys Asn Thr Leu Val Leu Phe Gly Ala Gly Phe Gly Ala Val
20 25 30
Ile Thr Val Val Val Ile Val Val Ile Ile Lys Trp Ile Phe Ser Ser
35 40 45
Val Val Asp Leu Lys Gln Thr Ile Ile Pro Asp Tyr Arg Asn Met Ile
50 55 60
Gly Gln Gly Ala 65
<210> 162
<211> 54
<212> Белок
<213> Искусственная последовательность
<220>
<223> GSC11764
<400> 162
Leu Ser Leu Ser Pro Gly Gly Gly Gly Ser Pro Pro Glu Asp Pro Pro
1 5 10 15
Asp Ser Lys Asn Thr Leu Val Leu Phe Gly Ala Gly Phe Gly Ala Val
20 25 30
Ile Thr Val Val Val Ile Val Val Ile Ile Arg Ser Gln Gln Glu Ala
35 40 45
Ala Ala Lys Lys Phe Phe 50
<210> 163
<211> 54
<212> Белок
<213> Искусственная последовательность
<220>
<223> GSC11678
<400> 163
Leu Ser Leu Ser Pro Gly Gly Gly Gly Ser Pro Pro Glu Asp Pro Pro
1 5 10 15
Ile Thr Val Val Val Ile Val Val Ile Ile Arg Ser Gln Gln Glu Ala
35 40 45
Ala Ala Lys Lys Trp Trp
<210> 164
<211> 87
<212> Белок
<213> Искусственная последовательность
<220>
<223> GSC11759
<400> 164
Leu Ser Leu Ser Pro Gly Gly Gly Gly Ser Pro Pro Glu Asp Pro Pro
1 5 10 15
Asp Ser Lys Asn Thr Leu Val Leu Phe Gly Ala Gly Phe Gly Ala Val
20 25 30
Ile Thr Val Val Val Ile Val Val Ile Ile Met Phe Leu Thr Leu Lys
35 40 45
Gly Ser Leu Lys Gln Arg Leu Gln Val Met Ile Gln Pro Ser Glu Asp
50 55 60
Ile Val Arg Pro Glu Asn Gly Pro Glu Gln Pro Gln Ala Gly Ser Ser
65 70 75 80
Ala Ser Lys Glu Ala Tyr Ile 85
<210> 165
<211> 50
<212> Белок
<213> Искусственная последовательность
<220>
<223> GSC11483
<400> 165
Leu Ser Leu Ser Pro Gly Gly Gly Gly Ser Pro Pro Glu Asp Pro Pro
1 5 10 15
Asp Ser Lys Asn Thr Leu Val Leu Phe Gly Ala Gly Phe Gly Ala Val
20 25 30
Ile Thr Val Val Val Ile Val Val Ile Ile Met Phe Leu Thr Leu Lys
35 40 45
Gly Ser 50
<210> 166
<211> 87
<212> Белок
<213> Искусственная последовательность
<220>
<223> GSC11760
<400> 166
Leu Ser Leu Ser Pro Gly Gly Gly Gly Ser Pro Pro Glu Asp Pro Pro
1 5 10 15
Asp Ser Lys Asn Thr Leu Val Leu Phe Gly Ala Gly Phe Gly Ala Val
20 25 30
Ile Thr Val Val Val Ile Val Val Ile Ile Cys Phe Val Gly Asn Arg
35 40 45
Phe Gln Gln Lys Leu Arg Ser Val Phe Arg Val Pro Ile Thr Trp Leu
50 55 60
Gln Gly Lys Arg Glu Thr Met Ser Cys Arg Lys Ser Ser Ser Leu Arg
65 70 75 80
Glu Met Asp Thr Phe Val Ser 85
<210> 167
<211> 80
<212> Белок
<213> Искусственная последовательность
<220>
<223> GSC11761
<400> 167
Leu Ser Leu Ser Pro Gly Gly Gly Gly Ser Pro Pro Glu Asp Pro Pro
1 5 10 15
Asp Ser Lys Asn Thr Leu Val Leu Phe Gly Ala Gly Phe Gly Ala Val
20 25 30
Ile Thr Val Val Val Ile Val Val Ile Ile Cys Phe Val Gly Asn Arg
35 40 45
Gln Gly Lys Arg Glu Thr Met Ser Cys Arg Lys Ser Ser Ser Leu Arg
65 70 75 80
<210> 168
<211> 125
<212> Белок
<213> Искусственная последовательность
<220>
<223> GSC11762
<400> 168
Leu Ser Leu Ser Pro Gly Gly Gly Gly Ser Pro Pro Glu Asp Pro Pro
1 5 10 15
Asp Ser Lys Asn Thr Leu Val Leu Phe Gly Ala Gly Phe Gly Ala Val
20 25 30
Ile Thr Val Val Val Ile Val Val Ile Ile Asn Ser His Leu Leu Pro
35 40 45
Arg Pro Leu Arg His Leu Ala Cys Cys Gly Gly Pro Gln Pro Arg Met
50 55 60
Arg Arg Arg Leu Ser Asp Gly Ser Leu Ser Ser Arg His Thr Thr Leu
65 70 75 80
Leu Thr Arg Ser Ser Cys Pro Ala Thr Leu Ser Leu Ser Leu Ser Leu
85 90 95
Thr Leu Ser Gly Arg Pro Arg Pro Glu Glu Ser Pro Arg Asp Leu Glu
100 105 110
Leu Ala Asp Gly Glu Gly Thr Ala Glu Thr Ile Ile Phe
115 120 125
<210> 169
<211> 66
<212> Белок
<213> Искусственная последовательность
<220>
<223> GSC11765
<400> 169
Leu Ser Leu Ser Pro Gly Gly Gly Gly Ser Pro Pro Glu Asp Pro Pro
1 5 10 15
Asp Ser Lys Asn Thr Leu Val Leu Phe Gly Ala Gly Phe Gly Ala Val
20 25 30
Ile Thr Val Val Val Ile Val Val Ile Ile Asn Ser His Glu Glu Ser
35 40 45
Pro Arg Asp Leu Glu Leu Ala Asp Gly Glu Gly Thr Ala Glu Thr Ile
50 55 60
Ile Phe 65
<210> 170
<211> 65
<212> Белок
<213> Искусственная последовательность
<220>
<223> GSC11766
<400> 170
Leu Ser Leu Ser Pro Gly Gly Gly Gly Ser Pro Pro Glu Asp Pro Pro
1 5 10 15
Asp Ser Lys Asn Thr Leu Val Leu Phe Gly Ala Gly Phe Gly Ala Val
20 25 30
Ile Thr Val Val Val Ile Val Val Ile Ile Cys Ile Lys Leu Lys His
35 40 45
Thr Lys Lys Arg Gln Ile Tyr Thr Asp Ile Glu Met Asn Arg Leu Gly
50 55 60
Lys
<210> 171
<211> 65
<212> Белок
<213> Искусственная последовательность
<220>
<223> GSC11763
<400> 171
Leu Ser Leu Ser Pro Gly Gly Gly Gly Ser Pro Pro Glu Asp Pro Pro
1 5 10 15
Asp Ser Lys Asn Thr Leu Val Leu Phe Gly Ala Gly Phe Gly Ala Val
20 25 30
Ile Thr Val Val Val Ile Val Val Ile Ile Cys Ile Lys Leu Lys His
35 40 45
Thr Lys Lys Arg Gln Ile Ala Ala Ala Ala Ala Ala Asn Arg Leu Gly
50 55 60
Lys
<210> 172
<211> 88
<212> Белок
<213> Искусственная последовательность
<220>
<223> GSC11294
<400> 172
Leu Ser Leu Ser Pro Glu Leu Gln Pro Val Glu Ser Cys Ala Glu Ala
1 5 10 15
Gln Asp Gly Glu Leu Asp Gly Leu Trp Thr Thr Ile Thr Ile Phe Ile
20 25 30
Thr Leu Phe Leu Leu Ser Val Cys Tyr Ser Ala Thr Val Thr Phe Phe
35 40 45
Lys Val Lys Cys Phe Cys Lys His Arg Ser Cys Phe Arg Arg Asn Glu
50 55 60
Ala Ser Arg Glu Thr Asn Asn Ser Leu Thr Phe Gly Pro Glu Glu Ala
65 70 75 80
Leu Ala Glu Gln Thr Val Phe Leu 85
<210> 173
<211> 22
<212> Белок
<213> Искусственная последовательность
<220>
<223> B7 TM домен
<400> 173
Thr Leu Val Leu Phe Gly Ala Gly Phe Gly Ala Val Ile Thr Val Val
1 5 10 15
Val Ile Val Val Ile Ile 20
<212> Белок
<213> Homo sapiens
<400> 174
Leu Ala Leu Ile Leu Gly Pro Val Leu Ala Leu Leu Ala Leu Val Ala
1 5 10 15
Leu Gly Val Leu Gly Leu Trp 20
<210> 175
<211> 23
<212> Белок
<213> Homo sapiens
<400> 175
Ile Ala Ala Ile Ile Val Ile Leu Val Leu Leu Leu Leu Leu Gly Ile
1 5 10 15
Gly Leu Met Trp Trp Phe Trp 20
<210> 176
<211> 22
<212> Белок
<213> Homo sapiens
<400> 176
Met Ala Leu Ile Val Leu Gly Gly Val Ala Gly Leu Leu Leu Phe Ile
1 5 10 15
Gly Leu Gly Ile Phe Phe 20
<210> 177
<211> 22
<212> Белок
<213> Homo sapiens
<400> 177
Ile Ala Gly Val Ile Ala Gly Ile Leu Leu Phe Val Ile Ile Phe Leu
1 5 10 15
Gly Val Val Leu Val Met 20
<210> 178
<211> 22
<212> Белок
<213> Homo sapiens
Ala Leu Val Val Ile Pro Ile Ile Phe Gly Ile Leu Phe Ala Ile Leu
1 5 10 15
Leu Val Leu Val Phe Ile 20
<210> 179
<211> 23
<212> Белок
<213> Homo sapiens
<400> 179
Ile Ile Pro Ile Val Ala Gly Val Val Ala Gly Ile Val Leu Ile Gly
1 5 10 15
Leu Ala Leu Leu Leu Ile Trp
<210> 180
<211> 24
<212> Белок
<213> Homo sapiens
<400> 180
Gly Ile Val Ala Gly Leu Ala Val Leu Ala Val Val Val Ile Gly Ala
1 5 10 15
Val Val Ala Ala Val Met Cys Arg 20
<210> 181
<211> 24
<212> Белок
<213> Homo sapiens
<400> 181
Leu Ile Ile Ala Leu Pro Val Ala Val Leu Leu Ile Val Gly Gly Leu
1 5 10 15
Val Ile Met Leu Tyr Val Phe His 20
<210> 182
<211> 24
<212> Белок
<213> Homo sapiens
<400> 182
Leu Leu Ala Leu Leu Cys His Leu 20
<210> 183
<211> 24
<212> Белок
<213> Homo sapiens
<400> 183
Leu Leu Leu Gly Val Ser Val Ser Cys Ile Val Ile Leu Ala Val Cys
1 5 10 15
Leu Leu Cys Tyr Val Ser Ile Thr
<210> 184
<211> 23
<212> Белок
<213> Homo sapiens
<400> 184
Thr Asn Thr Val Gly Ser Val Ile Gly Val Ile Val Thr Ile Phe Val
1 5 10 15
Ser Gly Thr Val Tyr Phe Ile 20
<210> 185
<211> 23
<212> Белок
<213> Homo sapiens
<400> 185
Ile Thr Leu Ile Ile Phe Gly Val Met Ala Gly Val Ile Gly Thr Ile
1 5 10 15
Leu Leu Ile Ser Tyr Gly Ile 20
<210> 186
<211> 21
<212> Белок
<213> Искусственная последовательность
<220>
<223> PTCRA TM домен
<400> 186
Ala Leu Trp Leu Gly Val Leu Arg Leu Leu Leu Phe Lys Leu Leu Leu
1 5 10 15
Phe Asp Leu Leu Leu
<210> 187
<211> 21
<212> Белок
<213> Искусственная последовательность
<220>
<223> PTCRA_R8V TM домен
<400> 187
Ala Leu Trp Leu Gly Val Leu Val Leu Leu Leu Phe Lys Leu Leu Leu
1 5 10 15
Phe Asp Leu Leu Leu
<210> 188
<211> 21
<212> Белок
<213> Искусственная последовательность
<220>
<223> PTCRA_K13V TM домен
<400> 188
Ala Leu Trp Leu Gly Val Leu Arg Leu Leu Leu Phe Val Leu Leu Leu
1 5 10 15
Phe Asp Leu Leu Leu
<210> 189
<211> 21
<212> Белок
<213> Искусственная последовательность
<220>
<223> PTCRA_D18V TM домен
<400> 189
Ala Leu Trp Leu Gly Val Leu Arg Leu Leu Leu Phe Lys Leu Leu Leu
1 5 10 15
Phe Val Leu Leu Leu
<210> 190
<211> 21
<212> Белок
<213> Искусственная последовательность
<223> PTCRA_R8V_K13V TM домен
<400> 190
Ala Leu Trp Leu Gly Val Leu Val 1 5
Leu Leu Leu Phe Val Leu Leu Leu
10 15
Phe Asp Leu Leu Leu
<210> 191
<211> 21
<212> Белок
<213> Искусственная последовательность
<220>
<223> PTCRA_R8V_D18V TM домен
<400> 191
Ala Leu Trp Leu Gly Val Leu Val Leu Leu Leu Phe Lys Leu Leu Leu
1 5 10 15
Phe Val Leu Leu Leu
<210> 192
<211> 21
<212> Белок
<213> Искусственная последовательность
<220>
<223> PTCRA_K13V_D18V TM домен
<400> 192
Ala Leu Trp Leu Gly Val Leu Arg Leu Leu Leu Phe Val Leu Leu Leu
1 5 10 15
Phe Val Leu Leu Leu
<210> 193
<211> 21
<212> Белок
<213> Искусственная последовательность
<220>
<223> PTCRA_R8V_K13V_D18V TM домен
<400> 193
Ala Leu Trp Leu Gly Val Leu Val Leu Leu Leu Phe Val Leu Leu Leu
1 5 10 15
<210> 194
<211> 19
<212> Белок
<213> Homo sapiens
<400> 194
Phe Phe Ile Pro Leu Leu Val Val Ile Leu Phe Ala Val Asp Thr Gly
1 5 10 15
Leu Phe Ile
<210> 195
<211> 19
<212> Белок
<213> Homo sapiens
<400> 195
Ile Leu Ile Gly Thr Ser Val Val Ile Ile Leu Phe Ile Leu Leu Phe
1 5 10 15
Phe Leu Leu
<210> 196
<211> 17
<212> Белок
<213> Homo sapiens
<400> 196
Val Leu Ala Leu Ile Val Ile Phe Leu Thr Ile Ala Val Leu Leu Ala
1 5 10 15
Leu
<210> 197
<211> 26
<212> Белок
<213> Homo sapiens
<400> 197
Val Met Ser Val Ala Thr Ile Val Ile Val Asp Ile Cys Ile Thr Gly
1 5 10 15
Gly Leu Leu Leu Leu Val Tyr Tyr Trp Ser 20 25
<212> Белок
<213> Homo sapiens
<400> 198
Ala Ile Pro Ile Trp Trp Val Leu Val Gly Val Leu Gly Gly Leu Leu
1 5 10 15
Leu Leu Thr Ile Leu Val Leu Ala Met Trp 20 25
<210> 199
<211> 27
<212> Белок
<213> Homo sapiens
<400> 199
Phe Trp Val Leu Val Val Val Gly Gly Val Leu Ala Cys Tyr Ser Leu
1 5 10 15
Leu Val Thr Val Ala Phe Ile Ile Phe Trp Val 20 25
<210> 200
<211> 27
<212> Белок
<213> Искусственная последовательность
<220>
<223> M1M2 TM домен
<400> 200
Leu Trp Thr Thr Ile Thr Ile Phe Ile Thr Leu Phe Leu Leu Ser Val
1 5 10 15
Cys Tyr Ser Ala Thr Val Thr Phe Phe Lys Val 20 25
<210> 201
<211> 18
<212> Белок
<213> Искусственная последовательность
<220>
<223> B7(18) TM домен
<400> 201
Thr Leu Val Leu Phe Gly Ala Gly Phe Gly Ala Thr Val Ile Val Val
1 5 10 15
Ile Ile
<210> 202
<211> 20
<212> Белок
<213> Искусственная последовательность
<220>
<223> B7(20) TM домен
<400> 202
Thr Leu Val Leu Phe Gly Ala Gly Phe Gly Ala Thr Val Val Val Ile
1 5 10 15
Val Val Ile Ile 20
<210> 203
<211> 24
<212> Белок
<213> Искусственная последовательность
<220>
<223> B7(24) TM домен
<400> 203
Thr Leu Val Leu Phe Gly Ala Gly Phe Gly Ala Val Val Ile Val Thr
1 5 10 15
Val Val Val Ile Val Val Ile Ile 20
<210> 204
<211> 26
<212> Белок
<213> Искусственная последовательность
<220>
<223> B7(26) TM домен
<400> 204
Thr Leu Val Leu Phe Gly Ala Gly Phe Gly Ala Val Val Ile Val Val
1 5 10 15
Val Thr Val Val Val Ile Val Val Ile Ile 20 25
<210> <211> <212> 205 9
Белок
<213> Искусственная последовательность
<220>
<223> 6His цитозольный хвост
Ala Ser Ala His His His His His His 1 5
<210> <211> <212> 206
Белок
<213> Искусственная последовательность
<220>
<223> KCFCK цитозольный хвост
<400> 206
Lys Cys Phe Cys Lys 1 5
<210> 207
<211> 26
<212> Белок
<213> Искусственная последовательность
<220>
<223> M1M2 цитозольный хвост
<400> 207
Lys Trp Ile Phe Ser Ser Val Val Asp Leu Lys Gln Thr Ile Ile Pro
1 5 10 15
Asp Tyr Arg Asn Met Ile Gly Gln Gly Ala 20 25
<210> 208
<211> 12
<212> Белок
<213> Искусственная последовательность
<220>
<223> ERGIC53 цитозольный хвост
<400> 208
Arg Ser Gln Gln Glu Ala Ala Ala Lys Lys Phe Phe
1 5 10
<210> 209
<211> 12
<212> Белок
<213> Искусственная последовательность
<220>
<223> ERGICnoER цитозольный хвост
<400> 209
Arg Ser Gln Gln Glu Ala Ala Ala Lys Lys Trp Trp
1 5 10
<210> 210
<211> 45
<212> Белок
<213> Искусственная последовательность
<220>
<223> GAT1 цитозольный хвост
<400> 210
Met Phe Leu Thr Leu Lys Gly Ser Leu Lys Gln Arg Leu Gln Val Met
1 5 10 15
Ile Gln Pro Ser Glu Asp Ile Val Arg Pro Glu Asn Gly Pro Glu Gln
20 25 30
Pro Gln Ala Gly Ser Ser Ala Ser Lys Glu Ala Tyr Ile
35 40 45
<210> <211> <212> 211
Белок
<213> Искусственная последовательность
<220>
<223> GAT1noER цитозольный хвост
<400> 211
Met Phe Leu Thr Leu Lys Gly Ser 1 5
<210> 212
<211> 45
<212> Белок
<213> Искусственная последовательность
<220>
<223> AGTR2 цитозольный хвост
<400> 212
Cys Phe Val Gly Asn Arg Phe Gln Gln Lys Leu Arg Ser Val Phe Arg
1 5 10 15
Val Pro Ile Thr Trp Leu Gln Gly Lys Arg Glu Thr Met Ser Cys Arg
20 25 30
Lys Ser Ser Ser Leu Arg Glu Met Asp Thr Phe Val Ser
35 40 45
<210> 213
<211> 38
<212> Белок
<213> Искусственная последовательность
<223> AGTR2noER цитозольный хвост
<400> 213
Cys Phe Val Gly Asn Arg Phe Gln 1 5
Gln Lys Leu Arg Ser Val Phe Arg 10 15
Val Pro Ile Thr Trp Leu Gln Gly Lys Arg Glu Thr Met Ser Cys Arg
20 25 30
Lys Ser Ser Ser Leu Arg
<210> 214
<211> 83
<212> Белок
<213> Искусственная последовательность
<220>
<223> V1BR цитозольный хвост
<400> 214
Asn Ser His Leu Leu Pro Arg Pro Leu Arg His Leu Ala Cys Cys Gly
1 5 10 15
Gly Pro Gln Pro Arg Met Arg Arg Arg Leu Ser Asp Gly Ser Leu Ser
20 25 30
Ser Arg His Thr Thr Leu Leu Thr Arg Ser Ser Cys Pro Ala Thr Leu
35 40 45
Ser Leu Ser Leu Ser Leu Thr Leu Ser Gly Arg Pro Arg Pro Glu Glu
50 55 60
Ser Pro Arg Asp Leu Glu Leu Ala Asp Gly Glu Gly Thr Ala Glu Thr
65 70 75 80
Ile Ile Phe
<210> 215 <211> 24
<212> Белок
<213> Искусственная последовательность
<220>
<223> V1BRnoER цитозольный хвост
<400> 215
Asn Ser His Glu Glu Ser Pro Arg Asp Leu Glu Leu Ala Asp Gly Glu
1 5 10 15
Gly Thr Ala Glu Thr Ile Ile Phe 20
<210> 216
<211> 23
<212> Белок
<213> Искусственная последовательность
<220>
<223> VGLG цитозольный хвост
