Патентная документация ЕАПВ

 
Запрос :  ea201492053a*\id

больше ...
Термины запроса в документе


Полный текст патента

(57) Реферат / Формула:

Настоящее изобретение относится к фармакологически активным стабильным белкам фактора роста фибробластов 21 (FGF21) человека, фармацевтическим композициям, содержащим белки FGF21, и способам лечения диабета 2-го типа, ожирения, дислипидемии и/или метаболического синдрома с применением таких белков.


БЕЛКИ ФАКТОРА РОСТА ФИБРОБЛАСТОВ 21
Настоящее изобретение относится к белкам фактора роста фибробластов 21 (FGF21), фармацевтическим композициям, содержащим белки FGF21, и способам лечения диабета 2-го типа, ожирения, дислипидемии и/или метаболического синдрома.
FGF21 представляет собой гормон, функционирующий в качестве важного метаболического регулятора гомеостаза глюкозы и липидов. FGF21 способствует усвоению глюкозы в адипоцитах за счет повышающей регуляции экспрессии GLUT1, механизма, отличного от механизма действия инсулина. У грызунов и обезьян с диабетом FGF21 человека понижал концентрации глюкозы в сыворотке натощак и концентрации триглицеридов, инсулина и глюкагона в сыворотке натощак. Кроме того, в моделях индуцированного диетой ожирения на грызунах введение FGF21 приводило к кумулятивной потере массы тела дозозависимым образом. Соответственно, FGF21 потенциально подходит для лечения диабета, ожирения, дислипидемии и метаболического синдрома.
Белки FGF21 были описаны в WO2010/042747, WO2010/285131 и WO2009/149171.
Проблемы, связанные с FGF21 человека и известными белками FGF21 дикого типа, заключаются в коротком периоде полужизни in vivo, низкой активности и/или фармацевтической нестабильности указанных молекул. Соответственно, все еще существует потребность в альтернативных белках FGF21, которые обладали бы длительным действием, активностью и/или стабильностью.
В настоящем изобретении предложены альтернативные белки FGF21. Определенные белки FGF21 согласно настоящему изобретению обладают преимуществами относительно FGF21 человека дикого типа и известных белков FGF21, раскрытых в данной области техники. Указанные преимущества включают продолжительный период полужизни, повышенную активность и/или повышенную фармацевтическая стабильность. Помимо повышенной активности определенные белки FGF21 согласно настоящему изобретению обладают одной или несколькими предпочтительными характеристиками стабильности, подходящими для эффективного получения и/или приготовления состава с терапевтическим белком, включая уменьшение протеолитического разложения in vivo, уменьшение восприимчивости к окислению, снижение тенденции к агрегации при высоких концентрациях, пониженные уровни посттрансляционных модификаций и протеолиза при получении в системах на основе клеток млекопитающих, и/или улучшенную химическую стабильность. Кроме того, белки
FGF21 согласно настоящему изобретению потенциально подходят для лечения диабета 2-го типа, ожирения, дислипидемии и/или метаболического синдрома.
В настоящем изобретении предложен белок FGF21, отличающийся тем, что последовательность аминокислот состоит из первого полипептида, соединенного со вторым полипептидом, при этом первый полипептид содержит Fc-фрагмент IgG4, отличающийся тем, что указанный фрагмент Fc состоит из шарнирной области, доменов СН2 и СНЗ константной области антитела, второй полипептид содержит белок FGF21, имеющий последовательность аминокислот SEQ ID NO: 1, и при этом С-конец первого полипептида соединен с N-концом второго полипептида посредством линкера.
Далее, в настоящем изобретении предложен белок FGF21, отличающийся тем, что последовательность аминокислот состоит из первого полипептида, соединенного со вторым полипептидом, при этом первый полипептид содержит Fc-фрагмент IgG4, имеющий последовательность аминокислот SEQ ID NO: 14, второй полипептид содержит белок FGF21, имеющий последовательность аминокислот SEQ ID NO: 1, и при этом С-конец первого полипептида соединен с N-концом второго полипептида посредством линкера.
Также в настоящем изобретении предложен белок FGF21, отличающийся тем, что последовательность аминокислот состоит из первого полипептида, соединенного со вторым полипептидом, при этом первый полипептид содержит Fc-фрагмент IgG4, имеющий последовательность аминокислот SEQ ID NO: 14, второй полипептид содержит белок FGF21, имеющий последовательность аминокислот SEQ ID NO: 1, и при этом С-конец первого полипептида соединен с N-концом второго полипептида посредством линкера, имеющего последовательность аминокислот SEQ ID NO: 11.
В настоящем изобретении предложен белок FGF21, отличающийся следующей последовательностью аминокислот:
ESKYGPPCPPCPAPEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWY VDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTIS KAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPP
VLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGGGGGSG GGGSGGGGSAHPIPDSSPLLOFGGOVRORYLYTDDAQQTECHLEIREDGTVGCAAD QSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFREDLKEDGYNV YQSEAHGLPLHLPGDKSPHRKPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLR LVEPSQLRSPSFE (SEQ ID NO: 5).
Белок FGF21, соответствующий последовательности SEQ ID NO: 5 согласно описанию выше содержит последовательность Fc-фрагмента IgG4, соответствующую последовательности SEQ ID NO: 14, последовательность линкера, соответствующую последовательности SEQ ID NO: 11, которая выделена жирным шрифтом, и белок FGF21, соответствующий подчеркнутой последовательности SEQ ID NO: 1.
Дополнительно в настоящем изобретении предложен белок FGF21, отличающийся следующей последовательностью аминокислот:
ESKYGPPCPPCPAPEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWY
VDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTIS
KAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPP
VLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGGGGGSGGG
GSGGGGSAHPIPDSSPLLQFGGQVRQRYLYTDDAQQTECHLEIREDGTVGCAADQSPES
LLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFREXiLX2EDGYNVYQS
EAHGLPLHLPGDKSPHRKPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLRLVE
PSQLX3SPSFX4X5 (SEQ ID NO: 15)
где Xi представляет собой L или D, Х2 представляет собой L или К, Хз представляет собой R или L, Х4 представляет собой L или Е, и Х5 представляет собой G или отсутствует. Также в настоящем изобретении предложен белок FGF21, соответствующий последовательности SEQ ID NO: 15, отличающийся тем, что Xi представляет собой D, Х2 представляет собой L или К, Хз представляет собой L, Х4 представляет собой L, и Х5 представляет собой G. Далее, в настоящем изобретении предложен белок FGF21, соответствующий последовательности SEQ ID NO: 15, где Xi представляет собой L или D, Х2 представляет собой L или К, Хз представляет собой R, Х4 представляет собой Е, и Х5 отсутствует.
В настоящем изобретении предложен белок FGF21, соответствующий последовательности SEQ ID NO: 15, отличающийся тем, что указанный белок FGF21 выбран из группы, состоящей из SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, и SEQ ID NO: 9. Также в настоящем изобретении предложен белок FGF21, соответствующий последовательности SEQ ID NO: 15, отличающийся тем, что указанный белок FGF21 выбран из группы, состоящей из SEQ ID NO: 8 и SEQ ID NO: 9. Дополнительно в настоящем изобретении предложен белок FGF21, соответствующий последовательности SEQ ID NO: 15, отличающийся тем, что указанный белок FGF21 выбран из группы, состоящей из SEQ ID NO: 5, SEQ ID NO: 6 и SEQ ID NO: 7. Наиболее предпочтительным является белок FGF21, соответствующий последовательности SEQ ID NO: 5.
Также в настоящем изобретении предложена фармацевтическая композиция, содержащая белок FGF21 согласно настоящему изобретению и по меньшей мере один фармацевтически приемлемый носитель, разбавитель или вспомогательное вещество.
Также в настоящем изобретении предложен способ лечения диабета 2-го типа, ожирения, дислипидемии и/или метаболического синдрома у пациента, включающий введение указанному пациенту белка FGF21 согласно настоящему изобретению.
Также в настоящем изобретении предложен способ лечения диабета 2-го типа, ожирения, дислипидемии и/или метаболического синдрома у пациента, включающий введение указанному пациенту фармацевтической композиции согласно настоящему изобретению.
Дополнительно в настоящем изобретении предложен белок FGF21 согласно настоящему изобретению для применения в терапии. Предпочтительно в настоящем изобретении предложен белок FGF21 согласно настоящему изобретению для применения при лечении диабета 2-го типа, ожирения, дислипидемии и/или метаболического синдрома.
Дополнительно в настоящем изобретении предложено применение белка FGF21 согласно настоящему изобретению для получения лекарственного средства для лечения диабета 2-го типа, ожирения, дислипидемии и/или метаболического синдрома.
Настоящее изобретение также относится к полинуклеотидам, кодирующим описанный выше белок FGF21 согласно настоящему изобретению.
Дополнительно в настоящем изобретении предложен полинуклеотид, кодирующий белок FGF21 согласно настоящему изобретению, отличающийся тем, что последовательность аминокислот указанного белка FGF21 состоит из первого полипептида, соединенного со вторым полипептидом, при этом первый полипептид содержит Fc-фрагмент IgG4, отличающийся тем, что указанный фрагмент Fc состоит из шарнирной области, доменов СН2 и СНЗ константной области антитела, второй полипептид содержит белок FGF21, имеющий последовательность аминокислот SEQ ID NO: 1, и при этом С-конец первого полипептида соединен с N-концом второго полипептида посредством линкера.
Также в настоящем изобретении предложен полинуклеотид, кодирующий белок FGF21 согласно настоящему изобретению, отличающийся тем, что последовательность аминокислот указанного белка FGF21 состоит из первого полипептида, соединенного со вторым полипептидом, при этом первый полипептид содержит Fc-фрагмент IgG4, имеющий последовательность аминокислот SEQ ID N0: 14, второй полипептид содержит белок FGF21, имеющий последовательность аминокислот SEQ ID NO: 1, и при этом С
конец первого полипептида соединен с N-концом второго полипептида посредством линкера.
Дополнительно в настоящем изобретении предложен полинуклеотид, кодирующий белок FGF21 согласно настоящему изобретению, отличающийся тем, что последовательность аминокислот указанного белка FGF21 состоит из первого полипептида, соединенного со вторым полипептидом, при этом первый полипептид содержит Fc-фрагмент IgG4, имеющий последовательность аминокислот SEQ ID NO: 14, второй полипептид содержит белок FGF21, имеющий последовательность аминокислот SEQ ID NO: 1, и при этом С-конец первого полипептида соединен с N-концом второго полипептида посредством линкера, имеющего последовательность аминокислот SEQ ID NO: 11.
Дополнительно в настоящем изобретении предложен полинуклеотид, кодирующий белок FGF21 согласно настоящему изобретению, отличающийся тем, что последовательность аминокислот указанного белка FGF21 представлена последовательностью:
ESKYGPPCPPCPAPEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQ FNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSS IEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNY KTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGGGG GSGGGGSGGGGSAHPIPDSSPLLQFGGOVRORYLYTDDAQQTECHLEIREDGTVGCA ADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFREDLKEDGY NVYOSEAHGLPLHLPGDKSPHRKPAPRGPARFLPLPGLPPALPEPPGILAPOPPDVGSSDP LRLVEPSOLRSPSFE (SEQ ID NO: 5).
Также в настоящем изобретении предложен полинуклеотид, кодирующий белок FGF21 согласно настоящему изобретению, отличающийся тем, что последовательность нуклеотидов представлена последовательностью SEQ ID NO: 13.
Полинуклеотиды, кодирующие описанные выше белки могут находиться в форме РНК или в форме ДНК, причем ДНК включает кДНК и синтетическую ДНК. Указанная ДНК может быть двуцепочечной или одноцепочечной. Последовательности, кодирующие белки согласно настоящему изобретению могут варьировать в результате избыточности или вырожденности генетического кода.
Полинуклеотиды, кодирующие белки согласно настоящему изобретению, могут включать следующие: только кодирующая последовательность указанных белков, кодирующая последовательность указанных белков и дополнительная кодирующая
последовательность, например, лидерная или секреторная последовательность или последовательность пропротеина; кодирующая последовательность указанных белков и некодирующая последовательность, например, интроны, или некодирующая последовательность в направлении 5' и/или 3' от кодирующей последовательности указанных белков. Соответственно, термин "полинуклеотид, кодирующий белок" охватывает полинуклеотид, который может содержать не только кодирующую последовательность указанных белков, но и полинуклеотид, содержащий дополнительную кодирующую и/или некодирующую последовательность, например, SEQ ID NO: 13.
Полинуклеотиды согласно настоящему изобретению экспрессируются в клетке-хозяине после функционального связывания последовательностей с контролирующей экспрессию последовательностью. Экспрессионные векторы, как правило, реплицируют в организмах-хозяевах либо в виде эписом, либо в виде составной части хромосомной ДНК хозяина. Обычно экспрессионные векторы содержат селективные маркеры, например, тетрациклин, неомицин и дигидрофолатредуктазу, позволяющие обнаружение клеток, трансформированных нужными последовательностями ДНК.
Белки FGF21 согласно настоящему изобретению могут легко быть получены в клетках млекопитающих, таких как клетки СНО, NSO, НЕК293 или COS; в бактериальных клетках, таких как Е. coli, Bacillus subtilis или Pseudomonas fluorescence; или в клетках грибов или дрожжей. Клетки-хозяева культивируют с применением техник, хорошо известных в данной области техники. Предпочтительными клетками-хозяевами из клеток млекопитающих является линия клеток CHOK1SV, содержащая систему экспрессии глутаминсинтетазы (ГС) (см. US 5122464).
Векторы, содержащие представляющие интерес полинуклеотидные последовательности (например, белки FGF21 и последовательности контроля экспрессии) могут быть перенесены в клетку-хозяина с помощью хорошо известных способов, которые различаются в зависимости от типа клетки-хозяина. Например, в случае прокариотических клеток обычно используют трансформацию с применением хлорида кальция, тогда как для других клеток-хозяев может применяться обработка фосфатом кальция или электропорация.
Могут быть использованы различные способы очистки белка; такие способы известны в данной области техники и описаны, например, у Deutscher, Methods in Enzymology 182: 83-89 (1990) и Scopes, Protein Purification: Principles and Practice, 3rd Edition, Springer, NY (1994).
Также в настоящем изобретении предложен способ получения гомодимера, в котором последовательность аминокислот каждого полипептида указанного гомодимера
представлена последовательностью SEQ ID NO: 5; причем указанный способ включает следующие этапы:
i) культивирование клетки-хозяина млекопитающего, содержащей полинуклеотид, кодирующий полипептид, имеющий последовательность аминокислот SEQ ID NO: 5 в условиях, обеспечивающих экспрессию указанной полипептидной последовательности; и
й) выделение из указанной клетки-хозяина гомодимера, последовательность аминокислот каждого полипептида которого представлена последовательностью SEQ ID NO: 5.