<400> 216
Cys Ile Lys Leu Lys His Thr Lys Lys Arg Gln Ile Tyr Thr Asp Ile
1 5 10 15
Glu Met Asn Arg Leu Gly Lys 20
<210> 217
<211> 23
<212> Белок
<213> Искусственная последовательность
<220>
<223> VGLGnoER цитозольный хвост
<400> 217
Cys Ile Lys Leu Lys His Thr Lys Lys Arg Gln Ile Ala Ala Ala Ala
1 5 10 15
Ala Ala Asn Arg Leu Gly Lys
<210> 218
<211> 38
<212> Белок
<213> Искусственная последовательность
<220>
<223> B7 цитозольный хвост
<400> 218
Lys Cys Phe Cys Lys His Arg Ser Cys Phe Arg Arg Asn Glu Ala Ser
1 5 10 15
Arg Glu Thr Asn Asn Ser Leu Thr Phe Gly Pro Glu Glu Ala Leu Ala
20 25 30
Glu Gln Thr Val Phe Leu 35
<212> ДНК
<213> Искусственная последовательность
<220>
<223> Праймер GlnPr2376 <400> 219
ggccgttcga atcatcactt gcagaagcac ttgataatc 39
<210> 220
<211> 65
<212> ДНК
<213> Искусственная последовательность
<220>
<223> Праймер GlnPr2377
<400> 220
gtcatttcga atcatcaatg atggtggtgg tgatgggcgc tggcgataat cacgacgatc 60 acgac 65
<210> 221
<211> 59
<212> Белок
<213> Искусственная последовательность
<220>
<223> Праймер GlnPr2378
<400> 221
Thr Thr Gly Ala Ala Cys Ala Gly Cys Ala Gly Cys Ala Gly Thr Cys
1 5 10 15
Thr Cys Ala Gly Cys Ala Cys Gly Cys Cys Cys Ala Gly Cys Cys Ala
20 25 30
Cys Ala Gly Gly Gly Cys Cys Cys Cys Gly Thr Cys Cys Ala Gly Cys
35 40 45
Thr Cys Cys Cys Cys Gly Thr Cys Cys Thr Gly 50 55
<210> 222
<211> 66
<212> ДНК
<213> Искусственная последовательность
<220>
<223> Праймер GlnPr2379
<400> 222
ctgagactgc tgctgttcaa gctgctcctg ttcgacctgc tcctcaagtg gatcttctcc 60
<210> 223
<211> 64
<212> ДНК
<213> Искусственная последовательность
<220>
<223> Праймер GlnPr2380
<400> 223
gcttgaacag cagcagtctc agcacgccca gccacagggc attcttggag tcaggggggt 60 cctc 64
<210> 224
<211> 69
<212> Белок
<213> Искусственная последовательность
<220>
<223> Праймер GlnPr2381
<400> 224
Cys Ala Gly Gly Ala Cys Cys Gly Gly Thr Gly Cys Thr Thr Gly Cys
1 5 10 15
Ala Gly Ala Ala Gly Cys Ala Cys Thr Thr Gly Ala Gly Gly Ala Gly
20 25 30
Cys Ala Gly Gly Thr Cys Gly Ala Ala Cys Ala Gly Gly Ala Gly Cys
35 40 45
Ala Gly Cys Thr Thr Gly Ala Ala Cys Ala Gly Cys Ala Gly Cys Ala
50 55 60
Gly Thr Cys Thr Cys 65
<210> 225
<211> 64
<212> ДНК
<213> Искусственная последовательность
<220>
<223> Праймер GlnPr2382
<400> 225
gcttgaacag cagcagtacc agcacgccca gccacagggc attcttggag tcaggggggt 60 cctc 64
<210> 226
<211> 69
<212> ДНК
<213> Искусственная последовательность
<223> Праймер GlnPr2383
<400> 226
caggaccggt gcttgcagaa gcacttgagg agcaggtcga acaggagcag cttgaacagc 60 agcagtacc 69
<210> 227
<211> 66
<212> ДНК
<213> Искусственная последовательность
<220>
<223> Праймер GlnPr2384 <400> 227
gaccggtgct tgcagaagca cttgaggagc aggtcgaaca ggagcagcac gaacagcagc 60 agtctc 66
<210> 228
<211> 66
<212> ДНК
<213> Искусственная последовательность
<220>
<223> Праймер GlnPr2385
<400> 228
gaccggtgct tgcagaagca cttgaggagc aggacgaaca ggagcagctt gaacagcagc 60 agtctc 66
<210> 229
<211> 69
<212> ДНК
<213> Искусственная последовательность
<220>
<223> Праймер GlnPr2386 <400> 229
caggaccggt gcttgcagaa gcacttgagg agcaggtcga acaggagcag cacgaacagc 60 agcagtacc 69
<210> 230
<211> 69
<212> ДНК
<213> Искусственная последовательность
<220>
<223> Праймер GlnPr2387
<400> 230
caggaccggt gcttgcagaa gcacttgagg agcaggacga acaggagcag cttgaacagc 60
<210> 231
<211> 66
<212> ДНК
<213> Искусственная последовательность
<220>
<223> Праймер GlnPr2388 <400> 231
gaccggtgct tgcagaagca cttgaggagc aggacgaaca ggagcagcac gaacagcagc 60 agtctc 66
<210> 232
<211> 69
<212> ДНК
<213> Искусственная последовательность
<220>
<223> Праймер GlnPr2389 <400> 232
caggaccggt gcttgcagaa gcacttgagg agcaggacga acaggagcag cacgaacagc 60 agcagtacc 69
<210> 233
<211> 47
<212> ДНК
<213> Искусственная последовательность
<220>
<223> Праймер GlnPr2390
<400> 233
ggtcgtgatc gtcgtgatta tcaagtggat cttctcctcg gtggtgg 47
<210> 234
<211> 47
<212> ДНК
<213> Искусственная последовательность
<220>
<223> Праймер GlnPr2391
<400> 234
ccaccaccga ggagaagatc cacttgataa tcacgacgat cacgacc 47
<210> 235
<211> 42
<212> ДНК
<213> Искусственная последовательность
<220>
<223> Праймер GlnPr2392
<400> 235
cttcggcgcc accgtggtcg tgatcgtcgt gattatcaag tg
<210> 236
<211> 42
<212> ДНК
<213> Искусственная последовательность
<220>
<223> Праймер GlnPr2393
<400> 236
caggaccggt gcttgcagaa gcacttgata atcacgacga tc 42
<210> 237
ДНК
<211> 40
<212> ДН
<213> Искусственная последовательность
<220>
<223> Праймер GlnPr2394
<400> 237
cttcggcgcc accgtgatcg tcgtgattat caagtgcttc 40
<210> 238
<211> 38
<212> ДНК
<213> Искусственная последовательность
<220>
<223> Праймер GlnPr2395
<400> 238
caggaccggt gcttgcagaa gcacttgata atcacgac 38
<210> 239
<211> 43
<212> ДНК
<213> Искусственная последовательность
<220>
<223> Праймер GlnPr2396
<400> 239
cttcggcgcc gtggtcattg taaccgtggt cgtgatcgtc gtg 43
<210> 240
<211> 50
<212> ДНК
<213> Искусственная последовательность
<220>
<223> Праймер GlnPr2397
<400> 240
caggaccggt gcttgcagaa gcacttgata atcacgacga tcacgaccac 50
<210> 241
<211> 49
<212> ДНК
<213> Искусственная последовательность
<220>
<223> Праймер GlnPr2398 <400> 241
cttcggcgcc gtggtcattg tagtcgtaac cgtggtcgtg atcgtcgtg 49
<210> 242
<211> 52
<212> ДНК
<213> Искусственная последовательность
<220>
<223> Праймер GlnPr2399
<400> 242
caggaccggt gcttgcagaa gcacttgata atcacgacga tcacgaccac gg 52
<210> 243
<211> 70
<212> ДНК
<213> Искусственная последовательность
<220>
<223> Праймер GlnPr2400 <400> 243
gagccaccag tgccagcaga gccagcacag gtcccaggat cagagccaga ttcttggagt 60 caggggggtc 70
<210> 244
<211> 65
<212> ДНК
<213> Искусственная последовательность
<220>
<223> > Seq Id No. 244 Праймер GlnPr2401 <400> 244
caggaccggt gcttgcagaa gcacttccac agtcccagca ctcccagagc caccagtgcc 60 agcag 65
<210> 245
<211> 70
<212> ДНК
<213> Искусственная последовательность
<220>
<223> Праймер GlnPr2402 <400> 245
cgatgcccag cagcaggagc aacaccagga tcacgatgat ggcggcgata ttcttggagt 60 caggggggtc 70
<212> ДНК
<213> Искусственная последовательность
<220>
<223> Праймер GlnPr2403 <400> 246
caggaccggt gcttgcagaa gcacttccag aaccaccaca tcaggccgat gcccagcagc 60 aggag 65
<210> 247
<211> 69
<212> ДНК
<213> Искусственная последовательность
<220>
<223> Праймер GlnPr2404 <400> 247
gataaacagc agcaggccag ccactccgcc cagcacaatc agggccatat tcttggagtc 60 aggggggtc 69
<210> 248
<211> 62
<212> ДНК
<213> Искусственная последовательность
<220>
<223> Праймер GlnPr2405
<400> 248
caggaccggt gcttgcagaa gcacttgaag aagatgccca ggccgataaa cagcagcagg 60 cc 62
<210> 249
<211> 70
<212> ДНК
<213> Искусственная последовательность
<220>
<223> Праймер GlnPr2406 <400> 249
gtccaatcag cacgatgcca gccaccacgc cggccacgat agggatgata ttcttggagt 60 caggggggtc 70
<210> 250
<211> 65
<212> ДНК
<213> Искусственная последовательность
<220>
<223> Праймер GlnPr2407
<210> 251
<211> 70
<212> ДНК
<213> Искусственная последовательность
<220>
<223> Праймер GlnPr2408 <400> 251
ccaggaagat gatcacgaac agcaggatgc cagcgatcac gccagcgata ttcttggagt 60 caggggggtc 70
<210> 252
<211> 62
<212> ДНК
<213> Искусственная последовательность
<220>
<223> Праймер GlnPr2409
<400> 252
caggaccggt gcttgcagaa gcacttcatc acgagcacca cgcccaggaa gatgatcacg 60 aa 62
<210> 253
<211> 70
<212> ДНК
<213> Искусственная последовательность
<220>
<223> Праймер GlnPr2410 <400> 253
gcaggatggc gaacaggatg ccgaagatga tggggatcac gaccagagca ttcttggagt 60 caggggggtc 70
<210> 254 <211> 63 <212> ДНК
<213> Искусственная последовательность
<220>
<223> Праймер GlnPr2411 <400> 254
caggaccggt gcttgcagaa gcacttgatg aacaccagca ccagcaggat ggcgaacagg 60 atg 63
<210> 255
<211> 65
<212> ДНК
<213> Искусственная последовательность
<220>
<223> Праймер GlnPr2412 <400> 255
cttcggcgcc gtgattaccg tggtcgtgat cgtcgtgatt atcaggtccc agcaggaggc 60 cgccg 65
<210> 256
<211> 51
<212> ДНК
<213> Искусственная последовательность
<220>
<223> Праймер GlnPr2413
<400> 256
gtcatttcga atcatcagaa gaacttcttg gcggcggcct cctgctggga c 51
<210> 257
<211> 51
<212> ДНК
<213> Искусственная последовательность
<220>
<223> Праймер GlnPr2414
<400> 257
gtcatttcga atcatcacca ccacttcttg gcggcggcct cctgctggga c 51
<210> 258
<211> 63
<212> ДНК
<213> Искусственная последовательность
<220>
<223> Праймер GlnPr2415
<400> 258
ggtcatttcg aatcatcagg agcccttcag ggtcaggaac atgataatca cgacgatcac 60 gac 63
<210> 259
<211> 39
<212> ДНК
<213> Искусственная последовательность
<220>
<223> Праймер GlnPr1285
<400> 259
cggaagaatt cagccacagc tttaaggcac ctggctaac 39
<210> 260
<211> 66
<212> ДНК
<213> Искусственная последовательность
ctggctaacc tctgcgcttc ttcccttccc tcctccctgg ctcaggtggt ggtggatctc 300
cccccgagga cccccctgac tccaagaatc tgtggacgac catcaccatc ttcatcacac 360
tcttcctgtt aagcgtgtgc tacagtgcca ccgtcacctt cttcaaggtg aagtggatct 420
tctcctcggt ggtggacctg aagcagacca tcatccccga ctacaggaac atgatcggac 480
agggggccta gtgattcgaa 500
<210> 264
<211> 545
<212> ДНК
<213> Искусственная последовательность
<220>
<223> GeneArt_Seq82 <400> 264
atcgatgctg aatgcaatta acaatgctca agcagaaccc ccggctccat cagcacagtg 60
caggaccaaa ccccatgctg cagcagtggg gctgtctgta cggggtgggc aatgggaacc 120
ggggtctgct ggggctcctg ctgcttcagt gctgccatgc agccacacat cctgagagct 180
gaaagggtcg gcgtcctcac ctggtgcaca ccgtagctct gccccacagc tttaaggcac 240
ctggctaacc tctgcgcttc ttcccttccc tcctccctgg ctcagagctg caaccggtgg 300
agagctgtgc ggaggcgcag gacggggagc tggacgggct gtggacgacc atcaccatct 360
tcatcacact cttcctgtta agcgtgtgct acagtgccac cgtcaccttc ttcaaggtga 420
agtgcttctg caagcaccgg tcctgcttcc ggcggaacga ggcctccaga gagacaaaca 480
actccctgac cttcggcccc gaggaagccc tggctgagca gaccgtgttt ctgtagtgat 540
tcgaa 545
<210> 265
<211> 423
<212> ДНК
<213> Искусственная последовательность
<220>
<223> GeneArt_Seq83 <400> 265
atcgatgctg aatgcaatta acaatgctca agcagaaccc ccggctccat cagcacagtg 60
caggaccaaa ccccatgctg cagcagtggg gctgtctgta cggggtgggc aatgggaacc 120
ggggtctgct ggggctcctg ctgcttcagt gctgccatgc agccacacat cctgagagct 180
gaaagggtcg gcgtcctcac ctggtgcaca ccgtagctct gccccacagc tttaaggcac 240
ctggctaacc tctgcgcttc ttcccttccc tcctccctgg ctcaggtggt ggtggatctc 300
ggt 423
<210> 266
<211> 423
<212> ДНК
<213> Искусственная последовательность
<220>
<223> GeneArt_Seq84 <400> 266
atcgatgctg aatgcaatta acaatgctca agcagaaccc ccggctccat cagcacagtg 60
caggaccaaa ccccatgctg cagcagtggg gctgtctgta cggggtgggc aatgggaacc 120
ggggtctgct ggggctcctg ctgcttcagt gctgccatgc agccacacat cctgagagct 180
gaaagggtcg gcgtcctcac ctggtgcaca ccgtagctct gccccacagc tttaaggcac 240
ctggctaacc tctgcgcttc ttcccttccc tcctccctgg ctcaggtggt ggtggatctc 300
cccccgagga cccccctgac tccaagaatg gaatcgtggc tggactggct gtgctggccg 360
tggtcgtgat tggagctgtg gtggccgccg tgatgtgcag aaagtgcttc tgcaagcacc 420
ggt 423
<210> 267
<211> 423
<212> ДНК
<213> Искусственная последовательность
<220>
<223> GeneArt_Seq85 <400> 267
atcgatgctg aatgcaatta acaatgctca agcagaaccc ccggctccat cagcacagtg 60
caggaccaaa ccccatgctg cagcagtggg gctgtctgta cggggtgggc aatgggaacc 120
ggggtctgct ggggctcctg ctgcttcagt gctgccatgc agccacacat cctgagagct 180
gaaagggtcg gcgtcctcac ctggtgcaca ccgtagctct gccccacagc tttaaggcac 240
ctggctaacc tctgcgcttc ttcccttccc tcctccctgg ctcaggtggt ggtggatctc 300
cccccgagga cccccctgac tccaagaatg gcctgctgat cggcatctcc atcgcctccc 360
tgtgcctggt ggtggccctg ctggccctgc tgtgccacct gaagtgcttc tgcaagcacc 420
ggt 423
<210> 268
<211> 423
<212> ДНК
<213> Искусственная последовательность
<210> 271
<211> 408
<212> ДНК
<213> Искусственная последовательность
<220>
<223> GeneArt_Seq89
<400> 271
atcgatgctg aatgcaatta acaatgctca agcagaaccc ccggctccat cagcacagtg 60
caggaccaaa ccccatgctg cagcagtggg gctgtctgta cggggtgggc aatgggaacc 120
ggggtctgct ggggctcctg ctgcttcagt gctgccatgc agccacacat cctgagagct 180
gaaagggtcg gcgtcctcac ctggtgcaca ccgtagctct gccccacagc tttaaggcac 240
ctggctaacc tctgcgcttc ttcccttccc tcctccctgg ctcaggtggt ggtggatctc 300
cccccgagga cccccctgac tccaagaatt tcttcatccc cctgctggtg gtgatcctgt 360
tcgccgtgga caccggcctg ttcatcaagt gcttctgcaa gcaccggt 408
<210> 272
<211> 408
<212> ДНК
<213> Искусственная последовательность
<220>
<223> GeneArt_Seq90 <400> 272
atcgatgctg aatgcaatta acaatgctca agcagaaccc ccggctccat cagcacagtg 60
caggaccaaa ccccatgctg cagcagtggg gctgtctgta cggggtgggc aatgggaacc 120
ggggtctgct ggggctcctg ctgcttcagt gctgccatgc agccacacat cctgagagct 180
gaaagggtcg gcgtcctcac ctggtgcaca ccgtagctct gccccacagc tttaaggcac 240
ctggctaacc tctgcgcttc ttcccttccc tcctccctgg ctcaggtggt ggtggatctc 300
cccccgagga cccccctgac tccaagaata tcctgatcgg cacctccgtg gtgatcatcc 360
tgttcatcct gctgttcttc ctgctgaagt gcttctgcaa gcaccggt 408
<210> 273
<211> 429
<212> ДНК
<213> Искусственная последовательность
<220>
<223> GeneArt_Seq91 <400> 273
atcgatgctg aatgcaatta acaatgctca agcagaaccc ccggctccat cagcacagtg 60 caggaccaaa ccccatgctg cagcagtggg gctgtctgta cggggtgggc aatgggaacc 120
ggggtctgct
ggggctcctg
ctgcttcagt
gctgccatgc
agccacacat
cctgagagct
180
gaaagggtcg
gcgtcctcac
ctggtgcaca
ccgtagctct
gccccacagc
tttaaggcac
240
ctggctaacc
tctgcgcttc
ttcccttccc
tcctccctgg
ctcaggtggt
ggtggatctc
300
cccccgagga
cccccctgac
tccaagaatg
tgatgtccgt
ggccaccatc
gtgatcgtgg
360
acatctgcat
caccggcggc
ctgctgctgc
tggtgtacta
ctggtccaag
tgcttctgca
420
agcaccggt
429
<210> 274 <211> 429 <212> ДНК
<213> Искусственная последовательность
<220>
<223> GeneArt_Seq92
<400> 274
atcgatgctg
aatgcaatta
acaatgctca
agcagaaccc
ccggctccat
cagcacagtg
caggaccaaa
ccccatgctg
cagcagtggg
gctgtctgta
cggggtgggc
aatgggaacc
120
ggggtctgct
ggggctcctg
ctgcttcagt
gctgccatgc
agccacacat
cctgagagct
180
gaaagggtcg
gcgtcctcac
ctggtgcaca
ccgtagctct
gccccacagc
tttaaggcac
240
ctggctaacc
tctgcgcttc
ttcccttccc
tcctccctgg
ctcaggtggt
ggtggatctc
300
cccccgagga
cccccctgac
tccaagaatg
ccatccccat
ctggtgggtg
ctggtgggcg
360
tgctgggcgg
cctgctgctg
ctgaccatcc
tggtgctggc
catgtggaag
tgcttctgca
420
agcaccggt
429
<210> 275
<211> 432 <212> ДНК