Белок FGF21 согласно настоящему изобретению представляет собой гомодимер при экспрессировании в клетках млекопитающих. "Гомодимер" в настоящем документе относится к двум белкам FGF21 согласно настоящему изобретению, имеющим одинаковую последовательность аминокислот (например SEQ ID NO: 5), связанных за счет нековалентных взаимодействий и межмолекулярных дисульфидных связей в Fc-фрагменте.
В настоящем изобретении предложен гомодимер белка FGF21, отличающийся тем, что последовательность аминокислот состоит из первого полипептида, соединенного со вторым полипептидом, при этом первый полипептид содержит Fc-фрагмент IgG4, отличающийся тем, что указанный фрагмент Fc состоит из шарнирной области, доменов СН2 и СНЗ константной области антитела, второй полипептид содержит белок FGF21, имеющий последовательность аминокислот SEQ ID NO: 1, и при этом С-конец первого полипептида соединен с N-концом второго полипептида посредством линкера.
Дополнительно в настоящем изобретении предложен гомодимер белка FGF21, отличающийся тем, что последовательность аминокислот состоит из первого полипептида, соединенного со вторым полипептидом, при этом первый полипептид содержит Fc-фрагмент IgG4, имеющий последовательность аминокислот SEQ ID NO: 14, второй полипептид содержит белок FGF21, имеющий последовательность аминокислот SEQ ID NO: 1, и при этом С-конец первого полипептида соединен с N-концом второго полипептида посредством линкера.
Также в настоящем изобретении предложен гомодимер белка FGF21, отличающийся тем, что последовательность аминокислот состоит из первого полипептида, соединенного со вторым полипептидом, при этом первый полипептид содержит Fc-фрагмент IgG4, имеющий последовательность аминокислот SEQ ID NO: 14, второй полипептид содержит белок FGF21, имеющий последовательность аминокислот SEQ ID NO: 1, и при этом С-конец первого полипептида соединен с N-концом второго
полипептида посредством линкера, имеющего последовательность аминокислот SEQ ID NO: 11.
В настоящем изобретении предложен гомодимер белка FGF21, отличающийся следующей последовательностью аминокислот:
ESKYGPPCPPCPAPEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWY
VDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTIS
KAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPP
VLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGGGGGSG
GGGSGGGGSAHPIPDSSPLLOFGGOVRORYLYTDDAQQTECHLEIREDGTVGCAAD
OSPESLLOLKALKPGVIOILGVKTSRFLCORPDGALYGSLHFDPEACSFREDLKEDGYNV
YQSEAHGLPLHLPGDKSPHRKPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLR
LVEPSQLRSPSFE (SEQ ID NO: 5).
Белок FGF21, соответствующий последовательности SEQ ID NO: 5 согласно описанию выше, содержит последовательность Fc-фрагмента IgG4, соответствующую последовательности SEQ ID NO: 14, последовательность линкера, соответствующую последовательности SEQ ID NO: 11, которая выделена жирным шрифтом, и белок FGF21, соответствующий подчеркнутой последовательности SEQ ID NO: 1.
Дополнительно в настоящем изобретении предложен гомодимер белка FGF21, отличающийся следующей последовательностью аминокислот
ESKYGPPCPPCPAPEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWY
VDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTIS
KAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPP
VLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGGGGGSGGG
GSGGGGSAHPIPDSSPLLQFGGQVRQRYLYTDDAQQTECHLEIREDGTVGCAADQSPES
LLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFREXiLX2EDGYNVYQS
EAHGLPLHLPGDKSPHRKPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLRLVE
PSQLX3SPSFX4X5 (SEQ ID NO: 15)
где Xi представляет собой L или D, Х2 представляет собой L или К, Хз представляет собой R или L, Х4 представляет собой L или Е, и Х5 представляет собой G или отсутствует. Также в настоящем изобретении предложен гомодимер белка FGF21, соответствующий последовательности SEQ ID NO: 15, где Xi представляет собой D, Хг представляет собой L или К, Хз представляет собой L, Х4 представляет собой L, и Х5 представляет собой G. Дополнительно в настоящем изобретении предложен гомодимер белка FGF21, соответствующий последовательности SEQ ID NO: 15, где Xi представляет собой L или D,
Х2 представляет собой L или К, Хз представляет собой R, Х4 представляет собой Е, и Х5 отсутствует.
В настоящем изобретении предложен гомодимер белка FGF21, соответствующий последовательности SEQ ID NO: 15, причем указанный белок FGF21 выбран из группы, состоящей из SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, и SEQ ID NO: 9. Также в настоящем изобретении предложен гомодимер белка FGF21, соответствующий последовательности SEQ ID NO: 15, причем указанный белок FGF21 выбран из группы, состоящей из SEQ ID NO: 8 и SEQ ID NO: 9. Дополнительно в настоящем изобретении предложен гомодимер белка FGF21, соответствующий последовательности SEQ ID NO: 15, причем указанный белок FGF21 выбран из группы, состоящей из SEQ ID NO: 5, SEQ ID NO: 6 и SEQ ID NO: 7. Наиболее предпочтительным является белок FGF21, соответствующий последовательности SEQ ID NO: 5.
Настоящее изобретение также относится к полинуклеотидам, кодирующим описанный выше гомодимер белка FGF21 согласно настоящему изобретению.
Также в настоящем изобретении предложена фармацевтическая композиция, содержащая гомодимер белка FGF21 согласно настоящему изобретению и по меньшей мере один фармацевтически приемлемый носитель, разбавитель или вспомогательное вещество.
Также в настоящем изобретении предложен способ лечения диабета 2-го типа, ожирения, дислипидемии и/или метаболического синдрома у пациента, включающий введение указанному пациенту гомодимера белка FGF21 согласно настоящему изобретению.
Дополнительно в настоящем изобретении предложен гомодимер белка FGF21 согласно настоящему изобретению для применения в терапии. Предпочтительно в настоящем изобретении предложен гомодимер белка FGF21 согласно настоящему изобретению для применения при лечении диабета 2-го типа, ожирения, дислипидемии и/или метаболического синдрома.
Дополнительно в настоящем изобретении предложено применение гомодимера белка FGF21 согласно настоящему изобретению при получении лекарственного средства для лечения диабета 2-го типа, ожирения, дислипидемии и/или метаболического синдрома.
Fc-фрагмент белков FGF21 согласно настоящему изобретению может быть гликозилирован по высококонсервативному участку N-гликозилирования. Дополнительно белки FGF21 согласно настоящему изобретению представляют собой гомодимер при экспрессировании в клетках млекопитающих. "Гомодимер" в настоящем документе
относится к двум белкам FGF21 согласно настоящему изобретению, имеющим одинаковую последовательность аминокислот, например SEQ ID NO: 5, связанных за счет нековалентных взаимодействий и межмолекулярных дисульфидных связей в Fc-фрагменте.
Полноразмерный FGF21 человека дикого типа представляет собой полипептид длиной 208 аминокислот, содержащий сигнальный пептид из 27 аминокислот. Зрелый FGF21 человека дикого типа содержит указанный полноразмерный полипептид за вычетом сигнального пептида длиной 27 аминокислот, что дает полипептид длиной в 181 аминокислоту (SEQ ID NO: 2).
Изменения аминокислот в положениях белков FGF21 согласно настоящему изобретению определяют исходя из положений аминокислот в полипептиде зрелого FGF21 человека дикого типа (SEQ ID NO: 2) без Fc-фрагмента IgG4 и линкера. Например, Fc-фрагмент IgG4 белка FGF21, соответствующий последовательности SEQ ID NO: 5, содержит аминокислоты с 1 по 228 включительно, линкер белка FGF21, соответствующий последовательности SEQ ID NO: 5, содержит аминокислоты с 229 по 244 включительно, и белок FGF21, соответствующий белку FGF21 с последовательностью SEQ ID NO: 5, содержит аминокислоты с 245 по 424 включительно. Соответственно, замена, описанная в настоящем документе как "A31С", относится к замене аминокислотой Cys аминокислоты дикого типа Ala в положении 31 зрелого FGF21 человека дикого типа.