<213> Искусственная последовательность
<220>
<223> GeneArt_Seq93
<400> 275
atcgatgctg
aatgcaatta
acaatgctca
agcagaaccc
ccggctccat
cagcacagtg
caggaccaaa
ccccatgctg
cagcagtggg
gctgtctgta
cggggtgggc
aatgggaacc
120
ggggtctgct
ggggctcctg
ctgcttcagt
gctgccatgc
agccacacat
cctgagagct
180
gaaagggtcg
gcgtcctcac
ctggtgcaca
ccgtagctct
gccccacagc
tttaaggcac
240
ctggctaacc
tctgcgcttc
ttcccttccc
tcctccctgg
ctcaggtggt
ggtggatctc
300
cccccgagga
cccccctgac
tccaagaatt
tctgggtgct
ggtggtggtg
ggcggcgtgc
360
tggcctgcta
ctccctgctg
gtgaccgtgg
ccttcatcat
cttctgggtg
aagtgcttct
420
Л -> о
<210> 276
<211> 420
<212> ДНК
<213> Искусственная последовательность
<220>
<223> GeneArt_Seq94
<400> 276
atcgatgctg aatgcaatta acaatgctca agcagaaccc ccggctccat cagcacagtg 60
caggaccaaa ccccatgctg cagcagtggg gctgtctgta cggggtgggc aatgggaacc 120
ggggtctgct ggggctcctg ctgcttcagt gctgccatgc agccacacat cctgagagct 180
gaaagggtcg gcgtcctcac ctggtgcaca ccgtagctct gccccacagc tttaaggcac 240
ctggctaacc tctgcgcttc ttcccttccc tcctccctgg ctcaggtggt ggtggatctc 300
cccccgagga cccccctgac tccaagaata tcaccctgat catcttcggc gtgatggccg 360
gcgtgatcgg caccatcctg ctgatctcct acggcatcaa gtgcttctgc aagcaccggt 420
<210> 277
<211> 186
<212> ДНК
<213> Искусственная последовательность
<220>
<223> GeneArt_Seq95 <400> 277
ggcgccgtga ttaccgtggt cgtgatcgtc gtgattatca tgttcctgac cctgaagggc 60 tccctgaagc agaggctgca ggtgatgatc cagccctccg aggacatcgt gaggcccgag 120 aacggccccg agcagcccca ggccggctcc tccgcctcca aggaggccta catctgatga 180 ttcgaa 186
<210> 278
<211> 186
<212> ДНК
<213> Искусственная последовательность
<220>
<223> GeneArt_Seq96 <400> 278
ggcgccgtga ttaccgtggt cgtgatcgtc gtgattatct gcttcgtggg caacaggttc 60 cagcagaagc tgaggtccgt gttcagggtg cccatcacct ggctgcaggg caagagggag 120 accatgtcct gcaggaagtc ctcctccctg agggagatgg acaccttcgt gtcctgatga 180 ttcgaa 186
<212> ДНК
<213> Искусственная последовательность
<220>
<223> GeneArt_Seq97 <400> 279
ggcgccgtga ttaccgtggt cgtgatcgtc gtgattatct gcttcgtggg caacaggttc 60 cagcagaagc tgaggtccgt gttcagggtg cccatcacct ggctgcaggg caagagggag 120 accatgtcct gcaggaagtc ctcctccctg aggtgatgat tcgaa 165
<210> 280
<211> 300
<212> ДНК
<213> Искусственная последовательность
<220>
<223> GeneArt_Seq98 <400> 280
ggcgccgtga ttaccgtggt cgtgatcgtc gtgattatca actcccacct gctgcccagg 60 cccctgaggc acctggcctg ctgcggcggc ccccagccca ggatgaggag gaggctgtcc 120 gacggctccc tgtcctccag gcacaccacc ctgctgacca ggtcctcctg ccccgccacc 180 ctgtccctgt ccctgtccct gaccctgtcc ggcaggccca ggcccgagga gtcccccagg 240 gacctggagc tggccgacgg cgagggcacc gccgagacca tcatcttctg atgattcgaa 300
<210> 281
<211> 123
<212> ДНК
<213> Искусственная последовательность
<220>
<223> GeneArt_Seq99 <400> 281
ggcgccgtga ttaccgtggt cgtgatcgtc gtgattatca actcccacga ggagtccccc 60 agggacctgg agctggccga cggcgagggc accgccgaga ccatcatctt ctgatgattc 120 gaa 123
<210> 282
<211> 120
<212> ДНК
<213> Искусственная последовательность
<220>
<223> GeneArt_Seq100
<400> 282
ggcgccgtga ttaccgtggt cgtgatcgtc gtgattatct gcatcaagct gaagcacacc 60
<210> 283
<211> 120
<212> ДНК
<213> Искусственная последовательность
<220>
<223> GeneArt_Seq101
<400> 283
ggcgccgtga ttaccgtggt cgtgatcgtc gtgattatct gcatcaagct gaagcacacc 60 aagaagaggc agatcgccgc cgccgccgcc gccaacaggc tgggcaagtg atgattcgaa 120
<210> 284
<211> 1064
<212> ДНК
<213> Искусственная последовательность
<220>
<223> GSC11206
<400> 284
ctgtctccgg
gtaaatgatg
aaagcttggt
aggtgatcct
cctgctgctt
tggttcaggg
ttttgcttga
gggggggggg
tggtgatttc
cttgccatgg
gcagactgag
cagaaaaggc
120
cattgggacc
atgttctgaa
tgcctccacc
tcaaccaccg
gccggtagga
ccaaagccac
180
cccgtgtttt
ctcaggatct
cttttcccag
ggagatccct
cggcccaaag
agggagatgg
240
caatgctgga
tgtgtgcaca
ataattcaac
aggcattgga
acttcagcat
cgatgctgaa
300
tgcaattaac
aatgctcaag
cagaaccccc
ggctccatca
gcacagtgca
ggaccaaacc
360
ccatgctgca
gcagtggggc
tgtctgtacg
gggtgggcaa
tgggaaccgg
ggtctgctgg
420
ggctcctgct
gcttcagtgc
tgccatgcag
ccacacatcc
tgagagctga
aagggtcggc
480
gtcctcacct
ggtgcacacc
gtagctctgc
cccacagctt
taaggcacct
ggctaacctc
540
tgcgcttctt
cccttccctc
ctccctggct
cagagctgca
accggtggag
agctgtgcgg
600
aggcgcagga
cggggagctg
gacggggccc
tgtggctggg
cgtgctgaga
ctgctgctgt
660
tcaagctgct
cctgttcgac
ctgctcctca
agtggatctt
ctcctcggtg
gtggacctga
720
agcagaccat
catccccgac
tacaggaaca
tgatcggaca
gggggcctag
tgattcgaaa
780
tgaccgacca
agcgacgccc
aacctgccat
cacgagattt
cgattccacc
gccgccttct
840
atgaaaggtt
gggcttcgga
atcgttttcc
gggacgccgg
ctggatgatc
ctccagcgcg
900
gggatctcat
gctggagttc
ttcgcccacc
ccaacttgtt
tattgcagct
tataatggtt
960
acaaataaag
caatagcatc
acaaatttca
caaataaagc
atttttttca
ctgcattcta
1020
gttgtggttt
gtccaaactc
atcaatgtat
cttatcatgt
ctgt
1064
<210> 285
<211> 70
<212> Белок
<213> Искусственная последовательность
<220>
<223> GSC11206
<400> 285
Leu Ser Leu Ser Pro Glu Leu Gln Pro Val Glu Ser Cys Ala Glu Ala
1 5 10 15
Gln Asp Gly Glu Leu Asp Gly Ala Leu Trp Leu Gly Val Leu Arg Leu
20 25 30
Leu Leu Phe Lys Leu Leu Leu Phe Asp Leu Leu Leu Lys Trp Ile Phe
35 40 45
Ser Ser Val Val Asp Leu Lys Gln Thr Ile Ile Pro Asp Tyr Arg Asn
50 55 60
Met Ile Gly Gln Gly Ala
65 70
<210> 286
<211> 470
<212> Белок
<213> Искусственная последовательность
<220>
<223> GSC314
<400> 286
Met Glu Ser Pro Ala Gln Leu Leu Phe Leu Leu Leu Leu Trp Leu Pro
1 5 10 15
Asp Thr Gln Ala Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val
20 25 30
Gln Pro Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Asn
35 40 45
Ile Lys Asp Thr Tyr Ile His Trp Val Arg Gln Ala Pro Gly Lys Gly
50 55 60
Leu Glu Trp Val Ala Arg Ile Tyr Pro Thr Asn Gly Tyr Thr Arg Tyr
65 70 75 80
Ala Asp Ser Val Lys Gly Arg Phe Thr Ile Ser Ala Asp Thr Ser Lys
85 90 95
Asn Thr Ala Tyr Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala
100 105 110
Val Tyr Tyr Cys Ser Arg Trp Gly Gly Asp Gly Phe Tyr Ala Met Asp
115 120 125
Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys
130 135 140
Gly Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly
145 150 155 160
Gly Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro
165 170 175
Val Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr
180 185 190
Phe Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val
195 200 205
Val Thr Val Pro Ser Ser Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn
210 215 220
Val Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro
225 230 235 240
Lys Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu
245 250 255
Leu Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp
260 265 270
Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp
275 280 285
Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly
290 295 300
Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn
305 310 315 320
Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp
325 330 335
Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro
340 345 350
Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu
355 360 365
Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg Glu Glu Met Thr Lys Asn
370 375 380
Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile
385 390 395 400
Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr
405 410 415
Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys
420 425 430
Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys
435 440 445
Ser Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu
450 455 460
Ser Leu Ser Pro Gly Lys
465 470
<210> 287
<211> 375
<212> ДНК
<213> Искусственная последовательность
<220>
<223> GSC3836
<210> 288
<211> 5
<212> Белок
<213> Искусственная последовательность
<220>
<223> GSC3836 / GSC3848
<400> 288
Leu Ser Pro Gly Lys 1 5
<210> 289
<211> 884
<212> ДНК
<213> Искусственная последовательность
<220>
<223> GSC3848
<400> 289
ctgtctccgg
gtaaatgatg
aaagcttggt
aggtgatcct
cctgctgctt
tggttcaggg
ttttgcttga
gggggggggg
tggtgatttc
cttgccatgg
gcagactgag
cagaaaaggc
cattgggacc
atgttctgaa
tgcctccacc
tcaaccaccg
gccggtagga
ccaaagccac
cccgtgtttt
ctcaggatct
cttttcccag
ggagatccct
cggcccaaag
agggagatgg
caatgctgga
tgtgtgcaca
ataattcaac
aggcattgga
acttcagcat
cgatgctgaa
tgcaattaac
aatgctcaag
cagaaccccc
ggctccatca
gcacagtgca
ggaccaaacc
ccatgctgca
gcagtggggc
tgtctgtacg
gggtgggcaa
tgggaaccgg
ggtctgctgg
ggctcctgct
gcttcagtgc
tgccatgcag
ccacacatcc
tgagagctga
aagggtcggc
gtcctcacct
ggtgcacacc
gtagctctgc
cccacagctt
taaggcacct
ggctaacctc
tgcgcttctt
cccttccctc
ctccctggct
cagagctgca
accggtggag
atattcgaaa
tgaccgacca
agcgacgccc
aacctgccat
cacgagattt
cgattccacc
gccgccttct
atgaaaggtt
gggcttcgga
atcgttttcc
gggacgccgg
ctggatgatc
ctccagcgcg
gggatctcat
gctggagttc
ttcgcccacc
ccaacttgtt
tattgcagct
tataatggtt
acaaataaag
caatagcatc
acaaatttca
caaataaagc
atttttttca
ctgcattcta
gttgtggttt
gtccaaactc
atcaatgtat
cttatcatgt
ctgt
60 120 180 240 300 360 420 480 540 600 660 720 780 840 884
<210> 290
<211> 76
<212> Белок
<213> Искусственная последовательность
<220>
<223> GSC3899 / GSC4398 / GSC4401 / GSC4402
<400> 290
Leu Ser Leu Ser Pro Glu Leu Gln Pro Val Glu Ser Cys Ala Glu Ala
1 5 10 15
Gln Asp Gly Glu Leu Asp Gly Leu Trp Thr Thr Ile Thr Ile Phe Ile
20 25 30
Thr Leu Phe Leu Leu Ser Val Cys Tyr Ser Ala Thr Val Thr Phe Phe
35 40 45
Lys Val Lys Trp Ile Phe Ser Ser Val Val Asp Leu Lys Gln Thr Ile
50 55 60
Ile Pro Asp Tyr Arg Asn Met Ile Gly Gln Gly Ala
65 70 75
<210> 291
<211> 42
<212> Белок
<213> Искусственная последовательность
<220>
<223> GSC5854 / GSC5855 / GSC5857 / GSC5856
<400> 291
Leu Ser Leu Ser Pro Ala Glu Leu Gln Pro Val Glu Ala Leu Trp Leu
1 5 10 15
Gly Val Leu Arg Leu Leu Leu Phe Lys Leu Leu Leu Phe Asp Leu Leu
20 25 30
Leu Ala Ser Ala His His His His His His
35 40
<210> 292
<211> 74
<212> Белок
<213> Искусственная последовательность
<220>
<223> GSC6030 / GSC6048 / GSC6047 / GSC6046
<400> 292
Leu Ser Leu Ser Pro Glu Leu Gln Pro Val Glu Ser Cys Ala Glu Ala
1 5 10 15
Gln Asp Gly Glu Leu Asp Ala Leu Trp Leu Gly Val Leu Arg Leu Leu
20 25 30
Leu Phe Lys Leu Leu Leu Phe Asp Leu Leu Leu Thr Phe Phe Lys Val
35 40 45
Lys Trp Ile Phe Ser Ser Val Val Asp Leu Lys Gln Thr Ile Ile Pro
50 55 60
Asp Tyr Arg Asn Met Ile Gly Gln Gly Ala 65 70
<210> 293
<211> 78
<212> Белок
<213> Искусственная последовательность
<223> GSC7057 / GSC7058 / GSC7056 / GSC7059 / GSC9763 / GSC9764 /
GSC9765 / GSC9768 / GSC9770 / GSC9949 / GSC9950
<400> 293
Leu Ser Pro Gly Gly Gly Gly Ser Pro Pro Glu Asp Pro Pro Asp Ser
1 5 10 15
Lys Asn Thr Leu Val Leu Phe Gly Ala Gly Phe Gly Ala Val Ile Thr
20 25 30
Val Val Val Ile Val Val Ile Ile Lys Cys Phe Cys Lys His Arg Ser
35 40 45
Cys Phe Arg Arg Asn Glu Ala Ser Arg Glu Thr Asn Asn Ser Leu Thr
50 55 60
Phe Gly Pro Glu Glu Ala Leu Ala Glu Gln Thr Val Phe Leu
65 70 75
<210> 294
<211> 708
<212> ДНК
<213> Искусственная последовательность
<220>
<210> 295 <211> 235
<212> Белок
<223> GSC315
<213> Искусственная последовательность
<220>
<223> GSC315
<400> 295
Met Glu Ser Pro Ala Gln Leu Leu Phe Leu Leu Leu Leu Trp Leu Pro
1 5 10 15
Asp Gly Val His Ala Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu
20 25 30
Ser Ala Ser Val Gly Asp Arg Val Thr Ile Thr Cys Arg Ala Ser Gln
35 40 45
Asp Val Asn Thr Ala Val Ala Trp Tyr Gln Gln Lys Pro Gly Lys Ala
50 55 60
Pro Lys Leu Leu Ile Tyr Ser Ala Ser Phe Leu Tyr Ser Gly Val Pro
65 70 75 80
Ser Arg Phe Ser Gly Ser Arg Ser Gly Thr Asp Phe Thr Leu Thr Ile
85 90 95
Ser Ser Leu Gln Pro Glu Asp Phe Ala Thr Tyr Tyr Cys Gln Gln His
100 105 110
Tyr Thr Thr Pro Pro Thr Phe Gly Gln Gly Thr Lys Val Glu Ile Lys
115 120 125
Arg Thr Val Ala Ala Pro Ser Val Phe Ile Phe Pro Pro Ser Asp Glu
130 135 140
Gln Leu Lys Ser Gly Thr Ala Ser Val Val Cys Leu Leu Asn Asn Phe
145 150 155 160
Tyr Pro Arg Glu Ala Lys Val Gln Trp Lys Val Asp Asn Ala Leu Gln
165 170 175
Ser Gly Asn Ser Gln Glu Ser Val Thr Glu Gln Asp Ser Lys Asp Ser
180 185 190
Thr Tyr Ser Leu Ser Ser Thr Leu Thr Leu Ser Lys Ala Asp Tyr Glu
195 200 205
Lys His Lys Val Tyr Ala Cys Glu Val Thr His Gln Gly Leu Ser Ser
210 215 220
Pro Val Thr Lys Ser Phe Asn Arg Gly Glu Cys
<210> 296 <211> 1428
<212> ДНК
<213> Искусственная последовательность
<220>
<223> GSC5607 <400> 296
atgcggagcc ctgcccagct gctgttcctg ctgctgctgt ggatccctgg caccaacgcc 60
caggtgcagc tgcagcagtc tggcgccgaa ctggccagac caggcgccag cgtgaagatg 120
agctgcaagg ccagcggcta caccttcacc cggtacacca tgcactgggt gaaacagcgg 180
cctggacagg gcctggaatg gatcggctac atcaacccca gccggggcta caccaactac 240
aaccagaagt tcaaggacaa ggccaccctg accaccgaca agagcagcag caccgcctac 300
atgcagctga gcagcctgac cagcgaggac agcgccgtgt actactgcgc ccggtactac 360
gacgaccact actgcctgga ctactggggc cagggcacca ccctgaccgt gagcagcgcg 420
tcgaccaagg gccccagcgt gttcccgcta gcccccagca gcaagagcac cagcggcggc 480
acagccgccc tgggctgcct ggtgaaggac tacttccccg agcccgttac cgtgtcctgg 540
aactctggag ccctgacctc cggcgtgcac accttccccg ccgtgctcca gagcagcggc 600
ctgtacagcc tgagcagcgt ggtgacagtg cccagcagca gcctgggaac ccagacctac 660
atctgcaacg tgaaccacaa gcccagcaac accaaggtgg acaagaaggt ggagcccaag 720
agctgcgaca aaactcacac ctgcccaccc tgccctgccc ctgagctgct gggcggaccc 780
tccgtgttcc tgttcccccc caagcccaag gacaccctga tgatcagccg gacccccgag 840
gtgacctgcg tggtggtgga cgtgagccac gaggaccctg aggtgaagtt caattggtac 900
gtggacggcg tggaggtgca caacgccaag accaagcccc gggaggaaca gtacaacagc 960
acctaccggg tggtgtccgt gctgaccgtg ctgcaccagg actggctgaa cggcaaggaa 1020
tacaagtgca aggtctccaa caaggccctg cctgccccca tcgaaaagac catcagcaag 1080
gccaagggcc agccgcgcga accgcaggtg tacaccctgc cccccagccg ggaagagatg 1140
accaagaacc aggtgaaact ggtgtgcctg gtgacaggct tctaccccag cgatatcgcc 1200
gtggaatggg agagcagcgg ccagcctgag aacaactact acaccacccc ccccatgctg 1260
gacagcgacg gcagcttcag cctggtgtcc tggctgaacg tggacaagag ccggtggcag 1320
cagggcaaca tcttcagctg cagcgtgatg cacgaggccc tgcacaaccg gttcacccag 1380
aagtccctga gcctgagccc gggtaaacat caccatcacc atcactga 1428