Важно отметить, что замена одного аминокислотного остатка в конкретном белке может влиять на характеристики белков в целом, и что общий эффект может быть благоприятным или вредным для фармакологической активности и/или фармацевтической стабильности. Например, одна замена аминокислоты, P115W, повышает активность белка FGF21; однако считается также, что P115W вносит вклад в самоассоциацию, которая вызывает агрегацию. Таким образом, общий эффект на белки является негативным, и, соответственно, замену P115W не включают в белки FGF21 согласно настоящему изобретению. Другой пример относится к аминокислотной замене R175L, которая повышает активность белка FGF21. Однако белки FGF21 с заменой R175L, как было обнаружено, подвержены протеолизу, соответственно, общий эффект был негативным. Для решения проблемы С-концевого протеолиза, наблюдаемого в белках FGF21 согласно настоящему изобретению, аминокислоты в положениях 180 и 181 (LB положении 180 и G в положении 181) заменяют аминокислотой Е в положении 180, а аминокислоту в положении 181 удаляют. Указанные модификации существенно уменьшают С-концевой протеолиз, но также снижают фармакологическую активность белка FGF21 в 25 раз, согласно измерениям в анализе на основе клеток человека 293-(3Klotho-SRE luc.
Неожиданным образом, активность восстанавливается при обратной замене аминокислотного остатка в положении 175 (R175L) на R дикого типа. Таким образом, общий эффект указанной замены (R175L) является негативным для белков, и, соответственно, замену R175L не включают в предпочтительные белки FGF21 согласно настоящему изобретению.
Определенные белки FGF21 согласно настоящему изобретению представляют собой эффективные биологически активные белки, что продемонстрировано для последовательности SEQ ID N0:5 в примерах 2 и 3. Предпочтительные белки FGF21 согласно настоящему изобретению содержат замены аминокислот, которые совместно не только повышают активность, но также совместимы с другими изменениями аминокислот, что, в свою очередь, может обеспечивать улучшенные характеристики стабильности и повышенную стабильность in vivo. Повышающие активность замены аминокислот в предпочтительных белках FGF21 согласно настоящему изобретению включают D127K, S167R и G174L (см. примеры 2 и 3).
Воздействие на концентрированный раствор белка FGF21 человека дикого типа фармацевтического консерванта, такого как л^-крезол, повышает предрасположенность указанного белка к образованию агрегатов. Структурная стабилизация за счет введения дополнительной дисульфидной связи улучшает совместимость с консервантом, а также температурную стабильность FGF21 человека дикого типа. Белки FGF21 согласно настоящему изобретению включают замены аминокислот A31С и G43C, значительно улучшающие термостабильность и совместимость с консервантом без ущерба для биологической активности. Высокоактивные белки FGF21, включающие также замены A31C/G43C, были описаны ранее. Эти описанные белки демонстрируют значительно улучшенную совместимость с консервантом по сравнению с FGF21 дикого типа, но все равно склонны к агрегации в присутствии консерванта. Указанная агрегация белка увеличивает риск иммуногенности, тем самым снижая приемлемость указанных белков в качестве терапевтических.
Соединение белков FGF21 с Fc-фрагментом также приводит к более выраженной самоассоциации. Указанное свойство может быть обусловлено гомодимерной структурой связей Fc, которая может обуславливать авидность, стабилизацию самовзаимодействия и агрегацию.
Предпочтительные белки согласно настоящему изобретению содержат замены аминокислот L98D и L100K, которые неожиданным образом приводят к значительно меньшему образованию высокомолекулярных агрегатов при высоких концентрациях.
Благоприятным образом замены аминокислот L98D и L100K не понижают активность указанных белков, однако при этом минимизируют проблему неблагоприятной агрегации.
Предпочтительной коммерческой экспрессионной системой для получения указанных белков FGF21 согласно настоящему изобретению является линия клеток млекопитающих СНО-К1. Однако клетки млекопитающих линий СНО-К1 и НЕК293 могут обуславливать посттрансляционные модификации зрелого FGF21 человека дикого типа за счет сульфатирования тирозин овой боковой цепи в положении 179. Сульфатирование остатков тирозина в положениях 179 и 180 (при их наличии) уменьшает активность и является нежелательным источником гетерогенности продукта. Соответственно, если белок FGF21, содержащий Туг в положении 179 и/или 180, экспрессируется в клетках линий СНО К1 или НЕК293, некоторая часть экспрессируемых белков может быть сульфатирована в положении 179, какие-то могут быть сульфагарованы в положении 180, другие могут быть сульфатированы в обоих положениях и некоторые - ни в одном из положений. Это приводит к образованию совокупности белков с неоднородным и непредсказуемым составом и пониженной активностью.
Предпочтительные белки FGF21 согласно настоящему изобретению содержат аминокислотную замену, решающую указанную проблему неблагоприятного сульфатирования. Соответственно, в указанные белки вводили аминокислотную замену Y179F. Y179F исключает сульфатирование, обусловленное продуцированием в клетках СНО-К1 и НЕК293. Более того, аминокислотная замена Y179F совместима с другими благоприятными заменами аминокислот согласно настоящему изобретению и определена как нейтральное в отношении активности изменение.
FGF21 человека дикого типа подвержен протеолитическому разложению in vivo. Основной протеолитический фрагмент, выделяемый из сыворотки после внутривенного или подкожного введения мышам или яванским макакам FGF21 дикого типа, представляет собой фрагмент, заканчивающийся в положении 171. Указанный фрагмент FGF21, захватывающий остатки 1-171, как было определено, приблизительно в 100 раз менее активен в анализах активности in vitro. Соответственно, устранение этого участка протеолитического расщепления может повысить эффективность лекарственного средства за счет увеличения воздействия активного лекарственного средства. Аминокислотная замена G170E, как было показано, значительно замедляет расщепление у мышей и практически полностью исключает протеолиз в положении 171 при измерении через 24 часа у яванских макаков. Замена G170E не влияет на активность и совместима с
нужным профилем физико-химической стабильности. Таким образом, аминокислотную замену G170E включают в белки FGF21 согласно настоящему изобретению.
FGF21 человека дикого типа также подвержен расщеплению карбоксипептидазой, синтезируемой при получении в клетках СНО-К1; аминокислотная замена А180Е и удаление аминокислоты в положении 181 замедляют указанный процессинг, снижая таким образом гетерогенность длины экспрессируемого белка (т.е. гетерогенность числа аминокислотных остатков в зрелом белке, экспрессируемом клеточной линией). Несмотря на то, что аминокислотная замена А180Е и удаление аминокислоты в положении 181 полностью не исключают С-концевой протеолиз при экспрессии в клетках млекопитающих, это довольно эффективно замедляет протеолиз при сохранении активности в контексте других требуемых замен аминокислот, включенных в белки FGF21 согласно настоящему изобретению. В связи с указанной благоприятной характеристикой аминокислотную замену А180Е и удаление аминокислоты в положении 181 включают в предпочтительные белки FGF21 согласно настоящему изобретению.
Белки FGF21 согласно настоящему изобретению соединены линкером с Fc-фрагментом иммуноглобулина. Fc-фрагмент, используемый для белков FGF21 согласно настоящему изобретению, получают из Fc-фрагмента IgG4. Еще более предпочтительно белки FGF21 согласно настоящему изобретению содержат Fc-фрагмент, который получают из IgG4 человека, но содержит одну или несколько замен по сравнению с последовательностью человека дикого типа. В настоящем документе термин "Fc-фрагмент иммуноглобулина" имеет обычное для области иммунологии значение. Конкретно, указанный термин относится к фрагменту антитела, не включающему две антигенсвязывающие области (Fab-фрагменты) антитела. Fc-фрагмент состоит из шарнирной области, доменов СН2 и СНЗ константной области антитела.
В данной области техники хорошо известно, что экспрессия антител у млекопитающих приводит к гликозилированию. Как правило, гликозилирование происходит в Fc-фрагменте антитела на высококонсервативном участке N-гликозилирования. N-гликаны, как правило, присоединяются к аспарагину.
Соответственно, белки FGF21 согласно настоящему изобретению получают из Fc-области иммуноглобулина IgG4 человека, соединенной с белком FGF21 согласно настоящему изобретению. Предпочтительно, Fc-фрагмент белка FGF21 содержит последовательность SEQ ID NO: 14:
ESKYGPPCPPCPAPEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWY VDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTIS KAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPP
VLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLG (SEQ ID NO: 14)
N-концевую аминокислоту белка FGF21 согласно настоящему изобретению соединяют с С-концом каждой тяжелой цепи Fc-фрагмента посредством богатого глицином (G) линкера, обозначаемого как L, при этом число перед L относится к числу повторяющихся единиц линкера, отделяющих белок FGF21 от Fc-фрагмента. Единица линкера определена как последовательность Gly-Gly-Gly-Gly-Ser (SEQ ID NO: 10). Линкер необязательно содержит Ala, связанный с концевым Ser, если используется несколько линкерных повторов.
Fc-фрагмент и белки FGF21 согласно настоящему изобретению предпочтительно соединены друг с другом посредством 1, 2, или 3 повторов богатого глицином (G) пептидного линкера, -Gly-Gly-Gly-Gly-Ser- (SEQ ID NO: 10), обозначаемого как 1L. Дополнительные богатые глицином (G) линкеры согласно настоящему изобретению содержат последовательности -Gly-Gly-Gly-Gly-Ser-Gly-Gly-Gly-Gly-Ser-Ala (SEQ ID NO: 12), обозначаемые как 2L и -Gly-Gly-Gly-Gly-Ser-Gly-Gly-Gly-Gly-Ser-Gly-Gly-Gly-Gly-Ser-Ala (SEQ ID NO: 11), обозначаемые как 3L. Наиболее предпочтительным богатым глицином линкером согласно настоящему изобретению является линкер 3L, -Gly-Gly-Gly-Gly-Ser-Gly-Gly-Gly-Gly-Ser-Gly-Gly-Gly-Gly-Ser-Ala (SEQ ID NO: 11).
Понятно, что IgG4 Fc состоит из константной области обоих тяжелых цепей антитела IgG4. Соответственно, белки FGF21 согласно настоящему изобретению состоят из Fc-фрагмента IgG4, соединенного с двумя белками FGF21, имеющими одинаковую последовательность аминокислот, посредством богатых глицином линкеров на каждом С-конце каждого полипептида Fc-фрагмента IgG4.
Фармацевтические композиции с белками FGF21 согласно настоящему изобретению могут быть введены любыми известными в данной области техники способами, обеспечивающие реализацию основного целевого назначения - лечения диабета 2-го типа, ожирения, дислипидемии и/или метаболического синдрома. Предпочтительный способ введения - парентеральный. Доза для введения зависит от возраста, состояния здоровья, массы тела реципиента, вида сопутствующего лечения, если оно проводится, частоты лечения и характера требуемого эффекта. Типичные дозировки могут быть оптимизированы с применением стандартных клинических техник, зависят от способа введения и состояния пациента и могут быть определены средним специалистом в данной области техники.
Фармацевтически приемлемые композиции с белками FGF21 согласно настоящему изобретению получают в соответствии с известными способами. Желательно, чтобы
состав представлял собой стабильный лиофилизированный продукт, восстанавливаемый с применением подходящего разбавителя или водного раствора высокой степени чистоты, необязательно с фармацевтически приемлемыми носителями, консервантами, вспомогательными веществами или стабилизаторами [Remington, The Science and Practice of Pharmacy, 19th edition, Gennaro, ed., Mack Publishing Co., Easton, PA 1995].
Белки FGF21 согласно настоящему изобретению могут входить в состав лекарственного средства совместно с фармацевтически приемлемым буфером, рН может быть скорректирован для получения приемлемой стабильности и приемлемых для введения уровней. Кроме того, композиции с FGF21 согласно настоящему изобретению могут упаковываться в контейнер, такой как флакон, картридж, шприц-ручка, шприц, трубка для внутривенного введения или пакет для внутривенного введения.
Термин "дислипидемия" означает расстройство метаболизма липопротеинов, в том числе сверхсинтез или дефицит липопротеинов. Дислипидемия может проявляться повышением концентрации общего холестерина, холестерина в форме липопротеинов низкой плотности (ЛПНП) и триглицеридов, и/или уменьшением концентрации холестерина в форме липопротеинов высокой плотности (ЛПВП) в крови.
Термин "метаболический синдром" характеризуется наличием группы метаболических факторов риска у одного человека. Такие факторы риска включают: абдоминальный жир - объем талии 40 дюймов или более для большинства людей; высокий уровень сахара в крови - по меньшей мере ПО миллиграммов на децилитр (мг/дл) натощак; высокий уровень триглицеридов - по меньшей мере 150 мг/дл в крови; низкий уровень ЛПВП - менее 40 мг/дл; и/или давление крови 130/85 или выше.
Термин "ожирение" определяется как состояние, при котором имеется избыток подкожного жира относительно нежировой массы тела (Stedman's Medical Dictionary 28th edition, 2006, Lippincott Williams & Wilkins).
"Пациент" представляет собой млекопитающее, предпочтительно человека.
Термин "лечение" (или "лечить") означает замедление, уменьшение или реверсию прогрессирования или тяжести существующего симптома, расстройства, состояния или заболевания.
Термин "терапевтически эффективное количество" относится к количеству или дозе белка согласно настоящему изобретению, которое(ая), при введении пациенту в одной или нескольких дозах, обеспечивает необходимое лечение.
Термин "диабет 2-го типа" характеризуется тем, что происходит избыточный синтез глюкозы, несмотря на наличие инсулина, и циркулирующие уровни глюкозы остаются чрезмерно высокими в результате неадекватного клиренса глюкозы.
Настоящее изобретение может быть реализовано на основе следующих примеров. Однако это не должно толковаться как ограничение объема настоящего изобретения. Далее, белки FGF21 согласно настоящему изобретению, описанные и проиллюстрированные в примерах, экспрессируются в клетках млекопитающих и, соответственно, являются гомодимерами.
Пример 1
Экспрессирование белков FGF21 в клетках CHOK1SV
Белки FGF21 согласно настоящему изобретению синтезировали в экспрессионной системе на основе клеток млекопитающих CHOK1SV. Гены, кодирующие белки FGF21 согласно настоящему изобретению, субклонировали в содержащие глутаминсинтетазу (ГС) экспрессионные плазмидные конструкции (плазмиды на основе рЕЕ12.4). Последовательность кДНК, кодирующую белки FGF21 согласно настоящему изобретению, соединяли внутри рамки с кодирующей последовательностью из предпочтительных последовательностей сигнальных пептидов для повышения секреции требуемого продукта в среду для тканевой культуры. Предпочтительные последовательности сигнальных пептидов представлены полипептидами, приведенными в последовательностях аминокислот SEQ ID NO: 3 и SEQ ID NO: 4.