<210> 297 <211> 475
<212> Белок
<213> Искусственная последовательность
<220>
<223> GSC5607
<400> 297
Met Arg Ser Pro Ala Gln Leu Leu Phe Leu Leu Leu Leu Trp Ile Pro
1 5 10 15
Gly Thr Asn Ala Gln Val Gln Leu Gln Gln Ser Gly Ala Glu Leu Ala
20 25 30
Arg Pro Gly Ala Ser Val Lys Met Ser Cys Lys Ala Ser Gly Tyr Thr
35 40 45
Phe Thr Arg Tyr Thr Met His Trp Val Lys Gln Arg Pro Gly Gln Gly
50 55 60
Leu Glu Trp Ile Gly Tyr Ile Asn Pro Ser Arg Gly Tyr Thr Asn Tyr
65 70 75 80
Asn Gln Lys Phe Lys Asp Lys Ala Thr Leu Thr Thr Asp Lys Ser Ser
85 90 95
Ser Thr Ala Tyr Met Gln Leu Ser Ser Leu Thr Ser Glu Asp Ser Ala
100 105 110
Val Tyr Tyr Cys Ala Arg Tyr Tyr Asp Asp His Tyr Cys Leu Asp Tyr
115 120 125
Trp Gly Gln Gly Thr Thr Leu Thr Val Ser Ser Ala Ser Thr Lys Gly
130 135 140
Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly
145 150 155 160
Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val
165 170 175
Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe
180 185 190
Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val
195 200 205
Thr Val Pro Ser Ser Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val
210 215 220
Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys
Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu
245 250 255
Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr
260 265 270
Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val
275 280 285
Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val
290 295 300
Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser
305 310 315 320
Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu
325 330 335
Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala
340 345 350
Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro
355 360 365
Gln Val Tyr Thr Leu Pro Pro Ser Arg Glu Glu Met Thr Lys Asn Gln
370 375 380
Val Lys Leu Val Cys Leu Val Thr Gly Phe Tyr Pro Ser Asp Ile Ala
385 390 395 400
Val Glu Trp Glu Ser Ser Gly Gln Pro Glu Asn Asn Tyr Tyr Thr Thr
405 410 415
Pro Pro Met Leu Asp Ser Asp Gly Ser Phe Ser Leu Val Ser Trp Leu
420 425 430
Asn Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Ile Phe Ser Cys Ser
435 440 445
Val Met His Glu Ala Leu His Asn Arg Phe Thr Gln Lys Ser Leu Ser
450 455 460
Leu Ser Pro Gly Lys His His His His His His
465 470 475
<210> 298
<211> 469
<212> Белок
<213> Искусственная последовательность
<220>
<223> GSC5644
<400> 298
Met Arg Ser Pro Ala Gln Leu Leu Phe Leu Leu Leu Leu Trp Ile Pro
1 5 10 15
Gly Thr Asn Ala Gln Val Gln Leu Gln Gln Ser Gly Ala Glu Leu Ala
20 25 30
Arg Pro Gly Ala Ser Val Lys Met Ser Cys Lys Ala Ser Gly Tyr Thr
35 40 45
Phe Thr Arg Tyr Thr Met His Trp Val Lys Gln Arg Pro Gly Gln Gly
50 55 60
Leu Glu Trp Ile Gly Tyr Ile Asn Pro Ser Arg Gly Tyr Thr Asn Tyr
65 70 75 80
Asn Gln Lys Phe Lys Asp Lys Ala Thr Leu Thr Thr Asp Lys Ser Ser
85 90 95
Ser Thr Ala Tyr Met Gln Leu Ser Ser Leu Thr Ser Glu Asp Ser Ala
100 105 110
Val Tyr Tyr Cys Ala Arg Tyr Tyr Asp Asp His Tyr Cys Leu Asp Tyr
115 120 125
Trp Gly Gln Gly Thr Thr Leu Thr Val Ser Ser Ala Ser Thr Lys Gly
130 135 140
Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly
145 150 155 160
Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val
165 170 175
Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe
180 185 190
Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val
195 200 205
Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys
225 230 235 240
Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu
245 250 255
Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr
260 265 270
Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val
275 280 285
Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val
290 295 300
Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser
305 310 315 320
Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu
325 330 335
Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala
340 345 350
Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro
355 360 365
Gln Val Tyr Thr Leu Pro Pro Ser Arg Glu Glu Met Thr Lys Asn Gln
370 375 380
Val Lys Leu Val Cys Leu Val Thr Gly Phe Tyr Pro Ser Asp Ile Ala
385 390 395 400
Val Glu Trp Glu Ser Ser Gly Gln Pro Glu Asn Asn Tyr Tyr Thr Thr
405 410 415
Pro Pro Met Leu Asp Ser Asp Gly Ser Phe Ser Leu Val Ser Trp Leu
420 425 430
Asn Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Ile Phe Ser Cys Ser
435 440 445
Val Met His Glu Ala Leu His Asn Arg Phe Thr Gln Lys Ser Leu Ser
450 455 460
<210> 299
<211> 76
<212> Белок
<213> Искусственная последовательность
<220>
<223> GSC5537
<400> 299
Leu Ser Leu Ser Pro Glu Leu Gln Pro Val Glu Ser Cys Ala Glu Ala
1 5 10 15
Gln Asp Gly Glu Leu Asp Gly Leu Trp Thr Thr Ile Thr Ile Phe Ile
20 25 30
Thr Leu Phe Leu Leu Ser Val Cys Tyr Ser Ala Thr Val Thr Phe Phe
35 40 45
Lys Val Lys Trp Ile Phe Ser Ser Val Val Asp Leu Lys Gln Thr Ile
50 55 60
Ile Pro Asp Tyr Arg Asn Met Ile Gly Gln Gly Ala
65 70 75
<210> 300
<211> 495
<212> Белок
<213> Искусственная последовательность
<220>
<223> GSC5608
<400> 300
Met Arg Ser Pro Ala Gln Leu Leu Phe Leu Leu Leu Leu Trp Ile Pro
1 5 10 15
Gly Thr Asn Ala Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val
20 25 30
Gln Pro Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Asn
35 40 45
Ile Lys Asp Thr Tyr Ile His Trp Val Arg Gln Ala Pro Gly Lys Gly
50 55 60
Leu Glu Trp Val Ala Arg Ile Tyr Pro Thr Asn Gly Tyr Thr Arg Tyr
65 70 75 80
Ala Asp Ser Val Lys Gly Arg Phe Thr Ile Ser Ala Asp Thr Ser Lys
85 90 95
Asn Thr Ala Tyr Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala
100 105 110
Val Tyr Tyr Cys Ser Arg Trp Gly Gly Asp Gly Phe Tyr Ala Met Asp
115 120 125
Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser Gly Gly Gly Gly
130 135 140
Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Asp Ile Gln Met Thr
145 150 155 160
Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly Asp Arg Val Thr Ile
165 170 175
Thr Cys Arg Ala Ser Gln Asp Val Asn Thr Ala Val Ala Trp Tyr Gln
180 185 190
Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile Tyr Ser Ala Ser Phe
195 200 205
Leu Tyr Ser Gly Val Pro Ser Arg Phe Ser Gly Ser Arg Ser Gly Thr
210 215 220
Asp Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro Glu Asp Phe Ala Thr
225 230 235 240
Tyr Tyr Cys Gln Gln His Tyr Thr Thr Pro Pro Thr Phe Gly Gln Gly
245 250 255
Thr Lys Val Glu Ile Lys Arg Gly Gly Gly Gly Thr Asp Lys Thr His
260 265 270
Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro Ser Val
275 280 285
Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg Thr
290 295 300
Pro Glu Val Thr Cys Val Val Val Asp Val Ser His Glu Asp Pro Glu
305 310 315 320
Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn Ala Lys
325 330 335
Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser
340 345 350
Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys
355 360 365
Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr Ile
370 375 380
Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Glu Val Ala Thr Phe Pro
385 390 395 400
Pro Ser Arg Asp Glu Leu Thr Lys Asn Gln Val Thr Leu Val Cys Leu
405 410 415
Val Thr Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn
420 425 430
Gly Gln Pro Glu Asn Asn Tyr Lys Thr Asp Pro Pro Leu Leu Glu Ser
435 440 445
Asp Gly Ser Phe Ala Leu Ser Ser Arg Leu Arg Val Asp Lys Ser Arg
450 455 460
Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met His Glu Ala Leu
465 470 475 480
His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys
485 490 495
Белок
<213> Искусственная последовательность
<220>
<223> GSC5538 <400> 301
Leu Ser Leu Ser Pro Glu Leu Gln Pro Val Glu Ser Cys Ala Glu Ala
1 5 10 15
Gln Asp Gly Glu Leu Asp Gly Leu Trp Thr Thr Ile Thr Ile Phe Ile
20 25 30
Thr Leu Phe Leu Leu Ser Val Cys Tyr Ser Ala Thr Val Thr Phe Phe
35 40 45
Lys Val Lys Trp Ile Phe Ser Ser Val Val Asp Leu Lys Gln Thr Ile
50 55 60
Ile Pro Asp Tyr Arg Asn Met Ile Gly Gln Gly Ala
<210> 302
<211> 702
<212> ДНК
<213> Искусственная последовательность
<220>
<223> GSC5540
<400> 302
atgcggagcc
ctgcccagct
gctgttcctg
ctgctgctgt
ggatccctgg
caccaacgcc
cagattgtgc
tgacccagag
ccccgccatc
atgtctgcca
gccctggcga
gaaagtgacc
atgacctgca
gcgccagcag
cagcgtgtcc
tacatgaact
ggtatcagca
gaagtccggc
accagcccca
agcggtggat
ctacgacacc
agcaagctgg
cctccggcgt
gcccgcccac
tttagaggca
gcggcagcgg
cacctcctac
tccctgacca
tcagcggcat
ggaagccgag
gacgccgcca
cctactactg
ccagcagtgg
tccagcaacc
ccttcacctt
cggctccggc
accaaactgg
aaattaaccg
tacggtggcc
gctcccagcg
tgttcatctt
cccccccagc
gacgagcagc
tgaagagcgg
caccgcctcc
gtggtgtgcc
tgctgaacaa
cttctacccc
cgggaggcca
aggtgcagtg
gaaggtggac
aacgccctcc
agagcggcaa
cagccaggaa
agcgtcaccg
agcaggacag
caaggactcc
acctacagcc
tgagcagcac
cctgaccctg
agcaaggccg
actacgagaa
gcacaaggtg
tacgcctgcg
aggtgaccca
ccagggcctg
tccagccccg
tgaccaagag
cttcaaccgg
ggcgagtgct
60 120
180
240 300 360 420 480 540 600 660 702
<210> 303
<211> 233
<212> Белок
<213> Искусственная последовательность
<220>
<223> GSC5540
<400> 303
Met Arg Ser Pro Ala Gln Leu Leu Phe Leu Leu Leu Leu Trp Ile Pro
1 5 10 15
Gly Thr Asn Ala Gln Ile Val Leu Thr Gln Ser Pro Ala Ile Met Ser
20 25 30
Ala Ser Pro Gly Glu Lys Val Thr Met Thr Cys Ser Ala Ser Ser Ser
35 40 45
Val Ser Tyr Met Asn Trp Tyr Gln Gln Lys Ser Gly Thr Ser Pro Lys
50 55 60
Arg Trp Ile Tyr Asp Thr Ser Lys Leu Ala Ser
Gly Val Pro Ala His
Phe Arg Gly Ser Gly Ser Gly Thr Ser Tyr Ser Leu Thr Ile Ser Gly
85 90 95
Met Glu Ala Glu Asp Ala Ala Thr Tyr Tyr Cys Gln Gln Trp Ser Ser
100 105 110
Asn Pro Phe Thr Phe Gly Ser Gly Thr Lys Leu Glu Ile Asn Arg Thr
115 120 125
Val Ala Ala Pro Ser Val Phe Ile Phe Pro Pro Ser Asp Glu Gln Leu
130 135 140
Lys Ser Gly Thr Ala Ser Val Val Cys Leu Leu Asn Asn Phe Tyr Pro
145 150 155 160
Arg Glu Ala Lys Val Gln Trp Lys Val Asp Asn Ala Leu Gln Ser Gly
165 170 175
Asn Ser Gln Glu Ser Val Thr Glu Gln Asp Ser Lys Asp Ser Thr Tyr
180 185 190
Ser Leu Ser Ser Thr Leu Thr Leu Ser Lys Ala Asp Tyr Glu Lys His
195 200 205
Lys Val Tyr Ala Cys Glu Val Thr His Gln Gly Leu Ser Ser Pro Val
210 215 220
Thr Lys Ser Phe Asn Arg Gly Glu Cys 225 230
ДНК
<210> 304 <211> 1522 <212> ДНК
<213> Искусственная последовательность
<220>
<223> GSC281
agggactttc
caatgggttt
tgcccagtac
ataaggtcaa
taggggtgaa
tcaacaggaa
420
agtcccattg
gagccaagta
cactgagtca
atagggactt
tccattgggt
tttgcccagt
480
acaaaaggtc
aatagggggt
gagtcaatgg
gtttttccca
ttattggcac
gtacataagg
540
tcaatagggg
tgagtcattg
ggtttttcca
gccaatttaa
ttaaaacgcc
atgtactttc
600
ccaccattga
cgtcaatggg
ctattgaaac
taatgcaacg
tgacctttaa
acggtacttt
660
cccatagctg
attaatggga
aagtaccgtt
ctcgagccaa
tacacgtcaa
tgggaagtga
720
aagggcagcc
aaaacgtaac
accgccccgg
ttttccctgg
aaattccata
ttggcacgca
780
ttctattggc
tgagctgcgt
tcacgtgggt
ataagcagag
ctcgtttagt
gaaccgtcag
840
atcgcctgga
gacgccatcc
acgctgtttt
gacctccata
gaagacaccg
ggaccgatcc
900
agcctccgcg
gccgggaacg
gtgcattgga
acgcggattc
cccgtgccaa
gagtgacgta
960
agtaccgcct
atagagtcta
taggcccacc
cccttggctt
cttatgcgac
ggatcccgta
1020
ctatgaggtg
tggcaggctt
gagatctggc
catacacttg
agtgacaatg
acatccactt
1080
tgcctttctc
tccacaggtg
tccactccca
cgtccaactg
cagctcggtt
cgatcgataa
1140
ttaattaagc
tagcggcgcc
gttaacaccg
gttgatcaaa
gcttgcggcc
gcgcttagcg
1200
atatcgaatt
ctctagaggt
acccccgggg
ggcccctcga
gttcgaaatg
accgaccaag
1260
cgacgcccaa
cctgccatca
cgagatttcg
attccaccgc
cgccttctat
gaaaggttgg
1320
gcttcggaat
cgttttccgg
gacgccggct
ggatgatcct
ccagcgcggg
gatctcatgc
1380
tggagttctt
cgcccacccc
aacttgttta
ttgcagctta
taatggttac
aaataaagca
1440
atagcatcac
aaatttcaca
aataaagcat
ttttttcact
gcattctagt
tgtggtttgt
1500
ccaaactcat
caatgtatct
1522
<210> 305
<211> 132
<212> ДНК
<213> Искусственная последовательность
<220>
<223> GSC3469 <400> 305
aacttgttta ttgcagctta taatggttac aaataaagca atagcatcac aaatttcaca 60 aataaagcat ttttttcact gcattctagt tgtggtttgt ccaaactcat caatgtatct 120 tatcatgtct gt 132
<210> 306
<211> 470
<212> ДНК
<213> Искусственная последовательность
<400> 306
cgaaatgacc
gaccaagcga
cgcccaacct
gccatcacga
gatttcgatt
ccaccgccgc
cttctatgaa
aggttgggct
tcggaatcgt
tttccgggac
gccggctgga
tgatcctcca
120
gcgcggggat
ctcatgctgg
agttcttcgc
ccaccccaac
ttgtttattg
cagcttataa
180
tggttacaaa
taaagcaata
gcatcacaaa
tttcacaaat
aaagcatttt
tttcactgca
240
ttctagttgt
ggtttgtcca
aactcatcaa
tgtatcttat
catgtctgta
taccgtcgac
300
ctctagctag
agcttggcgt
aatcatggtc
atagctgttt
cctgtgtgaa
attgttatcc
360
gctcacaatt
ccacacaaca
tacgagccgg
ggcaggataa
tatatggtag
ggttcatagc
420
cagagtaacc
ttttttttta
atttttattt
tattttattt
ttgagatcag
470
<210> 307
<211> 528
<212> ДНК
<213> Искусственная последовательность
<220>
<223> GSC4340
<400> 307
ggtaggtgat
cctcctgctg
ctttggttca
gggttttgct
tgaggggggg
gggtggtgat
ttccttgcca
tgggcagact
gagcagaaaa
ggccattggg
accatgttct
gaatgcctcc
120
acctcaacca
ccggccggta
ggaccaaagc
caccccgtgt
tttctcagga
tctcttttcc
180
cagggagatc
cctcggccca
aagagggaga
tggcaatgct
ggatgtgtgc
acaataattc
240
aacaggcatt
ggaacttcag
catcgatgct
gaatgcaatt
aacaatgctc
aagcagaacc
300
cccggctcca
tcagcacagt
gcaggaccaa
accccatgct
gcagcagtgg
ggctgtctgt
360
acggggtggg
caatgggaac
cggggtctgc
tggggctcct
gctgcttcag
tgctgccatg
420
cagccacaca
tcctgagagc
tgaaagggtc
ggcgtcctca
cctggtgcac
accgtagctc
480
tgccccacag
ctttaaggca
cctggctaac
cgagacctga
ggggacag
528
<210> 308 <211> 528 <212> ДНК
<213> Искусственная последовательность
<220>
<223> GSC4222
<400> 308
ggtaggtgat
cctcctgctg
ctttggttca
gggttttgct
tgaggggggg
gggtggtgat
ttccttgcca
tgggcagact
gagcagaaaa
ggccattggg
accatgttct
gaatgcctcc
120
acctcaacca
ccggccggta
ggaccaaagc
caccccgtgt
tttctcagga
tctcttttcc
180
cagggagatc
cctcggccca
aagagggaga
tggcaatgct
ggatgtgtgc
acaataattc
240
aacaggcatt
ggaacttcag
catcgatgct
gaatgcaatt
aacaatgctc
aagcagaacc
300
cccggctcca
tcagcacagt
gcaggaccaa
accccatgct
gcagcagtgg
ggctgtctgt
360
acggggtggg
caatgggaac