Экспрессию запускает промотор цитомегаловируса (CMV) . Клетки CHOK1SV стабильно трансфицировали с применением электропорации и подходящего количества рекомбинантной экспрессионной плазмиды, и трансфицированные клетки поддерживали в суспензионной культуре, при адекватной плотности клеток. Проводили отбор трансфицированных клеток путем культивирования на содержащей метионин-сульфоксимин (MSX) бессывороточной среде и инкубировали при 35-37 °С и 5-7 % С02.
Полученные клонированием клеточные линии измеряли или определяли с применением проточного цитометра. При экспрессировании белка FGF21 в клетках млекопитающих, как правило, образуется природная N-концевая последовательность, ESKY, т.е. отсутствует остаток метионина на N-конце, например, белок FGF21, представленный последовательностью аминокислот SEQ ID NO: 5.
Белки FGF21, секретируемые в среду клетками СНО, могут быть очищены с помощью аффинной хроматографии с белком А с последующей препаративной эксклюзионной хроматографией после применения стандартных хроматографических методик. Вкратце, белки FGF21 из собранной среды захватывали на колонке Mab Select Protein A (GE, Пискатауэй, Нью-Джерси) с подвижным буфером ФСБ, рН 7,4; быстро
промывали подвижным буфером для удаления неспецифически связанного материала; и элюировали 10 мМ цитратом с рН 3,0. Фракции, содержащие белки FGF21, объединяли и рН нейтрализовали добавлением 1/10 объема 1М Трис, рН 8,0. Нейтрализованный пул концентрировали и загружали на колонку для эксклюзионной хроматографии Superdex 200 (GE, Пискатауэй, Нью-Джерси) с ФСБ, рН 7,4, в качестве подвижной фазы. Фракции, содержащие мономерный белок FGF21 (ковалентно связанный гомодимер), объединяли, концентрировали и помещали на хранение.
Как вариант, бесклеточную среду, содержащую белки FGF21, можно нагревать до 50-60 QC на протяжении периода времени до двух часов, охладить, обработать детергентом (Triton Х-100) для инактивации вирусов, нанести на колонку Mab Select Protein A (GE Healthcare) и последовательно промыть раствором Трис-буфера, рН 7 с хлоридом натрия и без хлорида натрия для удаления неспецифически связанных материалов. Белок FGF21 элюировали из колонки с применением 20 мМ цитрата рН 3 и выдерживали при рН 3,4-3,7 до двух часов для инактивации вирусов. Значения рН раствора доводили до 4,8-5,2 добавлением Трис-буфера и хлорида натрия и перемешивали в течение по меньшей мере 15 минут. Образующийся осадок извлекали глубинным фильтрованием (Millipore). Затем белок FGF21 очищали с помощью катионообменной хроматографии с применением смол, таких как Poros HS 50 (Life Technologies) или SP Sepharose HP (GE Healthcare). Катионообменную колонку элюировали раствором хлорида натрия в забуференном ацетатом натрия растворе с рН 5. Белок FGF может быть дополнительно очищен с помощью хроматографии с гидрофобным взаимодействием на фенил-сефарозе Phenyl Sepharose HP (GE Healthcare) доведением значения рН от 7 до 8 с применением Трис-буфера, добавления сульфата натрия и внесения в колонку с последующим элюированием с обратным градиентом концентрации сульфата натрия. Очищенный белок FGF21 может быть пропущен через фильтр для удержания вирусов, такой как Planova 20N (Asahi Kasei Medical) с последующей концентрацией/диафильтрацией в 10 мМ цитрате, 150 мМ NaCl, рН 7, с применением ультрафильтрации в тангенциальном потоке на регенерированной целлюлозной мембране (Millipore).
Пример 2
Анализ усвоения глюкозы фибробластами 3T3-Ll-(3Klotho
Фибробласты 3T3-Ll-(3Klotho получали из фибробластов 3T3-L1 путем ретровирусной трансдукции контролируемого CMV экспрессионного вектора для
млекопитающих, содержащего кодирующую последовательность RKJotho мыши дикого типа и маркер устойчивости к бластицидину. Устойчивые к бластицидину клетки отбирали после культивирования в течение 14 дней в присутствии 15 мкМ бластицидина, и подтверждали экспрессию белка (3Klotho иммуноблоттингом с применением антитела против PKlotho. Фибробласты 3T3-L1-PKlotho поддерживали на среде Игла в модификации Дульбекко (DMEM) с 10% телячьей сыворотки и 15 мкМ бластицидином до посева с целью использования в экспериментах.
Для усвоения глюкозы фибробласты 3T3-L1-PKlotho высевали с плотностью 20 ООО клеток на лунку в 96-луночные планшеты и инкубировали в течение 48 часов в среде DMEM с добавлением 10% телячьей сыворотки. Клетки инкубировали в течение 3 часов в DMEM с 0,1% бычьего сывороточного альбумина (БСА) в присутствии или в отсутствие представляющего интерес белка FGF21, с последующим инкубированием в течение часа 1 в фосфатном буфере Кребса-Рингера (КРФ) (15 мМ HEPES, рН 7,4, 118 мМ NaCl, 4,8 мМ КС1, 1,2 мМ MgS04, 1,3 мМ СаС12, 1,2 мМ КН2Р04, 0,1% БСА), содержащем 100 мкМ 2-дезокси-В-(14С)глюкозу, в присутствии или в отсутствие белка FGF21. Неспецифическое связывание обнаруживали путем инкубирования выбранных лунок в бикарбонатном/HEPES буфере Кребса-Рингера (KRBH), содержащем 1 мМ 2-дезокси-0-(14С) глюкозу. Реакцию останавливали добавлением к клеткам 20 мкМ цитохалазина, и измеряли усвоение глюкозы с применением жидкостного сцинтилляционного счетчика.
При использовании по существу описанного выше протокола активность in vitro (ЕС50) гомодимера белка FGF21, соответствующего последовательности SEQ ID NO: 5, в анализе усвоения глюкозы фибробластами 3T3-L1-PKlotho определена как 0,070 нМ.
Пример 3
Анализ на клетках человека 293 PKlotho-SRE Luc
Конструирование репортерных клеток 293-(3Klotho-SRE Luc:
Клетки НЕК-293 (эмбриональные клетки почки человека) культивировали при 37 °С, 5 % СО2 в ростовой среде (PC), содержащей 10% фетальной бычьей сыворотки (ФБС)
в модифицированной по Дульбекко среде Игла. Клетки котрансфицировали плазмидой, содержащей контролируемую CMV-промотором экспрессионную кассету PKlotho человека, и плазмидой, содержащей контролируемую элементом ответа сыворотки (SRE) люциферазную экспрессионную кассету. Экспрессионная плазмида PKlotho также содержит управляемую промотором SV40 неомицин-фосфотрансферазную экспрессионную кассету для придания устойчивости к аминогликозидному антибиотику G418. Трансфицированные клетки НЕК-293 выбирали с применением 600 мкг/мл G418 для отбора клеток, в которых трансфицированные плазмиды были встроены в геном. Выбранные клетки клонировали разведением и тестировали на увеличение синтеза люциферазы через 24 ч после добавления FGF21. Клон, демонстрирующий максимальное FGF21-зависимое повышения уровня люциферазы, выбирали в качестве клеточной линии для измерения относительной активности белков FGF21.