cggggtctgc
tggggctcct
gctgcttcag
tgctgccatg
420
cagccacaca
tcctgagagc
tgaaagggtc
ggcgtcctca
cctggtgcac
accgtagctc
480
tgccccacag
ctttaaggca
cctggctaac
cctgtcctta
ttgcacag
528
<210> 309 <211> 528 <212> ДНК
<213> Искусственная последовательность
<220>
<223> GSC2617
<400> 309
ggtaggtgat
cctcctgctg
ctttggttca
gggttttgct
tgaggggggg
gggtggtgat
ttccttgcca
tgggcagact
gagcagaaaa
ggccattggg
accatgttct
gaatgcctcc
120
acctcaacca
ccggccggta
ggaccaaagc
caccccgtgt
tttctcagga
tctcttttcc
180
cagggagatc
cctcggccca
aagagggaga
tggcaatgct
ggatgtgtgc
acaataattc
240
aacaggcatt
ggaacttcag
catcgatgct
gaatgcaatt
aacaatgctc
aagcagaacc
300
cccggctcca
tcagcacagt
gcaggaccaa
accccatgct
gcagcagtgg
ggctgtctgt
360
acggggtggg
caatgggaac
cggggtctgc
tggggctcct
gctgcttcag
tgctgccatg
420
cagccacaca
tcctgagagc
tgaaagggtc
ggcgtcctca
cctggtgcac
accgtagctc
480
tgccccacag
ctttaaggca
cctggctaac
cctgggagga
ttgcacag
528
<210> 310 <211> 528 <212> ДНК
<213> Искусственная последовательность
<220>
<223> GSC4335
<400> 310
ggtaggtgat
cctcctgctg
ctttggttca
gggttttgct
tgaggggggg
gggtggtgat
ttccttgcca
tgggcagact
gagcagaaaa
ggccattggg
accatgttct
gaatgcctcc
120
acctcaacca
ccggccggta
ggaccaaagc
caccccgtgt
tttctcagga
tctcttttcc
180
cagggagatc
cctcggccca
aagagggaga
tggcaatgct
ggatgtgtgc
acaataattc
240
aacaggcatt
ggaacttcag
catcgatgct
gaatgcaatt
aacaatgctc
aagcagaacc
300
cccggctcca
tcagcacagt
gcaggaccaa
accccatgct
gcagcagtgg
ggctgtctgt
360
acggggtggg
caatgggaac
cggggtctgc
tggggctcct
gctgcttcag
tgctgccatg
420
cagccacaca
tcctgagagc
tgaaagggtc
ggcgtcctca
cctggtgcac
accgtagctc
480
tgccccacag ctttaaggca cctggctaac cgtctccttc tgggacag
528
<210> 311
<211> 546
<212> ДНК
<213> Искусственная последовательность
<220>
<223> GSC2332 <400> 311
ggtaggtgat cctcctgctg ctttggttca gggttttgct tgaggggggg gggtggtgat 60
ttccttgcca tgggcagact gagcagaaaa ggccattggg accatgttct gaatgcctcc 120
acctcaacca ccggccggta ggaccaaagc caccccgtgt tttctcagga tctcttttcc 180
cagggagatc cctcggccca aagagggaga tggcaatgct ggatgtgtgc acaataattc 240
aacaggcatt ggaacttcag catcgatgct gaatgcaatt aacaatgctc aagcagaacc 300
cccggctcca tcagcacagt gcaggaccaa accccatgct gcagcagtgg ggctgtctgt 360
acggggtggg caatgggaac cggggtctgc tggggctcct gctgcttcag tgctgccatg 420
cagccacaca tcctgagagc tgaaagggtc ggcgtcctca cctggtgcac accgtagctc 480
tgccccacag ctttaaggca cctggctaac ctctgcgctt cttcccttcc ctgctacctg 540
gctcag 546
<210> 312
<211> 36
<212> ДНК
<213> Искусственная последовательность
<220>
<223> Праймер GlnPr2160
<400> 312
ccaagctttc atcatttgcc cggagacagg gagagg 36
<210> 313
<211> 42
<212> ДНК
<213> Искусственная последовательность
<220>
<223> Праймер GlnPr2161
<400> 313
ccaagctttc atcatttacc gggagacagg gagaggctct tc 42
<210> 314
<211> 49
<212> ДНК
<213> Искусственная последовательность
<400> 314
gtcctcgggg ggagatccac caccacctgt cccagaagga gacggttag
<210> 315
<211> 49
<212> ДНК
<213> Искусственная последовательность
<220>
<223> Праймер GlnPr2163
<400> 315
gtcctcgggg ggagatccac caccacctgt gcaatcctcc cagggttag 49
<210> 316
<211> 49
<212> ДНК
<213> Искусственная последовательность
<220>
<223> Праймер GlnPr2164
<400> 316
gtcctcgggg ggagatccac caccacctgt gcaataagga cagggttag 49
<210> 317
<211> 49
<212> ДНК
<213> Искусственная последовательность
<220>
<223> Праймер GlnPr2165
<400> 317
gtcctcgggg ggagatccac caccacctgt cccctcaggt ctcggttag 49
<210> 318
<211> 49
<212> ДНК
<213> Искусственная последовательность
<220>
<223> Праймер GlnPr2166
<400> 318
gtcctcgggg ggagatccac caccacctga gccaggtagc agggaaggg 49
<210> 319
<211> 705
<212> ДНК
<213> Искусственная последовательность
<220>
<223> Конструкция GSC3704
<400> 319
atggaaagcc cagcccagct gctgttcctg ctgctgctgt ggctgcccga cggggtgcac
gctgagatcg
tgctgacaca
gagccccgcc
accctgtctc
tgagccctgg
cgaaagagcc
120
accctgagct
gtagagccag
cagcagcgtg
tcctacatgc
actggtatca
gcagaagccc
180
ggccaggcgc
cgcgcccgtg
gatttatgcg
accagcaatc
gggccacagg
catccctgcc
240
agattttctg
gcagcggctc
cggcaccgac
tacaccctga
ccatctccag
cctggaaccc
300
gaggacttcg
ccgtgtacta
ctgccagcag
tggtccagca
acccctggac
atttggccag
360
ggcaccaaag
tggaaattaa
acgtacggtg
gccgctccca
gcgtgttcat
cttccccccc
420
agcgacgagc
agctgaagag
cggcaccgcc
tccgtggtgt
gcctgctgaa
caacttctac
480
ccccgggagg
ccaaggtgca
gtggaaggtg
gacaacgccc
tccagagcgg
caacagccag
540
gaaagcgtca
ccgagcagga
cagcaaggac
tccacctaca
gcctgagcag
caccctgacc
600
ctgagcaagg
ccgactacga
gaagcacaag
gtgtacgcct
gcgaggtgac
ccaccagggc
660
ctgtccagcc
ccgtgaccaa
gagcttcaac
cggggcgagt
gctga
705
<210> 320
<211> 234
<212> Белок
<213> Искусственная последовательность
<220>
<223> Конструкция GSC3704
<400> 320
Met Glu Ser Pro Ala Gln Leu Leu Phe Leu Leu Leu Leu Trp Leu Pro
1 5 10 15
Asp Gly Val His Ala Glu Ile Val Leu Thr Gln Ser Pro Ala Thr Leu
20 25 30
Ser Leu Ser Pro Gly Glu Arg Ala Thr Leu Ser Cys Arg Ala Ser Ser
35 40 45
Ser Val Ser Tyr Met His Trp Tyr Gln Gln Lys Pro Gly Gln Ala Pro
50 55 60
Arg Pro Trp Ile Tyr Ala Thr Ser Asn Arg Ala Thr Gly Ile Pro Ala
65 70 75 80
Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Tyr Thr Leu Thr Ile Ser
85 90 95
Ser Leu Glu Pro Glu Asp Phe Ala Val Tyr Tyr Cys Gln Gln Trp Ser
100 105 110
Ser Asn Pro Trp Thr Phe Gly Gln Gly Thr Lys Val Glu Ile Lys Arg
115 120 125
Thr Val Ala Ala Pro Ser Val Phe Ile Phe Pro Pro Ser Asp Glu Gln
130 135 140
Leu Lys Ser Gly Thr Ala Ser Val Val Cys Leu Leu Asn Asn Phe Tyr
145 150 155 160
Pro Arg Glu Ala Lys Val Gln Trp Lys Val Asp Asn Ala Leu Gln Ser
165 170 175
Gly Asn Ser Gln Glu Ser Val Thr Glu Gln Asp Ser Lys Asp Ser Thr
180 185 190
Tyr Ser Leu Ser Ser Thr Leu Thr Leu Ser Lys Ala Asp Tyr Glu Lys
195 200 205
His Lys Val Tyr Ala Cys Glu Val Thr His Gln Gly Leu Ser Ser Pro
210 215 220
Val Thr Lys Ser Phe Asn Arg Gly Glu Cys 225 230
<210> 321 <211> 1094
<212> ДНК
<213> Искусственная последовательность
<220>
<223> Конструкция GSC10488
<400> 321
ctgtctccgg
gtaaatgatg
aaagcttggt
aggtgatcct
cctgctgctt
tggttcaggg
ttttgcttga
gggggggggg
tggtgatttc
cttgccatgg
gcagactgag
cagaaaaggc
120
cattgggacc
atgttctgaa
tgcctccacc
tcaaccaccg
gccggtagga
ccaaagccac
180
cccgtgtttt
ctcaggatct
cttttcccag
ggagatccct
cggcccaaag
agggagatgg
240
caatgctgga
tgtgtgcaca
ataattcaac
aggcattgga
acttcagcat
cgatgctgaa
300
tgcaattaac
aatgctcaag
cagaaccccc
ggctccatca
gcacagtgca
ggaccaaacc
360
ccatgctgca
gcagtggggc
tgtctgtacg
gggtgggcaa
tgggaaccgg
ggtctgctgg
420
ggctcctgct
gcttcagtgc
tgccatgcag
ccacacatcc
tgagagctga
aagggtcggc
480
gtcctcacct
ggtgcacacc
gtagctctgc
cccacagctt
taaggcacct
ggctaacctc
540
tgcgcttctt
cccttccctc
ctccctggct
caggtggtgg
tggatctccc
cccgaggacc
600
cccctgactc
caagaatacc
ctggtgctgt
tcggcgctgg
cttcggcgcc
gtgattaccg
660
tggtcgtgat
cgtcgtgatt
atcaagtgct
tctgcaagca
ccggtcctgc
ttccggcgga
720
acgaggcctc
cagagagaca
aacaactccc
tgaccttcgg
ccccgaggaa
gccctggctg
780
agcagaccgt gtttctgtga tgattcgaaa tgaccgacca
agcgacgccc
aacctgccat
840
cacgagattt cgattccacc gccgccttct atgaaaggtt
gggcttcgga
atcgttttcc
900
gggacgccgg ctggatgatc ctccagcgcg gggatctcat
gctggagttc
ttcgcccacc
960
ccaacttgtt tattgcagct tataatggtt acaaataaag
caatagcatc
acaaatttca
1020
caaataaagc atttttttca ctgcattcta gttgtggttt
gtccaaactc
atcaatgtat
1080
cttatcatgt ctgt
1094
<210> 322 <211> 80
<212> Белок
<213> Искусственная последовательность
<220>
<223> Конструкция GSC10488
<400> 322
Leu Ser Leu Ser Pro Gly Gly Gly Gly Ser Pro 1 5 10
Pro Glu Asp
Pro Pro
Asp Ser Lys Asn Thr Leu Val Leu Phe Gly Ala 20 25
Gly Phe Gly 30
Ala Val
Ile Thr Val Val Val Ile Val Val Ile Ile Lys 35 40
Cys Phe Cys 45
Lys His
Arg Ser Cys Phe Arg Arg Asn Glu Ala Ser Arg 50 55
Glu Thr Asn 60
Asn Ser
Leu Thr Phe Gly Pro Glu Glu Ala Leu Ala Glu 65 70 75
Gln Thr Val
Phe Leu
<210> 323 <211> 1094 <212> ДНК
<213> Искусственная последовательность
<220>
<223> Конструкция GSC10487
<400> 323
ctgtctccgg gtaaatgatg aaagcttggt aggtgatcct
cctgctgctt
tggttcaggg
ttttgcttga gggggggggg tggtgatttc cttgccatgg
gcagactgag
cagaaaaggc
120
cattgggacc atgttctgaa tgcctccacc tcaaccaccg
gccggtagga
ccaaagccac
180
cccgtgtttt ctcaggatct cttttcccag ggagatccct
cggcccaaag
agggagatgg
240
caatgctgga tgtgtgcaca ataattcaac aggcattgga
acttcagcat
cgatgctgaa
300
tgcaattaac aatgctcaag cagaaccccc ggctccatca
gcacagtgca
ggaccaaacc
360
ccatgctgca
gcagtggggc
tgtctgtacg
gggtgggcaa
tgggaaccgg
ggtctgctgg
420
ggctcctgct
gcttcagtgc
tgccatgcag
ccacacatcc
tgagagctga
aagggtcggc
480
gtcctcacct
ggtgcacacc
gtagctctgc
cccacagctt
taaggcacct
ggctaacctc
540
tgcgcttctt
cccttccctc
ctccctggct
caggtggtgg
tggatctccc
cccgaggacc
600
cccctgactc
caagaatacc
ctggtgctgt
tcggcgctgg
cttcggcgcc
gtgattaccg
660
tggtcgtgat
cgtcgtgatt
atcaagtgct
tctgcaagca
ccggtcctgc
ttccggcgga
720
acgaggcctc
cagagagaca
aacaactccc
tgaccttcgg
ccccgaggaa
gccctggctg
780
agcagaccgt
gtttctgtga
tgattcgaaa
tgaccgacca
agcgacgccc
aacctgccat
840
cacgagattt
cgattccacc
gccgccttct
atgaaaggtt
gggcttcgga
atcgttttcc
900
gggacgccgg
ctggatgatc
ctccagcgcg
gggatctcat
gctggagttc
ttcgcccacc
960
ccaacttgtt
tattgcagct
tataatggtt
acaaataaag
caatagcatc
acaaatttca
1020
caaataaagc
atttttttca
ctgcattcta
gttgtggttt
gtccaaactc
atcaatgtat
1080
cttatcatgt
ctgt
1094
<210> 324
<211> 80
<212> Белок
<213> Искусственная последовательность
<220>
<223> Конструкция GSC10487
<400> 324
Leu Ser Leu Ser Pro Gly Gly Gly Gly Ser Pro Pro Glu Asp Pro Pro
1 5 10 15
Asp Ser Lys Asn Thr Leu Val Leu Phe Gly Ala Gly Phe Gly Ala Val
20 25 30
Ile Thr Val Val Val Ile Val Val Ile Ile Lys Cys Phe Cys Lys His
35 40 45
Arg Ser Cys Phe Arg Arg Asn Glu Ala Ser Arg Glu Thr Asn Asn Ser
50 55 60
Leu Thr Phe Gly Pro Glu Glu Ala Leu Ala Glu Gln Thr Val Phe Leu
65 70 75 80
<210> 325
<211> 53
<212> ДНК
<213> Искусственная последовательность
<400> 325
ctgctgctgt ggctgcccga cggggtgcac gctgagatcg tgctgacaca gag
<210> 326
<211> 35
<212> ДНК
<213> Искусственная последовательность
<220>
<223> GlnPr1491
<400> 326
ccaaatcgat ttatcagcac tcgccccggt tgaag 35
<210> 327
<211> 31
<212> ДНК
<213> Искусственная последовательность
<220>
<223> GlnPr1452
<400> 327
acgtatcgat tcatcacttg ccgggggaca g 31
<210> 328
<211> 53
<212> ДНК
<213> Искусственная последовательность
<220>
<223> GlnPr1488
<400> 328
ctgctgctgt ggctgcccga cggggtgcac gctcaggtca cactgaaaga gtc 53
<210> 329
<211> 1470
<212> ДНК
<213> Искусственная последовательность
<223> pGLEX41_HC-GGC-I4(SV40ter)-B7-B7(18)-6His
<400> 329
ctgtctccgg gcaaatgatg aaagcttggt aggtgatcct cctgctgctt tggttcaggg 60
ttttgcttga gggggggggg tggtgatttc cttgccatgg gcagactgag cagaaaaggc 120
cattgggacc atgttctgaa tgcctccacc tcaaccaccg gccggtagga ccaaagccac 180
cccgtgtttt ctcaggatct cttttcccag ggagatccct cggcccaaag agggagatgg 240
caatgctgga tgtgtgcaca ataattcaac aggcattgga acttcagcat cgaaatgacc 300
gaccaagcga cgcccaacct gccatcacga gatttcgatt ccaccgccgc cttctatgaa 360
aggttgggct tcggaatcgt tttccgggac gccggctgga tgatcctcca gcgcggggat 420
ctcatgctgg
agttcttcgc
ccaccccaac
ttgtttattg
cagcttataa
tggttacaaa
480
taaagcaata
gcatcacaaa
tttcacaaat
aaagcatttt
tttcactgca
ttctagttgt
540
ggtttgtcca
aactcatcaa
tgtatcttat
catgtctgta
taccgtcgac
ctctagctag
600
agcttggcgt
aatcatggtc
atagctgttt
cctgtgtgaa
attgttatcc
gctcacaatt
660
ccacacaaca
tacgagccgg
ggcaggataa
tatatggtag
ggttcatagc
cagagtaacc
720
ttttttttta
atttttattt
tattttattt
ttgagatcag
ttcgatgctg
aatgcaatta
780
acaatgctca
agcagaaccc
ccggctccat
cagcacagtg
caggaccaaa
ccccatgctg
840
cagcagtggg
gctgtctgta
cggggtgggc
aatgggaacc
ggggtctgct
ggggctcctg
900
ctgcttcagt
gctgccatgc
agccacacat
cctgagagct
gaaagggtcg
gcgtcctcac
960
ctggtgcaca
ccgtagctct
gccccacagc
tttaaggcac
ctggctaacc
tctgcgcttc
1020
ttcccttccc
tcctccctgg
ctcaggtggt
ggtggatctc
cccccgagga
cccccctgac
1080
tccaagaata
ccctggtgct
gttcggcgct
ggcttcggcg
ccaccgtgat
cgtcgtgatt
1140
atcgccagcg
cccatcacca
ccaccatcat
tgatgatgat
tcgaaatgac
cgaccaagcg
1200
acgcccaacc
tgccatcacg
agatttcgat
tccaccgccg
ccttctatga
aaggttgggc
1260
ttcggaatcg
ttttccggga
cgccggctgg
atgatcctcc
agcgcgggga
tctcatgctg
1320
gagttcttcg
cccaccccaa
cttgtttatt
gcagcttata
atggttacaa
ataaagcaat
1380
agcatcacaa
atttcacaaa
taaagcattt
ttttcactgc
attctagttg
tggtttgtcc
1440
aaactcatca
atgtatctta
tcatgtctgt
1470
<210> 330 <211> 46
<212> Белок
<213> Искусственная последовательность
<220>
<223> pGLEX41_HC-GGC-I4(SV40ter)-B7-B7(18)-6His <400> 330
Leu Ser Leu Ser Arg Gly Gly Gly Ser Pro Pro Glu Asp Pro Pro Asp
1 5 10 15
Ser Lys Asn Thr Leu Val Leu Phe Gly Ala Gly Phe Gly Ala Thr Val
20 25 30
Ile Val Val Ile Ile Ala Ser Ala His His His His His His
35 40 45
<210> 331
<211> 1135
<212> ДНК
<213> Искусственная последовательность
<220>
<223> pGLEX41_HC-GGC-I4(polyA)-B7-B7(18)-6His
<400> 331
ctgtctccgg
gcaaatgatg
aaagcttggt
aggtgatcct
cctgctgctt
tggttcaggg
ttttgcttga
gggggggggg
tggtgatttc
cttgccatgg
gcagactgag
cagaaaaggc
120
cattgggacc
atgttctgaa
tgcctccacc
tcaaccaccg
gccggtagga
ccaaagccac
180
cccgtgtttt
ctcaggatct
cttttcccag
ggagatccct
cggcccaaag
agggagatgg
240
caatgctgga
tgtgtgcaca
ataattcaac
aggcattgga
acttcagcat
cgatacttgt
300
ttattgcagc
ttataatggt
tacaaataaa
gcaatagcat
cacaaatttc
acaaataaag
360
catttttttc
actgcattct
agttgtggtt
tgtccaaact
catcaatgta
tcttatcatg
420
tctgtatcga
tgctgaatgc
aattaacaat
gctcaagcag
aacccccggc
tccatcagca
480
cagtgcagga
ccaaacccca
tgctgcagca
gtggggctgt
ctgtacgggg
tgggcaatgg
540
gaaccggggt
ctgctggggc
tcctgctgct
tcagtgctgc
catgcagcca
cacatcctga
600
gagctgaaag
ggtcggcgtc
ctcacctggt
gcacaccgta
gctctgcccc
acagctttaa
660
ggcacctggc
taacctctgc
gcttcttccc
ttccctcctc
cctggctcag
gtggtggtgg
720
atctcccccc
gaggaccccc
ctgactccaa
gaataccctg
gtgctgttcg
gcgctggctt
780
cggcgccacc
gtgatcgtcg
tgattatcgc
cagcgcccat
caccaccacc
atcattgatg
840
atgattcgaa
atgaccgacc
aagcgacgcc
caacctgcca
tcacgagatt
tcgattccac
900
cgccgccttc
tatgaaaggt
tgggcttcgg
aatcgttttc
cgggacgccg
gctggatgat
960
cctccagcgc
ggggatctca
tgctggagtt
cttcgcccac
cccaacttgt
ttattgcagc
1020
ttataatggt
tacaaataaa
gcaatagcat
cacaaatttc
acaaataaag
catttttttc
1080
actgcattct
agttgtggtt
tgtccaaact
catcaatgta
tcttatcatg
tctgt
1135
<210> 332
<211> 45
<212> Белок
<213> Искусственная последовательность
<220>
<223> pGLEX41_HC-GGC-I4(polyA)-B7-B7(18)-6His
<400> 332
Leu Ser Pro Gly Gly Gly Gly Ser Pro Pro Glu Asp Pro Pro Asp Ser
1 5 10 15
Lys Asn Thr Leu Val Leu Phe Gly Ala Gly Phe Gly Ala Thr Val Ile
20 25 30
<210> 333
<211> 1123
<212> ДНК
<213> Искусственная последовательность
<220>
<223> pGLEX41_HC-GGC-I4(polyA)-B7-B7(18)-KCFCK
<210> 334
<211> 41
<212> Белок
<213> Искусственная последовательность
<220>
<223> pGLEX41_HC-GGC-I4(polyA)-B7-B7(18)-KCFCK
<400> 334
Leu Ser Pro Gly Gly Gly Gly Ser Pro Pro Glu Asp Pro Pro Asp Ser
1 5 10 15
Lys Asn Thr Leu Val Leu Phe Gly Ala Gly Phe Gly Ala Thr Val Ile
Val Val Ile Ile Lys Cys Phe Cys Lys 35 40
<210> 335 <211> 1141 <212> ДНК
<213> Искусственная последовательность
<220>
<223> pGLEX41_HC-GGC-I4(polyA)-B7-B7(20)-6His
<400> 335
ctgtctccgg gcaaatgatg aaagcttggt aggtgatcct cctgctgctt tggttcaggg 60
ttttgcttga gggggggggg tggtgatttc cttgccatgg gcagactgag cagaaaaggc 120
cattgggacc atgttctgaa tgcctccacc tcaaccaccg gccggtagga ccaaagccac 180
cccgtgtttt ctcaggatct cttttcccag ggagatccct cggcccaaag agggagatgg 240
caatgctgga tgtgtgcaca ataattcaac aggcattgga acttcagcat cgatacttgt 300
ttattgcagc ttataatggt tacaaataaa gcaatagcat cacaaatttc acaaataaag 360
catttttttc actgcattct agttgtggtt tgtccaaact catcaatgta tcttatcatg 420
tctgtatcga tgctgaatgc aattaacaat gctcaagcag aacccccggc tccatcagca 480
cagtgcagga ccaaacccca tgctgcagca gtggggctgt ctgtacgggg tgggcaatgg 540
gaaccggggt ctgctggggc tcctgctgct tcagtgctgc catgcagcca cacatcctga 600
gagctgaaag ggtcggcgtc ctcacctggt gcacaccgta gctctgcccc acagctttaa 660
ggcacctggc taacctctgc gcttcttccc ttccctcctc cctggctcag gtggtggtgg 720
atctcccccc gaggaccccc ctgactccaa gaataccctg gtgctgttcg gcgctggctt 780
cggcgccacc gtggtcgtga tcgtcgtgat tatcgccagc gcccatcacc accaccatca 840
ttgatgatga ttcgaaatga ccgaccaagc gacgcccaac ctgccatcac gagatttcga 900
ttccaccgcc gccttctatg aaaggttggg cttcggaatc gttttccggg acgccggctg 960
gatgatcctc cagcgcgggg atctcatgct ggagttcttc gcccacccca acttgtttat 1020
tgcagcttat aatggttaca aataaagcaa tagcatcaca aatttcacaa ataaagcatt 1080
tttttcactg cattctagtt gtggtttgtc caaactcatc aatgtatctt atcatgtctg 1140
t 1141
<210> 336
<211> 47
<212> Белок
<213> Искусственная последовательность
Leu Ser Pro Gly Gly Gly Gly Ser Pro Pro Glu Asp Pro Pro Asp Ser
1 5 10 15
Lys Asn Thr Leu Val Leu Phe Gly Ala Gly Phe Gly Ala Thr Val Val
20 25 30
Val Ile Val Val Ile Ile Ala Ser Ala His His His His His His
35 40 45
<210> 337
<211> 1129
<212> ДНК
<213> Искусственная последовательность
<220>
<223> pGLEX41_HC-GGC-I4(polyA)-B7-B7(20)-KCFCK
<400> 337
ctgtctccgg
gcaaatgatg
aaagcttggt
aggtgatcct
cctgctgctt
tggttcaggg
ttttgcttga
gggggggggg
tggtgatttc
cttgccatgg
gcagactgag
cagaaaaggc
120
cattgggacc
atgttctgaa
tgcctccacc
tcaaccaccg
gccggtagga
ccaaagccac
180
cccgtgtttt
ctcaggatct
cttttcccag
ggagatccct
cggcccaaag
agggagatgg
240
caatgctgga
tgtgtgcaca
ataattcaac
aggcattgga
acttcagcat
cgatacttgt
300
ttattgcagc
ttataatggt
tacaaataaa
gcaatagcat
cacaaatttc
acaaataaag
360
catttttttc
actgcattct
agttgtggtt
tgtccaaact
catcaatgta
tcttatcatg
420
tctgtatcga
tgctgaatgc
aattaacaat
gctcaagcag
aacccccggc
tccatcagca
480
cagtgcagga
ccaaacccca
tgctgcagca
gtggggctgt
ctgtacgggg
tgggcaatgg
540
gaaccggggt
ctgctggggc
tcctgctgct
tcagtgctgc
catgcagcca
cacatcctga
600
gagctgaaag
ggtcggcgtc
ctcacctggt
gcacaccgta
gctctgcccc
acagctttaa
660
ggcacctggc
taacctctgc
gcttcttccc
ttccctcctc
cctggctcag
gtggtggtgg
720
atctcccccc
gaggaccccc
ctgactccaa
gaataccctg
gtgctgttcg
gcgctggctt
780
cggcgccacc
gtggtcgtga
tcgtcgtgat
tatcaagtgc
ttctgcaagt
gatgatgatt
840
cgaaatgacc
gaccaagcga
cgcccaacct
gccatcacga
gatttcgatt
ccaccgccgc
900
cttctatgaa
aggttgggct
tcggaatcgt
tttccgggac
gccggctgga
tgatcctcca
960
gcgcggggat
ctcatgctgg
agttcttcgc
ccaccccaac
ttgtttattg
cagcttataa
1020
tggttacaaa
taaagcaata
gcatcacaaa
tttcacaaat
aaagcatttt
tttcactgca
1080
ttctagttgt
ggtttgtcca
aactcatcaa
tgtatcttat
catgtctgt
1129
<211> 43
<212> Белок
<213> Искусственная последовательность
<220>
<223> pGLEX41_HC-GGC-I4(polyA)-B7-B7(20)-KCFCK
<400> 338
Leu Ser Pro Gly Gly Gly Gly Ser Pro Pro Glu Asp Pro Pro Asp Ser
1 5 10 15
Lys Asn Thr Leu Val Leu Phe Gly Ala Gly Phe Gly Ala Thr Val Val
20 25 30
Val Ile Val Val Ile Ile Lys Cys Phe Cys Lys 35 40
<210> 339
<211> 1458
<212> ДНК
<213> Искусственная последовательность
<220>
<223> pGLEX41_HC-GGC-I4(SV40ter)-B7-B7(18)-KCFCK
ttcccttccc
tcctccctgg
ctcaggtggt
ggtggatctc
cccccgagga
cccccctgac
1080
tccaagaata
ccctggtgct
gttcggcgct
ggcttcggcg
ccaccgtgat
cgtcgtgatt
1140
atcaagtgct
tctgcaagtg
atgatgattc
gaaatgaccg
accaagcgac
gcccaacctg
1200
ccatcacgag
atttcgattc
caccgccgcc
ttctatgaaa
ggttgggctt
cggaatcgtt
1260
ttccgggacg
ccggctggat
gatcctccag
cgcggggatc
tcatgctgga
gttcttcgcc
1320
caccccaact
tgtttattgc
agcttataat
ggttacaaat
aaagcaatag
catcacaaat
1380
ttcacaaata
aagcattttt
ttcactgcat
tctagttgtg
gtttgtccaa
actcatcaat
1440
gtatcttatc
atgtctgt
1458
<210> 340
<211> 41
<212> Белок
<213> Искусственная последовательность
<220>
<223> pGLEX41_HC-GGC-I4(SV40ter)-B7-B7(18)-KCFCK
<400> 340
Leu Ser Pro Gly Gly Gly Gly Ser Pro Pro Glu Asp Pro Pro Asp Ser
1 5 10 15
Lys Asn Thr Leu Val Leu Phe Gly Ala Gly Phe Gly Ala Thr Val Ile
20 25 30
Val Val Ile Ile Lys Cys Phe Cys Lys 35 40
<210> 341
<211> 1476
<212> ДНК
<213> Искусственная последовательность
<220>
<223> pGLEX41_HC-GGC-I4(SV40ter)-B7-B7(20)-6His <400> 341
ctgtctccgg gcaaatgatg aaagcttggt aggtgatcct cctgctgctt tggttcaggg 60
ttttgcttga gggggggggg tggtgatttc cttgccatgg gcagactgag cagaaaaggc 120
cattgggacc atgttctgaa tgcctccacc tcaaccaccg gccggtagga ccaaagccac 180
cccgtgtttt ctcaggatct cttttcccag ggagatccct cggcccaaag agggagatgg 240
caatgctgga tgtgtgcaca ataattcaac aggcattgga acttcagcat cgaaatgacc 300
gaccaagcga cgcccaacct gccatcacga gatttcgatt ccaccgccgc cttctatgaa 360
aggttgggct tcggaatcgt tttccgggac gccggctgga tgatcctcca gcgcggggat 420
taaagcaata
gcatcacaaa
tttcacaaat
aaagcatttt
tttcactgca
ttctagttgt
540
ggtttgtcca
aactcatcaa
tgtatcttat
catgtctgta
taccgtcgac
ctctagctag
600
agcttggcgt
aatcatggtc
atagctgttt
cctgtgtgaa
attgttatcc
gctcacaatt
660
ccacacaaca
tacgagccgg
ggcaggataa
tatatggtag
ggttcatagc
cagagtaacc
720
ttttttttta
atttttattt
tattttattt
ttgagatcag
ttcgatgctg
aatgcaatta
780
acaatgctca
agcagaaccc
ccggctccat
cagcacagtg
caggaccaaa
ccccatgctg
840
cagcagtggg
gctgtctgta
cggggtgggc
aatgggaacc
ggggtctgct
ggggctcctg
900
ctgcttcagt
gctgccatgc
agccacacat
cctgagagct
gaaagggtcg
gcgtcctcac
960
ctggtgcaca
ccgtagctct
gccccacagc
tttaaggcac
ctggctaacc
tctgcgcttc
1020
ttcccttccc
tcctccctgg
ctcaggtggt
ggtggatctc
cccccgagga
cccccctgac
1080
tccaagaata
ccctggtgct
gttcggcgct
ggcttcggcg
ccaccgtggt
cgtgatcgtc
1140
gtgattatcg
ccagcgccca
tcaccaccac
catcattgat
gatgattcga
aatgaccgac
1200
caagcgacgc
ccaacctgcc
atcacgagat
ttcgattcca
ccgccgcctt
ctatgaaagg
1260
ttgggcttcg
gaatcgtttt
ccgggacgcc
ggctggatga
tcctccagcg
cggggatctc
1320
atgctggagt
tcttcgccca
ccccaacttg
tttattgcag
cttataatgg
ttacaaataa
1380
agcaatagca
tcacaaattt
cacaaataaa
gcattttttt
cactgcattc
tagttgtggt
1440
ttgtccaaac
tcatcaatgt
atcttatcat
gtctgt
1476
<210> 342 <211> 47
<212> Белок
<213> Искусственная последовательность
<220>
<223> pGLEX41_HC-GGC-I4(SV40ter)-B7-B7(20)-6His
<400> 342
Leu Ser Pro Gly Gly Gly Gly Ser Pro Pro Glu Asp Pro Pro Asp Ser
1 5 10 15
Lys Asn Thr Leu Val Leu Phe Gly Ala Gly Phe Gly Ala Thr Val Val
20 25 30
Val Ile Val Val Ile Ile Ala Ser Ala His His His His His His
35 40 45
<210> 343
<211> 1464
<212> ДНК
<213> Искусственная последовательность
<220>
<223> pGLEX41_HC-GGC-I4(SV40ter)-B7-B7(20)-KCFCK
<400> 343
ctgtctccgg gcaaatgatg aaagcttggt aggtgatcct cctgctgctt tggttcaggg 60
ttttgcttga gggggggggg tggtgatttc cttgccatgg gcagactgag cagaaaaggc 120
cattgggacc atgttctgaa tgcctccacc tcaaccaccg gccggtagga ccaaagccac 180
cccgtgtttt ctcaggatct cttttcccag ggagatccct cggcccaaag agggagatgg 240
caatgctgga tgtgtgcaca ataattcaac aggcattgga acttcagcat cgaaatgacc 300
gaccaagcga cgcccaacct gccatcacga gatttcgatt ccaccgccgc cttctatgaa 360
aggttgggct tcggaatcgt tttccgggac gccggctgga tgatcctcca gcgcggggat 420
ctcatgctgg agttcttcgc ccaccccaac ttgtttattg cagcttataa tggttacaaa 480
taaagcaata gcatcacaaa tttcacaaat aaagcatttt tttcactgca ttctagttgt 540
ggtttgtcca aactcatcaa tgtatcttat catgtctgta taccgtcgac ctctagctag 600
agcttggcgt aatcatggtc atagctgttt cctgtgtgaa attgttatcc gctcacaatt 660
ccacacaaca tacgagccgg ggcaggataa tatatggtag ggttcatagc cagagtaacc 720
ttttttttta atttttattt tattttattt ttgagatcag ttcgatgctg aatgcaatta 780
acaatgctca agcagaaccc ccggctccat cagcacagtg caggaccaaa ccccatgctg 840
cagcagtggg gctgtctgta cggggtgggc aatgggaacc ggggtctgct ggggctcctg 900
ctgcttcagt gctgccatgc agccacacat cctgagagct gaaagggtcg gcgtcctcac 960
ctggtgcaca ccgtagctct gccccacagc tttaaggcac ctggctaacc tctgcgcttc 1020
ttcccttccc tcctccctgg ctcaggtggt ggtggatctc cccccgagga cccccctgac 1080
tccaagaata ccctggtgct gttcggcgct ggcttcggcg ccaccgtggt cgtgatcgtc 1140
gtgattatca agtgcttctg caagtgatga tgattcgaaa tgaccgacca agcgacgccc 1200
aacctgccat cacgagattt cgattccacc gccgccttct atgaaaggtt gggcttcgga 1260
atcgttttcc gggacgccgg ctggatgatc ctccagcgcg gggatctcat gctggagttc 1320
ttcgcccacc ccaacttgtt tattgcagct tataatggtt acaaataaag caatagcatc 1380
acaaatttca caaataaagc atttttttca ctgcattcta gttgtggttt gtccaaactc 1440
atcaatgtat cttatcatgt ctgt 1464
<210> 344 <211> 43
<212> Белок
<213> Искусственная последовательность
<220>
<223> pGLEX41_HC-GGC-I4(SV40ter)-B7-B7(20)-KCFCK <400> 344
10 15
Lys Asn Thr Leu Val Leu Phe Gly Ala Gly Phe Gly Ala Thr Val Val
20 25 30
Val Ile Val Val Ile Ile Lys Cys Phe Cys Lys 35 40
<210> 345
<211> 9
<212> ДНК
<213> Искусственная последовательность
<220>
<223> консенсусная последовательность донорного сайта сплайсинга
<400> 345
maggtragt 9
<210> 346
<211> 12
<212> ДНК
<213> Искусственная последовательность
<220>
<223> консенсусная последовательность акцепторного сайта сплайсинга
<220>
<221> смешанный признак
<222> (7)..(7)
<223> поли^)-участок, содержащий по меньшей мере 15 нуклеотидов и избыток
пиримидиновых (C или T) оснований
<220>
<221> смешанный_признак
<222> (8)..(8)
<223> n представляет собой a, c, g, или t
<400> 346
ctrayynnca gg 12
<210> 347
<211> 6
<212> ДНК
<213> Искусственная последовательность
<220>
<223> консенсусная последовательность области точки разветвления
<400> 347
ctrayy 6
Формула изобретения
1. Экспрессирующая конструкция, содержащая в направлении от 5' к 3': промотор;
первый экзон, кодирующий полипептид, представляющий интерес; донорный сайт сплайсинга, интрон и акцепторный сайт сплайсинга, причем первый стоп-кодон расположен между указанным донорным сайтом сплайсинга и указанным акцепторным сайтом сплайсинга в пределах указанного интрона;
второй экзон, кодирующий трансмембранную область, которая выбрана из модифицированной трансмембранной области иммуноглобулина или модифицированной или немодифицированной трансмембранной области, отличной от трансмембранной области иммуноглобулина; второй стоп-кодон; и поли(А)-сайт,
причем после поступления в клетку-хозяин транскрипция указанного первого и второго экзонов приводит к экспрессии полипептида, представляющего интерес, и экспонированию части полипептида, представляющего интерес, на поверхности мембраны клетки-хозяина.
2. Экспрессирующая конструкция по п. 1, отличающаяся тем, что указанная трансмембранная область содержит от 17 до 29 остатков, предпочтительно, от 19 до 26 остатков и, наиболее предпочтительно, от 21 до 24 остатков.
3. Экспрессирующая конструкция по п. 1 или 2, отличающаяся тем, что указанная трансмембранная область, отличная от трансмембранной области иммуноглобулина, выбрана из группы, включающей трансмембранную область рецептора фактора роста тромбоцитов человека (PDGFR), асиалогликопротеинового рецептора человека, В7-1 человека и мыши, ICAM-1 человека, erbbl человека, erbb2 человека, егЬЬЗ человека, erbb4 человека, рецепторов фактора роста фибробластов человека, таких как FGFR 1, FGFR2, FGFR3, FGFR4, VEGFR-1 человека, VEGFR-2 человека, рецептора эритропоэтина человека, PRL-R человека, рецептора пролактина, EphAl человека, рецептора 1 эфринатипа А, инсулина человека, рецепторов IGF-1, рецептороподобных тирозинфосфатаз белков человека, нейропилина человека, главного комплекса гистосовместимости класса II человека (цепи альфа и бета), интегринов человека
(семейства альфа и бета), синдеканов человека, белка миелина человека, кадгеринов человека, синаптобревина-2 человека, гликофорина-А человека, Bnip3 человека, АРР человека, белка-предшественника амилоида, рецептора Т-клеток альфа и бета человека, CD3 гамма, CD3 дельта, CD3 дзета и CD3 эпсилон.
4. Экспрессирующая конструкция по п. 1, отличающаяся тем, что указанная трансмембранная область, отличная от трансмембранной области иммуноглобулина, представляет собой трансмембранную область В7-1 мыши (SEQ Ш N0: 173), ACLV1 (SEQ ID N0: 174), ANTR2 (SEQ ГО N0: 175), CD4 (SEQ ГО N0: 176), PTPRM (SEQ ГО N0: 177), TNR5 (SEQ ID NO: 178), ITB1 (SEQ ID NO: 179), IGF1R (SEQ ID NO: 181), 1B07 (SEQ ID NO: 180), TRMB (SEQ ID NO: 182), IL4RA (SEQ ID NO: 183), LRP6 (SEQ ID NO: 184), GpA (SEQ ID NO: 185), PTCRA (SEQ ID NO: 186).
5. Экспрессирующая конструкция по любому из пп. 1-4, отличающаяся тем, что указанный интрон содержит поли(А)-сайт.
6. Экспрессирующая конструкция по любому из пп. 1-5, отличающаяся тем, что акцепторный сайт сплайсинга указанного интрона содержит поли(У)-участок, и при этом содержание Y в указанном поли(У)-участке модифицируют посредством изменения количества пиримидиновых оснований в нем.