Анализ активности FGF2lHa 293-PKlotho-SRE luc:
Клетки 293-PKlotho-SRE luc промывали и помещали в среду для суспензионной культуры CD 293 (Invitrogen). Клетки культивировали в суспензии в течение ночи при 37 °С, 6 % СС> 2, 125 об/мин. Клетки подсчитывали, осаждали центрифугированием и
повторно суспендировали в среде 293 CD, содержащей 0,1% БСА. Клетки помещали в белые 96-луночные планшеты с плотностью 25 ООО клеток на лунку. С помощью четырехкратного серийного разведения в CD 293/0,1% БСА каждого белка FGF21 получали восемь разведений с конечными концентрациями от 100 нМ до 0,006 нМ. Растворы добавляли к клеткам в трех повторностях и инкубировали в течение 16-20 часов при 37 °С, 5 % С02. Уровень люциферазы определяли путем добавления равного объема субстрата люциферазы OneGlo(tm) (Promega) и измерения относительной люминесценции. Данные анализировали с применением четырехпараметрической логистической модели (XLfit вере. 5.1) для аппроксимации кривых и определения ЕС50.
При использовании по существу описанного выше протокола средняя активность in vitro (ЕС50) гомодимера белка FGF21, соответствующего последовательности SEQ ID NO: 5, в анализе на клетках человека 293 (3Klotho-SRE Luc определена как 0,51 нМ.
Пример 4 Физическая стабильность Гетерогенность экспрессии R175 и Е180
Желательным является получение гомогенного белкового продукта, так как это обеспечивает более надежное получение единообразного и точно охарактеризованного продукта. Для оценки гетерогенности продукта аликвоту образца объемом 10 мкл смешивали с 90 мкл фосфатно-солевого буфера Дульбекко (DPBS). Образец анализировали с помощью жидкостной хроматографии/масс-спектрометрии (ЖХ-МС) с использованием следующих условий: подвижная фаза А: 0,05% ТФУ, подвижная фаза В: 0,04% ТФУ в ацетонитриле, колонка: PLRPS 2,1 х 50 мм, вводимый объем: 15 мкл.
Масс-спектрометр Waters Micromass LCT Premier(tm) настраивали на диапазон масс от 400 до 1990 а.е.м., полярность: ЭС+, напряжение на капилляре: 3000, пробоотборный конус: 40 В, апертура 1: 25 В, температура источника: 105 °С, поток газа через конус: 50 л / час, температура десольватации: 150 °С, поток газа десольватации: 600 л/час.
В таблице 2 представлена итоговая гетерогенность каждого белка FGF21 по оценке с помощью метода ЖХ-МС. Продукт 1-425 представляет собой полноразмерный белок FGF21, содержащий Fc-фрагмент IgG4, линкер и белок FGF21 для белка FGF21, соответствующего последовательности SEQ ID NO: 8, и белка FGF21, соответствующего последовательности SEQ ID NO: 9. Белок FGF21, соответствующий последовательности SEQ ID NO: 8, и белок FGF21, соответствующий последовательности SEQ ID NO: 9, отличаются только по положению 100, где белок FGF21, соответствующий последовательности SEQ ID NO: 8, содержит остаток лейцина дикого типа, а белок FGF21, соответствующий последовательности SEQ ID NO: 9, содержит остаток аминокислоты лизина (L100K); С-концы обоих белков идентичны. Оба указанных белка предрасположены к усечению по С-концу, в частности, удалению остатка аминокислоты глицина в положении 181. Как видно из таблицы 2, менее чем 50% очищенного продукта гомодимера белка FGF21, соответствующего последовательности SEQ ID NO: 8, и гомодимера белка FGF21, соответствующего последовательности SEQ ID NO: 9, представляет собой целевой полноразмерный фрагмент 1-425; фрагментом 1-424 представлена наибольшая часть очищенного продукта. Кроме того, обнаруживаются также небольшие количества продуктов 1-422, 1-411 и 1-379.
В белке FGF21, соответствующем последовательности SEQ ID NO: 5, удален остаток аминокислоты в положении 181 в генной конструкции, и остаток аминокислоты 180 заменен на глутаминовую кислоту (Е). Указанные изменения защищают С-конец от разрушения при экспрессировании в СНО, что позволяет получить 100% однородный очищенный продукт 1-424.
Пример 5 Физическая стабильность Самоассоциация при высокой концентрации
Агрегация и самоассоциация белков нежелательна, так как потенциально может усугублять нежелательные эффекты, такие как запуск иммунного ответа. Соответственно, поддержание белка в мономерном состоянии (ковалентно связанный гомодимер) является предпочтительным. Для тестирования склонности белков FGF21 к самоассоциации белки подвергали диализу против буферов, перечисленных в таблице 3, и анализировали с помощью эксклюзионной хроматографии (ЭХ) для определения % высокой молекулярной массы (% ВММ ) в растворе 1,0 мг/мл. % ВММ является показателем агрегации и самоассоциации белков.
ЭХ проводили на 5 мкм колонке Tosoh Bioscience 3000SWXL с размерами 30 см х 0,78 см. Подвижная фаза: 0,05 М фосфат натрия, 175 мМ NaCl, рН 7 при скорости потока 0,5 мл/мин. Образцы 1,0 мг/мл вводили в виде 10 мкл проб и осуществляли мониторинг при поглощении на 214 нм, а образцы 75 мг / мл вводили в виде 1 мкл проб и проводили мониторинг при 280 нм.
Таблица 3 иллюстрирует 4-5 % ВММ для гомодимера белка FGF21, соответствующего последовательности SEQ ID NO: 8, и <1% ВМВ для гомодимера белка FGF21, соответствующего последовательности SEQ ID NO: 9, и гомодимера белка FGF21, соответствующего последовательности SEQ ID NO: 5 при концентрации 1,0 мг/мл для всех буферных составов. Затем образцы концентрировали до 75 мг/мл для имитации состава с высокой концентрацией и повторно анализировали с помощью ЭХ для определения % ВММ Гомодимер белка FGF21, соответствующего варианту последовательности SEQ ID NO: 8, содержал 13,7-21,9 % ВММ при концентрации 75 мг/мл, тогда как гомодимер белка FGF21, соответствующего последовательности SEQ ID NO: 9, содержал всего 2,2-3,5%. Поскольку единственное отличие белка FGF21,
соответствующего последовательности SEQ ID NO: 8, и белка FGF21, соответствующего последовательности SEQ ID NO: 9, заключается в замене в положении 100 (L100L на L100K), указанные данные показывают, что L100K уменьшает образование ВММ.
Белок FGF21, соответствующий последовательности SEQ ID NO: 5, также содержит L100K, помимо других изменений, и в указанном гомодимерном белке также наблюдается меньший % ВММ.
Пример 6 Физическая стабильность Замена L100K и % высокой молекулярной массы
Физическую стабильность белков FGF21 определяли следующим образом. Белки диализировали и разводили в концентрации 1-2 мг/мл в10 мМ цитрате с рН7, 150 мМ NaCI, и анализировали с помощью ЭХ для определения % ВММ (таблица 3: "Исходный").
Разделение с помощью ЭХ проводили на 5 мкм колонке Tosoh Bioscience 3000SWXL с размерами 30 см х 0,78 см. Подвижная фаза: 0.05 М фосфат натрия, 175 мМ NaCI, рН 7 при скорости потока 0,5 мл/мин. Исходные низкоконцентрированные образцы вводили в виде проб объемом 10 мкл и проводили мониторинг при поглощении на 214 нм, а образцы 50 мг/мл вводили в виде 1 мкл проб и проводили мониторинг при 280 нм.