7. Экспрессирующая конструкция по любому из пп. 1-6, содержащая по меньшей мере одну область точки разветвления, отличающаяся тем, что последовательность указанной по меньшей мере одной области точки разветвления является модифицированной относительно консенсусной последовательности области точки разветвления CTRAYY (SEQ ГО N0: 347).
8. Экспрессирующая конструкция по любому из пп. 1-7, отличающаяся тем, что консенсусная последовательность указанного донорного сайта сплайсинга интрона является модифицированной.
9. Экспрессирующая конструкция по любому из пп. 1-8, отличающаяся тем, что указанный полипептид, представляющий интерес, содержит тяжелую цепь антитела или её фрагмент.
10. Полинуклеотид, кодирующий экспрессирующую конструкцию по любому из пп. 1-9.
11. Вектор клонирования или экспрессии, содержащий один или более полинуклеотидов по п. 10.
12. Клетка-хозяин, содержащая один или более векторов клонирования или экспрессии по п. 11.
13. Клетка-хозяин по п. 12, содержащая вектор экспрессии, который содержит полинуклеотид, кодирующий экспрессирующую конструкцию по п. 9 для экспрессии тяжелой цепи антитела, и вектор экспрессии, который содержит полинуклеотид, кодирующий экспрессирующую конструкцию для экспрессии легкой цепи антитела.
14. Клетка-хозяин по п. 12, содержащая вектор экспрессии, который содержит полинуклеотид, кодирующий экспрессирующую конструкцию по п. 9 для экспрессии тяжелой цепи антитела, вектор экспрессии, который содержит полинуклеотид, кодирующий экспрессирующую конструкцию по п. 8 для экспрессии scFv-Fc, и вектор экспрессии, который содержит полинуклеотид, кодирующий экспрессирующую конструкцию для экспрессии легкой цепи антитела.
15. Способ получения полипептида, включающий культивирование клетки-хозяина по любому из пп. 12 - 14 в культуре и выделение полипептида, экспрессированного из культуры.
16. Способ отбора клетки-хозяина, экспрессирующей полипептид, представляющий интерес, причем указанный способ включает:
(i) трансфекцию клетки-хозяина экспрессирующей конструкцией по п. 1;
(ii) культивирование клетки-хозяина в условиях, подходящих для экспрессии полипептида, представляющего интерес;
(iii) обнаружение экспрессии полипептида, представляющего интерес, на мембране клетки; и
(iv) отбор клетки-хозяина, экспонирующей полипептид, представляющий интерес, на поверхности мембраны клетки на желаемом уровне экспрессии.
(i)
17. Способ отбора клетки-хозяина, экспрессирующей гетеромультимерный полипептид, представляющий интерес, причем указанный способ включает:
(i) котрансфекцию клетки-хозяина по меньшей мере экспрессирующей конструкцией по п. 1, кодирующей первый полипептид, представляющий интерес, и экспрессирующей конструкцией по п. 1, кодирующей второй полипептид, представляющий интерес;
(ii) культивирование клетки-хозяина в условиях, подходящих для экспрессии гетеромультимерного полипептида, представляющего интерес;
(iii) обнаружение экспрессии гетеромультимерного полипептида, представляющего интерес, на мембране клетки; и
(iv) отбор клетки-хозяина, экспонирующей желаемый гетеромультимерный полипептид, представляющий интерес, на поверхности мембраны клетки на желаемом уровне экспрессии.
18. Способ отбора клетки-хозяина, экспрессирующей биспецифичное антитело, причем указанный способ включает:
(i) котрансфекцию клетки-хозяина экспрессирующей конструкцией по п. 1, кодирующей тяжелую цепь антитела, экспрессирующей конструкцией по п. 1, кодирующей scFv-Fc, и экспрессирующей конструкцией, кодирующей легкую цепь антитела;
(ii) культивирование клетки-хозяина в условиях, подходящих для экспрессии биспецифичного антитела;
(iii) обнаружение экспрессии биспецифичного антитела на клеточной мембране; и
(iv) отбор клетки-хозяина, экспонирующей желаемое биспецифичное антитело на поверхности клеточной мембраны на желаемом уровень экспрессии.
(i)
Полипептид
интрон 4 cTNT (-500 п.о.) Продукт сплайсинга 1: Секретируемый полипептид
1 ?
Полипептид
|||
¦ G _ К
Продукт сплайсинга 2; Мембраносеязанный полипелтид
Полипептид
0 Стоп-кодоны
Точка разветвления (TP), за которой следует поли(У)-тракт акцептора сплайсинга Трансмембранная область ("Ш)
^ Положение необязательного сигнала поли{А) (с терминатором гастрина или без него) ^ Положение необязательного терминатора гастрина
Поверхностное окрашивание
В7-1 М1М2 PTCRA M1M2-PTCRA
(SEQ ID NO: 55) {SEQ ID NO; 36) (SEQ ID NO: 40) {SEQ ID NO: 284)
50 45 40 35 30 25 20 15 10 5 0
± ст. откл.; n > 3
rih
45 40 35 30 25 20 15 10 5 0
+ ст. откл.; n > 3
о ill a. о > " с -вв к
1600 1400 1200 1000 800 600 400 200 0
4?-
Л4-
Поверхностное окрашивание
igG4~B7-l (SEQ ID NO: 80)
± ст. откл.; п = э
+ ст. откл.
; п = э
i
Г 1
ЯНН
ниня
500 1
к 450 | 400
| 350
I зоо I 250
* 200 1 150 | 100 и 50 ± ст. откл.
igG4
IgG 4-87-1
lgG4
lgG4-B7-1
lgG4
Поверхностное окрашивание
Трансфицирующие векторы Fc LC каппа scFv-Fc
рНС + pScFv-Fc + pLC
10е 101 10- 10s 10* ю° 101 10: 10-'' 10J 10° 10l 10г 10 s 104
рНС-М1М2 + pScFv-Fc-MlM2+ pLC
DHC-M1M2 + pScFv-Fc + pLC
10е' 101 10' 10* 104 10е 10l 10* 10* 10* 10° 10' 10-' 103 10*
Поверхностное окрашивание
Трансфицирующие векторы Fc LC каппа scFv-Fc
рНС + pScFv-Fc-MlM2 + pLC
pScFv-Fc-MlM2
рНС-М1М2 + pLC
Без изменений
Сокращение поли(У) (0Y)
Поли(А)
Терминатор гастрина
Контроль
SEQ 10 N0: 36 А
SEQ ID N0: 37
SEQ ID NO: 38
SEQ ID NO: 39
SEQ ID NO: 48
М1М2
m- ml ten nv io*
PTCRA
SEQ ID NO: 40
SEQ ID NO: 41 F
SEQ ID NO: 42
SEQ ID NO: 43 H
ffl
н s < о о
T О)
X с с; 2 о
Флуоресценция
Без изменений SEQ ID NO: 44
Сокращение поли(У) (0Y)
SEQ ID NO: 45
Поли{А) SEQ ID NO: 46
Терминатор гастрина
SEQ ID NO: 47
Контроль SEQ ID NO: 48
М1М2-
PTCRA
B7-1
if,
<
о а.
Р о о
< о
<
о о.
М1М2
PTCRA
M1M2-PTCRA
В7-1
CNT
Поверхностное окрашивание
27Y
{SEQ ID NO; 55)
25Y
(SEQ ID N0:63)
10Y
(SEQ ID NO: 61) {SEQIDNO:59}
{SEQ ID NO: 60)
{SEQ ID NO: 62}
(SEQ ID N0:53}
Флуоресценция
70 60 50 40 30 20 10 4
+ ст. откл.; n > 5
20 i
^ 15 s
IL.
1 10
CL _
i- 5
JL ± ст. откл.; n > 5
fc Г
"-О ЛЧ> ,rO "A>
R X
i o> ar
Q. О > .
•З"
X СУ
а. О
1400 1200 1000 800 600 400 200 0
± ст. откл.: п > 5
¦ I t
.а* ,-0 -4> 4> ,4> 4> Ч>
ч^%Ь^ч^ ч*4 %^ \^
Поверхностное окрашивание
cTNT-14 SD_CCC SD_GGC
(SEQ ID NO: 55) (SEQ ID NO: 58) (SEQ ID NO: 57J
70 ¦
60 ¦
О 1-
50 ¦
40 ¦
30 ¦
20 ¦
10 ¦
0 ¦
± ст. откл.; n = 6
' ' 10 5 0
+ ст. откл.; n = 6
R X
У 0) Q. О ^
-0"
к к x
Q. О
1400 1200 1000
800 •
600 ¦
400
200 0
± ст. откл.; n = 6
<§> '
4> '
4> '
Поверхностное окрашивание
В7-1 AC VII ANTR2 С04
(SEQID N0: 55) (SEQID N0:81) (SEQIDNO: 82) (SEQID N0: 83}
j А 0 I В " I С 1 " | Dj
ail 10 1 1 о I ; о It "I
PTPRM TNR5 !TB1
(SEQ ID NO: 84) (SEQ ID NO: 85) (SEQ ID MO: 86)
о л ¦
о о ;
Ф н 1
3" т 1
ц ё I о i
Флуоресценция
60 ¦
50 ¦
> <
40 -
ето
30 ¦
(pa
20 ¦
10 ¦
откл.: п > 6
А А
-40 ¦ I
^ 35 - ft
¦5 зо •
| 25 4
20 ?¦ 15 ¦5 10
± ст. откл.: п > 6
A A d
? 1600 1
11400
о. о > .
¦9-
к к
" о.
| 1200 Й 1000 4
800 4 600 400 200 О
± ст, откл.: п > 6
is *
Поверхностное окрашивание
60 -I
X 50 -
? 40 Ф о
§¦ 2 20 ¦{
v? 10 ¦
О4"
± ст. откл.: п > 6
rti
* ^ чсГ ^ *Г
г-, 40 ' "Н* 35 ¦
"С 30 4
1 25
" 20 О.
Н 15 Н- 10 5 -I
± ст. откл.; п > б
* rh Р
т-¦ ¦ I
¦8-
о; к
"а ф а о
1600 !
1400 1200 1000 800
600 4
400 200 Н
± ст. откл.: п > 6
Поверхностное окрашивание
PTCRA PTCRA_R8V PTCRA_K13V PTCRA_D18V
(SEQ!D NO: 93) (SEQID NO: 94) (SEQID NO: 95) (SEQID NO: 96)
PTC.RA_R8V_.K13V PTCRA_R8V_D18V PTCRA_K13V_D18V PTCRA_R8V_K13V_D18V
(SEQ ID NO: 97) (SEQID NO: 98) (SEQID NO: 99/ (SEQ ID NO: 100)
^ Флуоресценция
60 -I
50 ¦
_• 40 ¦
О пп
краш
\~ 30 ¦ ф
Ц 20 •
10 ¦
о4-
0 ¦
± ст. откл.; п _ 9
rfi
rfi
¦Tl
у ^ ^ / /. /. / /_ /
<й^х
5 35 и 30 § 25 "- 20 О. -\ 5
5 10
± ст, откл,; п > 9
X З1 X
от о
о. о > • с;
¦в-к
о. О
1400 1200 1000 800 600 400 200
± ст. откл.; п > 9
шщтшШШШяввшт
4$' <г ~s
'* * ^ J>
Ч~ О ч* О ъ о
<^ ^ ^ ^
Поверхностное окрашивание
В 7 -1. (SEQID NO: 55)
FCERA (SEQID NO: 101)
KI2L2 (SEQID NO: 102}
IL3RB
(SEQID NO: 103}
о 1
(tm) Флуоресценция
60 -s 50 40 30 20 10 0
± ст. откл.; n > 9
if.
45 -j
40 •
35 ^
30 ¦
25 •
20 ¦
15 ¦
10 ¦
5 ¦
0 ¦
± ст. откл.; n > 9
_ о
¦fr
К К
a. U
1600 -j 1400 -1200 ¦ 1000 ¦ 800 • 600 ¦ 400 ¦ 200 ¦ 0 ¦
± ст. откл.; n > 9
Поверхностное окрашивание
В7-1 CD3E ITA28 CD28 М1М2
(SEQID N0:55) (SEQID NO: 104) (SEQ ID NO: 105) (SEQID NO: 106} (SEQID NO: 107)
50 45 40 35 30 25 20 15 10 5 4
± ст. откл.; n > 9
45 40 35 30
I 25 ' 20 x 15 h 10
± ст. откл.; n > 9
Ш CL
к -8-
о а U
1600 1400 1200 1000
800
600
400
200 i
± ст. откл.; п > 9
X ^ c# J>

Поверхностное окрашивание
В7-1 (22 ак) (SEQ.IDNO: 55)
В7 (18 ак) (SEQSD N0: 108)
В7 (20 ак)
(SEQID NO: 109)
В7 (24 ак) (SEQfD NO: 110)
В7 (26 ак)
(SEQID NO: 111)
аз if. I1
^ Флуоресценция
60 -j
50 •
40 ¦
X 0)
30 ¦
20 •
10 •
0 •
± ст.
откл.; п > 9
45 1 40 __ 35
1 зо
* 25
iL 20
|15-S l_ 10 .
5 О
± ст. откл.; п > 9
± ст. откл.; п > 9 Ц
\ 4i • * *
ктрл В7 87 В7 В7 В7 (22) (18) (20) (24) (26)
ктрл В7 В7 В7 В7 В7 (22) (18) (20) (24) (26)
ктрл В7 В7 В7 В7 В7 (22) (18) (20) (24) (26)
Поверхностное окрашивание
В7-1 6His
(SEQID N0:55) (SEQID NO: 112)
KCFCK (SEQID NO: 113)
M1M2 (SEQID NO: 114}
о l
-у-т-:-ri-\
10 10 so 10 13 * Флуоресценция
ERGIC53
(SEQID NO: 115)
ERGICS3_noER (SEQID NO: 116)
6AT1 (SEQ ID NO: 117)
GATl_noER (SEQID NO: 118)
AGTR2 (SEQID N0:119}
AGTR2 noER
(SEQID NO: 120)
~ i J
V1BR (SEQID NO: 121}
VlBR_noЈR (SEQ ID NO: 122)
VGLG
(SEQID NO: 123)
VGLG_noER
(SEQID NO: 124)
о, __
50 45
О 30 -
Ф 25 Ц 20
ай 15 ¦
10 -5
± ст. откл.; п > б
i А
45 "с 35
Т: зо
25 • ___ 20 ¦
а 15 н ю
± ст. откл.; п > 6
ES X
S 1800 ¦ х 1600 ¦ § 1400 8 1200 о 1000 ^ 800 -I
600
400 200
± ст. откл.; п > 6
A rfc
Поверхностное окрашивание
М1М2-М1М2-МШ2 {SEQID NO: 36)
МШ2М1М2-В7 (SEQID NO: 125)
У °
У 0J
s e;
c; a!
Флуоресценция
25 i
± ст. откл.; п > 9
45 40 35
|зо
? 25 Е
" 20 а.
s 15 10 •
5 0
± ст. откл.; п > 9 D
2500
§ 2000
х: Ш
I 1500
¦8- 1000
| 500 О
± ст, откл.; п > 9
КТрЛ М1М2
ктрл
М1М2
КТрЛ М1Г.12
scFv-Fc-DIM
Антитело против Fc-фрагмента человека
100
¦ % Q6* по сравнению с % BEAT u % Q7* по сравнению с % scFv-FcDIM
¦
90 : fj^~~--
^ 80 ¦ V R2 - 0,9063
1 70
> 60 ¦
р 30
< 50
2 40 ¦ ?
0 i ; °~ о ' - - , -
0 10 20 30 40 50 60 70 80 90 100
% положительных клеток согласно поверхностному окрашиванию
Фигура 22 100
90 ¦
80 R2 = 0,8095
Ф ¦
5Е 70 ¦
? 60
50 40
> * о
< 30 Ш
от*
0 10 20 30 40 50 60 70 80 90 100 % BEAT, экспонированного на поверхности
Среднее [ОЕФ]
0 12 3 4
0 3 6 9 12 10 10 10 10 10
FSC Антитело против Fc-гамма человека - ФЭ
ш s О
х а
ш х =г ф
о d о. я
О к
о о
S U
Ф н
X 5
X га
о о о
о о
к о.
ш о с
1000 900 800
700 800 500 400 300 200 100
= 0,8773
0 5 10 15 20
Титр IgG в день 1 [мкг/мл]
ш s &
X л
а> х
зг о
о с[
Ф "
о к
> > s
Ц х
-й- го
" ш
О Я"
х Q-
S о
х ?
а> о
Н X
X н
" §
га х
Е ш
<3 m
* о
1000 900
800 700 600 500 400 300 200 100
¦ ¦
¦ ¦
R2 = 0,8598
qP [nr. клетку-1, день"1]
"ООО
s О 900 ¦
? ? 800 ф
§ g R? = 0,8443 у
о ef ! ¦ ' у
g. ш 700
О к
-В- я
5 1 600
ю ¦
о ш
х 9- :"ж Ф
Ш ± илп Ф S
I 500 Ф *
О 400 +
300
X 1_
Ф О
1 и
2 х 200
5 3 100
о Ф
С ¦ <
0 100 200 300 400
Конечный титр IgG в день 7 для серии культивирования
с добавками [мкг/мл]
о О
5 3"
0) Q. О > "
а О 1000
100
••••
•ЛИ
Низкая
Средняя Высокая
S 304
20-
?, 10-
-"Г ИГШИГ "I TI" ЖШДРИЛР
Исходный Низкая
пул
Средняя Высокая
(19)
(19)
(19)
(19)
(19)
100
100
101
104
104
111
114
114
116
116
116
116
116
116
120
120
120
120
<400> 20
gcgcgatcga tacttgttta ttgcagctta taatgg
<400> 20
gcgcgatcga tacttgttta ttgcagctta taatgg
<210> 26
<210> 26
<210> 31
<210> 31
Искусственная последовательность
Искусственная последовательность
Искусственная последовательность
Искусственная последовательность
Искусственная последовательность
Искусственная последовательность
Искусственная последовательность
Искусственная последовательность
Искусственная последовательность
Искусственная последовательность
tgcaattaac aatgctcaag cagaaccccc ggctccatca gcacagtgca ggaccaaacc 360
tgcaattaac aatgctcaag cagaaccccc ggctccatca gcacagtgca ggaccaaacc 360
ggtgaagtgg atcttctcct cggtggtgga cctgaagcag accatcatcc ccgactacag 900
ggtgaagtgg atcttctcct cggtggtgga cctgaagcag accatcatcc ccgactacag 900
agcgacgccc aacctgccat cacgagattt cgattccacc gccgccttct atgaaaggtt 900
agcgacgccc aacctgccat cacgagattt cgattccacc gccgccttct atgaaaggtt 900
agcgacgccc aacctgccat cacgagattt cgattccacc gccgccttct atgaaaggtt 900
ccatgctgca gcagtggggc tgtctgtacg gggtgggcaa tgggaaccgg ggtctgctgg 420
ccatgctgca gcagtggggc tgtctgtacg gggtgggcaa tgggaaccgg ggtctgctgg 420
<210> 48
<210> 48
agcttataat ggttacaaat aaagcaatag catcacaaat ttcacaaata aagcattttt 1680
agcttataat ggttacaaat aaagcaatag catcacaaat ttcacaaata aagcattttt 1680
ctgcagatga actccctgcg ggccgaggac accgccgtgt actactgctc cagatgggga 360
ctgcagatga actccctgcg ggccgaggac accgccgtgt actactgctc cagatgggga 360
ctgcttcagt gctgccatgc agccacacat cctgagagct gaaagggtcg gcgtcctcac 480
ctgcttcagt gctgccatgc agccacacat cctgagagct gaaagggtcg gcgtcctcac 480
cttataatgg ttacaaataa agcaatagca tcacaaattt cacaaataaa gcattttttt 1020
cttataatgg ttacaaataa agcaatagca tcacaaattt cacaaataaa gcattttttt 1020
<400> 55
<400> 55
ggctcctgct gcttcagtgc tgccatgcag ccacacatcc tgagagctga aagggtcggc 480
ggctcctgct gcttcagtgc tgccatgcag ccacacatcc tgagagctga aagggtcggc 480
acgaggcctc cagagagaca aacaactccc tgaccttcgg ccccgaggaa gccctggctg 780
acgaggcctc cagagagaca aacaactccc tgaccttcgg ccccgaggaa gccctggctg 780
tgcaattaac aatgctcaag cagaaccccc ggctccatca gcacagtgca ggaccaaacc 360
tgcaattaac aatgctcaag cagaaccccc ggctccatca gcacagtgca ggaccaaacc 360
ccgccgcctt ctatgaaagg ttgggcttcg gaatcgtttt ccgggacgcc ggctggatga 900
ccgccgcctt ctatgaaagg ttgggcttcg gaatcgtttt ccgggacgcc ggctggatga 900
<400> 63
ctgtctccgg gtaaatgatg aaagcttggt aggtgatcct cctgctgctt tggttcaggg 60
<400> 63
ctgtctccgg gtaaatgatg aaagcttggt aggtgatcct cctgctgctt tggttcaggg 60
cctcgcggac agttaagaac ccaggggcct ctgcgcctgg gcccagctct gtcccacacc 180
tgagtggcat gagggaggca gagcgggtc 2009
cctcgcggac agttaagaac ccaggggcct ctgcgcctgg gcccagctct gtcccacacc 180
tgagtggcat gagggaggca gagcgggtc 2009
cctcgcggac agttaagaac ccaggggcct ctgcgcctgg gcccagctct gtcccacacc 180
tgagtggcat gagggaggca gagcgggtc 2009
ctcaggatct cttttcccag ggagatccct cggcccaaag agggagatgg caatgctgga 240
ctcaggatct cttttcccag ggagatccct cggcccaaag agggagatgg caatgctgga 240
tgtgtgcaca ataattcaac aggcattgga acttcagcat cgatgctgaa tgcaattaac 300
tgtgtgcaca ataattcaac aggcattgga acttcagcat cgatgctgaa tgcaattaac 300
gtcctcacct ggtgcacacc gtagctctgc cccacagctt taaggcacct ggctaacctc 540
gtcctcacct ggtgcacacc gtagctctgc cccacagctt taaggcacct ggctaacctc 540
tgcgcttctt cccttccctc ctccctggct caggtggtgg tggatctccc cccgaggacc 600
tgcgcttctt cccttccctc ctccctggct caggtggtgg tggatctccc cccgaggacc 600
<400> 83
ctgtctccgg gtaaatgatg aaagcttggt aggtgatcct cctgctgctt tggttcaggg 60
<400> 83
ctgtctccgg gtaaatgatg aaagcttggt aggtgatcct cctgctgctt tggttcaggg 60
gtcctcacct ggtgcacacc gtagctctgc cccacagctt taaggcacct ggctaacctc 540
gtcctcacct ggtgcacacc gtagctctgc cccacagctt taaggcacct ggctaacctc 540
tgcgcttctt cccttccctc ctccctggct caggtggtgg tggatctccc cccgaggacc 600
tgcgcttctt cccttccctc ctccctggct caggtggtgg tggatctccc cccgaggacc 600
<400> 87
ctgtctccgg gtaaatgatg aaagcttggt aggtgatcct cctgctgctt tggttcaggg 60
<400> 87
ctgtctccgg gtaaatgatg aaagcttggt aggtgatcct cctgctgctt tggttcaggg 60
gtcctcacct ggtgcacacc gtagctctgc cccacagctt taaggcacct ggctaacctc 540
gtcctcacct ggtgcacacc gtagctctgc cccacagctt taaggcacct ggctaacctc 540
tgcgcttctt cccttccctc ctccctggct caggtggtgg tggatctccc cccgaggacc 600
tgcgcttctt cccttccctc ctccctggct caggtggtgg tggatctccc cccgaggacc 600
<400> 91
ctgtctccgg gtaaatgatg aaagcttggt aggtgatcct cctgctgctt tggttcaggg 60
<400> 91
ctgtctccgg gtaaatgatg aaagcttggt aggtgatcct cctgctgctt tggttcaggg 60
gtcctcacct ggtgcacacc gtagctctgc cccacagctt taaggcacct ggctaacctc 540
gtcctcacct ggtgcacacc gtagctctgc cccacagctt taaggcacct ggctaacctc 540
tgcgcttctt cccttccctc ctccctggct caggtggtgg tggatctccc cccgaggacc 600
tgcgcttctt cccttccctc ctccctggct caggtggtgg tggatctccc cccgaggacc 600
ataaagcatt tttttcactg cattctagtt gtggtttgtc caaactcatc aatgtatctt 1080
ataaagcatt tttttcactg cattctagtt gtggtttgtc caaactcatc aatgtatctt 1080
<400> 95
ctgtctccgg gtaaatgatg aaagcttggt aggtgatcct cctgctgctt tggttcaggg 60
<400> 95
ctgtctccgg gtaaatgatg aaagcttggt aggtgatcct cctgctgctt tggttcaggg 60
gtcctcacct ggtgcacacc gtagctctgc cccacagctt taaggcacct ggctaacctc 540
gtcctcacct ggtgcacacc gtagctctgc cccacagctt taaggcacct ggctaacctc 540
tgcgcttctt cccttccctc ctccctggct caggtggtgg tggatctccc cccgaggacc 600
tgcgcttctt cccttccctc ctccctggct caggtggtgg tggatctccc cccgaggacc 600
ataaagcatt tttttcactg cattctagtt gtggtttgtc caaactcatc aatgtatctt 1080
ataaagcatt tttttcactg cattctagtt gtggtttgtc caaactcatc aatgtatctt 1080
<400> 99
ctgtctccgg gtaaatgatg aaagcttggt aggtgatcct cctgctgctt tggttcaggg 60
<400> 99
ctgtctccgg gtaaatgatg aaagcttggt aggtgatcct cctgctgctt tggttcaggg 60
gtcctcacct ggtgcacacc gtagctctgc cccacagctt taaggcacct ggctaacctc 540
gtcctcacct ggtgcacacc gtagctctgc cccacagctt taaggcacct ggctaacctc 540
tgcgcttctt cccttccctc ctccctggct caggtggtgg tggatctccc cccgaggacc 600
tgcgcttctt cccttccctc ctccctggct caggtggtgg tggatctccc cccgaggacc 600
catttttttc actgcattct agttgtggtt tgtccaaact catcaatgta tcttatcatg 1080
catttttttc actgcattct agttgtggtt tgtccaaact catcaatgta tcttatcatg 1080
ttttgcttga gggggggggg tggtgatttc cttgccatgg gcagactgag cagaaaaggc 120
ttttgcttga gggggggggg tggtgatttc cttgccatgg gcagactgag cagaaaaggc 120
tgcgcttctt cccttccctc ctccctggct caggtggtgg tggatctccc cccgaggacc 600
tgcgcttctt cccttccctc ctccctggct caggtggtgg tggatctccc cccgaggacc 600
cccctgactc caagaatgtg atgtccgtgg ccaccatcgt gatcgtggac atctgcatca 660
cccctgactc caagaatgtg atgtccgtgg ccaccatcgt gatcgtggac atctgcatca 660
tcatcaatgt atcttatcat gtctgt 1106
tcatcaatgt atcttatcat gtctgt 1106
cccctgactc caagaatacc ctggtgctgt tcggcgctgg cttcggcgcc accgtgatcg 660
cccctgactc caagaatacc ctggtgctgt tcggcgctgg cttcggcgcc accgtgatcg 660
atgtctgt 1088
atgtctgt 1088
cattgggacc atgttctgaa tgcctccacc tcaaccaccg gccggtagga ccaaagccac 180
cattgggacc atgttctgaa tgcctccacc tcaaccaccg gccggtagga ccaaagccac 180
cccctgactc caagaatacc ctggtgctgt tcggcgctgg cttcggcgcc gtgattaccg 660
cccctgactc caagaatacc ctggtgctgt tcggcgctgg cttcggcgcc gtgattaccg 660
ttttgcttga gggggggggg tggtgatttc cttgccatgg gcagactgag cagaaaaggc 120
ttttgcttga gggggggggg tggtgatttc cttgccatgg gcagactgag cagaaaaggc 120
cattgggacc atgttctgaa tgcctccacc tcaaccaccg gccggtagga ccaaagccac 180
cattgggacc atgttctgaa tgcctccacc tcaaccaccg gccggtagga ccaaagccac 180
tggtcgtgat cgtcgtgatt atcatgttcc tgaccctgaa gggctccctg aagcagaggc 720
tggtcgtgat cgtcgtgatt atcatgttcc tgaccctgaa gggctccctg aagcagaggc 720
tgcaggtgat gatccagccc tccgaggaca tcgtgaggcc cgagaacggc cccgagcagc 780
tgcaggtgat gatccagccc tccgaggaca tcgtgaggcc cgagaacggc cccgagcagc 780
tgcaattaac aatgctcaag cagaaccccc ggctccatca gcacagtgca ggaccaaacc 360
tgcaattaac aatgctcaag cagaaccccc ggctccatca gcacagtgca ggaccaaacc 360
ccctgaccct gtccggcagg cccaggcccg aggagtcccc cagggacctg gagctggccg 900
ccctgaccct gtccggcagg cccaggcccg aggagtcccc cagggacctg gagctggccg 900
<210> 123 <211> 1049
<210> 123 <211> 1049
tgcaattaac aatgctcaag cagaaccccc ggctccatca gcacagtgca ggaccaaacc 360
tgcaattaac aatgctcaag cagaaccccc ggctccatca gcacagtgca ggaccaaacc 360
ccatgctgca gcagtggggc tgtctgtacg gggtgggcaa tgggaaccgg ggtctgctgg 420
ccatgctgca gcagtggggc tgtctgtacg gggtgggcaa tgggaaccgg ggtctgctgg 420
accaagcgac gcccaacctg ccatcacgag atttcgattc caccgccgcc ttctatgaaa 900
accaagcgac gcccaacctg ccatcacgag atttcgattc caccgccgcc ttctatgaaa 900
<400> 140
Leu Ser Leu Ser Pro Gly Gly Gly Gly Ser Pro Pro Glu Asp Pro Pro
1 5 10 15
<400> 140
Leu Ser Leu Ser Pro Gly Gly Gly Gly Ser Pro Pro Glu Asp Pro Pro
1 5 10 15
<400> 140
Leu Ser Leu Ser Pro Gly Gly Gly Gly Ser Pro Pro Glu Asp Pro Pro
1 5 10 15
<220>
<223> GSC11758
<220>
<223> GSC11758
Asp Ser Lys Asn Thr Leu Val Leu Phe Gly Ala Gly Phe Gly Ala Val
20 25 30
Asp Ser Lys Asn Thr Leu Val Leu Phe Gly Ala Gly Phe Gly Ala Val
20 25 30
Phe Gln Gln Lys Leu Arg Ser Val Phe Arg Val Pro Ile Thr Trp Leu
50 55 60
Phe Gln Gln Lys Leu Arg Ser Val Phe Arg Val Pro Ile Thr Trp Leu
50 55 60
Phe Gln Gln Lys Leu Arg Ser Val Phe Arg Val Pro Ile Thr Trp Leu
50 55 60
<210> 174 <211> 23
<210> 174 <211> 23
<400> 178
<400> 178
Gly Leu Leu Ile Gly Ile Ser Ile Ala Ser Leu Cys Leu Val Val Ala
1 5 10 15
Gly Leu Leu Ile Gly Ile Ser Ile Ala Ser Leu Cys Leu Val Val Ala
1 5 10 15
<220>
<220>
Phe Val Leu Leu Leu
Phe Val Leu Leu Leu
<211> 26
<211> 26
205
<400>
205
<400>
205
<400>
205
<400>
205
<400>
205
<400>
205
<400>
<220>
<220>
<220>
<220>
<220>
<220>
<210> 219 <211> 39
<210> 219 <211> 39
tcggtg
tcggtg
<220>
<220>
agcagtacc
agcagtacc
<211> 65
<211> 65
<400> 250
caggaccggt gcttgcagaa gcacttccag atcagcagca gggccagtcc aatcagcacg
<400> 250
caggaccggt gcttgcagaa gcacttccag atcagcagca gggccagtcc aatcagcacg
atgcc
atgcc
gaaagggtcg gcgtcctcac ctggtgcaca ccgtagctct gccccacagc tttaaggcac 240
gaaagggtcg gcgtcctcac ctggtgcaca ccgtagctct gccccacagc tttaaggcac 240
cccccgagga cccccctgac tccaagaatc tgatcattgc cctgcctgtg gccgtgctgc 360
cccccgagga cccccctgac tccaagaatc tgatcattgc cctgcctgtg gccgtgctgc 360
tgatcgtggg aggcctcgtg atcatgctgt acgtgttcca caagtgcttc tgcaagcacc 420
tgatcgtggg aggcctcgtg atcatgctgt acgtgttcca caagtgcttc tgcaagcacc 420
<220>
<220>
402
tcgccgtgct gctggccctg aagtgcttct gcaagcaccg
402
tcgccgtgct gctggccctg aagtgcttct gcaagcaccg
402
tcgccgtgct gctggccctg aagtgcttct gcaagcaccg
<211> 165
<211> 165
aagaagaggc agatctacac cgacatcgag atgaacaggc tgggcaagtg atgattcgaa 120
aagaagaggc agatctacac cgacatcgag atgaacaggc tgggcaagtg atgattcgaa 120
225 230 235
225 230 235
225 230 235
225
235
240
230
225
235
240
230
Thr Val Pro Ser Ser Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val
210 215 220
Thr Val Pro Ser Ser Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val
210 215 220
Leu Ser Pro Gly Lys
465
Leu Ser Pro Gly Lys
465
65 70 75
65 70 75
65 70 75
65 70 75
<220>
<223> GSC23
<220>
<223> GSC23
<220>
<223> Праймер GlnPr2162
<220>
<223> Праймер GlnPr2162
<220>
<223> GlnPr1487
<220>
<223> GlnPr1487
Val Val Ile Ile Ala Ser Ala His His His His His His
35 40 45
Val Val Ile Ile Ala Ser Ala His His His His His His
35 40 45
Val Val Ile Ile Ala Ser Ala His His His His His His
35 40 45
<220>
<223> pGLEX41_HC-GGC-I4(polyA)-B7-B7(20)-6His
<220>
<223> pGLEX41_HC-GGC-I4(polyA)-B7-B7(20)-6His
<220>
<223> pGLEX41_HC-GGC-I4(polyA)-B7-B7(20)-6His
<220>
<223> pGLEX41_HC-GGC-I4(polyA)-B7-B7(20)-6His
<400> 336
<400> 336
<210> 338
<210> 338
ctcatgctgg agttcttcgc ccaccccaac ttgtttattg cagcttataa tggttacaaa 480
ctcatgctgg agttcttcgc ccaccccaac ttgtttattg cagcttataa tggttacaaa 480
ctcatgctgg agttcttcgc ccaccccaac ttgtttattg cagcttataa tggttacaaa 480
Leu Ser Pro Gly Gly Gly Gly Ser Pro Pro Glu Asp Pro Pro Asp Ser
Leu Ser Pro Gly Gly Gly Gly Ser Pro Pro Glu Asp Pro Pro Asp Ser
121
121
1/31
Фигура 1
1/31
Фигура 1
1/31
Фигура 1
1/31
Фигура 1
1/31
Фигура 1
1/31
Фигура 1
1/31
Фигура 1
1/31
Фигура 1
2/31
Фигура 2
2/31
Фигура 2
2/31
Фигура 2
2/31
Фигура 2
2/31
Фигура 2
2/31
Фигура 2
3/31
Фигура 3
3/31
Фигура 3
3/31
Фигура 3
3/31
Фигура 3
4/31
Фигура 4
4/31
Фигура 4
4/31
Фигура 4
4/31
Фигура 4
4/31
Фигура 4
4/31
Фигура 4
4/31
Фигура 4
4/31
Фигура 4
4/31
Фигура 4
4/31
Фигура 4
5/31
Фигура 4 (продолжение)
5/31
Фигура 4 (продолжение)
5/31
Фигура 4 (продолжение)
5/31
Фигура 4 (продолжение)
5/31
Фигура 4 (продолжение)
5/31
Фигура 4 (продолжение)
6/31
6/31
7/31
Фигура 6
7/31
Фигура 6
7/31
Фигура 6
7/31
Фигура 6
7/31
Фигура 6
7/31
Фигура 6
7/31
Фигура 6
7/31
Фигура 6
8/31
Фигура 6 (продолжение)
8/31
Фигура 6 (продолжение)
8/31
Фигура 6 (продолжение)
8/31
Фигура 6 (продолжение)
9/31
Фигура 7
120
9/31
Фигура 7
120
9/31
Фигура 7
120
9/31
Фигура 7
120
9/31
Фигура 7
120
9/31
Фигура 7
120
9/31
Фигура 7
120
9/31
Фигура 7
120
9/31
Фигура 7
120
9/31
Фигура 7
120
9/31
Фигура 7
120
9/31
Фигура 7
120
10/31
Фигура 8
10/31
Фигура 8
10/31
Фигура 8
10/31
Фигура 8
10/31
Фигура 8
10/31
Фигура 8
10/31
Фигура 8
10/31
Фигура 8
10/31
Фигура 8
10/31
Фигура 8
10/31
Фигура 8
10/31
Фигура 8
11/31
Фигура 9
11/31
Фигура 9
11/31
Фигура 9
11/31
Фигура 9
11/31
Фигура 9
11/31
Фигура 9
12/31
Фигура 10
12/31
Фигура 10
13/31
Фигура 11
13/31
Фигура 11
14/31
Фигура 11 (продолжение)
14/31
Фигура 11 (продолжение)
4> ^ ^
4> ^ ^
14/31
Фигура 11 (продолжение)
14/31
Фигура 11 (продолжение)
4> ^ ^
4> ^ ^
14/31
Фигура 11 (продолжение)
14/31
Фигура 11 (продолжение)
4> ^ ^
4> ^ ^
15/31
Фигура 12
15/31
Фигура 12
16/31
Фигура 12 (продолжение)
16/31
Фигура 12 (продолжение)
16/31
Фигура 12 (продолжение)
16/31
Фигура 12 (продолжение)
16/31
Фигура 12 (продолжение)
16/31
Фигура 12 (продолжение)
17/31
Фигура 13
17/31
Фигура 13
17/31
Фигура 13
17/31
Фигура 13
17/31
Фигура 13
17/31
Фигура 13
17/31
Фигура 13
17/31
Фигура 13
17/31
Фигура 13
17/31
Фигура 13
18/31
Фигура 14
18/31
Фигура 14
19/31
Фигура 15
19/31
Фигура 15
19/31
Фигура 15
19/31
Фигура 15
19/31
Фигура 15
19/31
Фигура 15
19/31
Фигура 15
19/31
Фигура 15
19/31
Фигура 15
19/31
Фигура 15
20/31
Фигура 16
20/31
Фигура 16
20/31
Фигура 16
20/31
Фигура 16
21/31
Фигура 16 (продолжение)
21/31
Фигура 16 (продолжение)
^ ^ -4°
^ ^ -4°
21/31
Фигура 16 (продолжение)
21/31
Фигура 16 (продолжение)
^ ^ -4°
^ ^ -4°
21/31
Фигура 16 (продолжение)
21/31
Фигура 16 (продолжение)
^ ^ -4°
^ ^ -4°
22/31
Фигура 17
22/31
Фигура 17
22/31
Фигура 17
22/31
Фигура 17
22/31
Фигура 17
22/31
Фигура 17
22/31
Фигура 17
22/31
Фигура 17
24/31
Фигура 19
24/31
Фигура 19
25/31
Фигура 20
25/31
Фигура 20
25/31
Фигура 20
25/31
Фигура 20
26/31
26/31
27/31
27/31
27/31
27/31
28/31
Фигура 23
28/31
Фигура 23
29/31
Фигура 24
29/31
Фигура 24
30/31
Фигура 25
30/31
Фигура 25
30/31
Фигура 25
30/31
Фигура 25
30/31
Фигура 25
30/31
Фигура 25
30/31
Фигура 25
30/31
Фигура 25
30/31
Фигура 25
30/31
Фигура 25
30/31
Фигура 25
30/31
Фигура 25
31/31
Фигура 26
31/31
Фигура 26