Затем белки концентрировали до 50 мг/мл и повторно анализировали (t=0). % ВММ для гомодимера белка FGF21, соответствующего последовательности SEQ ID NO: 8, увеличивался с 4,5% до 9,3% при концентрировании. % ВММ для гомодимера белка FGF21, соответствующего последовательности SEQ ID NO: 9, увеличивался с 0,9% до 1,4% при концентрировании. % ВММ для гомодимера белка FGF21, соответствующего последовательности SEQ ID NO: 5, увеличивался с 0,4% до 1,4% при концентрировании. Соответственно, и гомодимер белка FGF21, соответствующего последовательности SEQ ID NO: 9, и гомодимер белка FGF21, соответствующего последовательности SEQ ID N0:5, содержат более низкий исходный % ВММ и более низкий % ВММ в составах с концентрацией указанных белков 50 мг/мл по сравнению с гомодимером белка FGF21, соответствующего последовательности SEQ ID NO: 8. Эти данные свидетельствуют о важном значении модификации L100K, присутствующей в белке FGF21, соответствующем последовательности SEQ ID N0:9, и белке FGF21, соответствующем последовательности SEQ ID NO: 5, но отсутствующей в белке FGF21, соответствующем последовательности SEQ ID NO: 8.
Составы с концентрацией 50 мг/мл инкубировали в течение 4 недель при 4 °С, 25 °С, и 40 °С для оценки долгосрочной стабильности в стрессовых условиях. Как видно из таблицы 4, % ВММ повторно определяли через 4 недели (t=4 недели). % ВММ для гомодимера белка FGF21, соответствующего последовательности SEQ ID NO: 8, увеличивался с 9,3% до 16,0% при 40 °С. % ВММ для гомодимера белка FGF21, соответствующего последовательности SEQ ID NO: 9, увеличивался с 1,4% до 5,5% при 40 °С. % ВММ для гомодимера белка FGF21, соответствующего последовательности SEQ ID NO: 5, увеличивался с 0,4% до 5,4% при 40 °С. Через 4 недели при 25 °С уровни % ВММ составляли всего 3,3% для гомодимера белка FGF21, соответствующего последовательности SEQ ID NO: 9, и гомодимера белка FGF21, соответствующего последовательности SEQ ID NO: 5, в то же время составляя 13,8% для гомодимера белка FGF21, соответствующего последовательности SEQ ID NO: 8. Эти данные свидетельствуют о благоприятном влиянии введения модификации L100K, присутствующей в белке FGF21, соответствующем последовательности SEQ ID NO: 9 и белке FGF21, соответствующем последовательности SEQ ID NO: 5.
Пример 7 Физическая стабильность Самоассоциация
Очищенный белок FGF21, соответствующий последовательности SEQ ID NO: 7 (представляющий собой белок FGF21, соответствующий последовательности SEQ ID NO: 5 с заменой D98L) и очищенный белок FGF21, соответствующий последовательности SEQ
ID NO: 6 (представляющий собой белок FGF21, соответствующий последовательности SEQ ID NO: 5 с заменой K100L) диализировали против буфера: 10 мМ цитрата, 50 мМ NaCI, рН6; определенные концентрации составили 12,9 мг/мл, 1,0 мг/мл и 0,6 мг/мл, соответственно. Каждый выделенный при диализе образец анализируют с помощью ЭХ для определения % ВММ (таблица 5). % ВММ составлял менее 1 % для всех выделенных диализатов. Затем образцы концентрировали до 65-87 мг/мл с отсечкой по молекулярной массе 10 000 на центрифужном концентраторе Millipore (4 мл). Концентрации для каждого образца приведены в таблице 5. После концентрирования % ВММ повторно определяли с помощью ЭХ, используя концентрированный белок.
Как видно из таблицы 5, % ВММ для гомодимера белка FGF21, соответствующего последовательности SEQ ID NO: 5, увеличивался до 2,3 %, что указывает на низкий уровень самоассоциации при более высоких концентрациях. И напротив, % ВММ для гомодимера белка FGF21, соответствующего последовательности SEQ ID NO: 7 (представляющего собой белок FGF21, соответствующий последовательности SEQ ID NO: 5 с заменой D98L), и гомодимера белка FGF21, соответствующего последовательности SEQ ID NO: 6 (представляющего собой белок FGF21, соответствующий последовательности SEQ ID NO: 5 с заменой K100L), увеличивался до уровней 8,0 % и 14,2 %, соответственно. Эти данные свидетельствуют о большей предрасположенности к нежелательной самоассоциации при включении в последовательность L98 или L100 дикого типа. Соответственно, обе замены, L98D и L100K, способствуют уменьшению самоассоциации белка FGF21, соответствующего последовательности SEQ ID NO: 5. Далее, можно сделать вывод, что наличие L100K в отсутствие L98D (т.е. белок FGF21, соответствующий последовательности SEQ ID NO: 7) является недостаточным для того, чтобы наиболее полно свести к минимуму самоассоциацию. В свою очередь, можно сделать вывод, что присутствие L98D в отсутствие L100K (т.е. белок FGF21, соответствующий последовательности SEQ ID NO: 6) является недостаточным для того, чтобы наиболее полно свести к минимуму самоассоциацию. Соответственно, для обеспечения максимального эффекта уменьшения самоассоциации требуется одновременно как L98D, так и L100K.
При разбавлении концентрированных белков до 1 мг/мл % ВММ уменьшается, что указывает на обратимость самоассоциации. Разбавление гомодимера белка FGF21, соответствующего последовательности SEQ ID NO: 6 (представляющего собой белок FGF21, соответствующий последовательности SEQ ID NO: 5 с заменой K100L) до 1 мг/мл приводит к уменьшению % ВММ с 14,2 % до 2,0 %. Разбавление гомодимера белка FGF21, соответствующего последовательности SEQ ID NO: 7 (представляющего собой
белок FGF21, соответствующий последовательности SEQ ID NO: 5 с заменой D98L) до 1 мг/мл приводит к уменьшению % ВММ с 8,0 % до 1,3 %. При одновременном присутствии L98D и L100K в гомодимере белка FGF21, соответствующего последовательности SEQ ID NO: 5, % ВММ уменьшается до 0,88% при разбавлении до 1 мг/мл, что еще раз подтверждает наличие наиболее благоприятных свойств при комбинировании L98D и L100K.
Пример 8
Снижение уровней глюкозы в модели на мышах оЪ/оЪ
Возраст самцов мышей ob/ob и совпадающих по возрасту контрольных ob/m (без ожирения) составлял 7 недель на момент получения и 8-9 недель в момент начала лечения. После прибытия всех мышей размещали поодиночке и позволяли
акклиматизироваться в течение 1-2 недель до начала лечения. Мыши получали корм для грызунов Purina Rodent Chow 5015 и водопроводную воду из автоматической поилки в неограниченном количестве. В помещениях для мышей устанавливали 12-тичасовой цикл света/темноты и температуру воздуха 75 °F. За 1-2 дня до начала лечения собирали образцы крови из хвоста. Измеряли уровни глюкозы в крови с помощью глюкометра Accu-Check Avivia (Roche) и собирали образцы сыворотки для анализа на инсулин с применением набора для анализа инсулина Meso Scale для мышей и крыс. В день начала лечения (день 0) мышей распределяли в группы на основании массы тела до лечения, уровня глюкозы в крови и инсулина в сыворотке (программное обеспечение для сортировки BRAT). На 0 и 3 день мышам вводили п/к дозы от 0,1 до 30 нмоль/кг гомодимера белка FGF21, соответствующего последовательности SEQ ID NO: 5, в объеме 10 мл/кг. В качестве носителя использовали стерильный ФСБ (от Ну Clone, в модификации Дульбекко (DPBS), без кальция и магния) содержащий 0,03% мышиного сывороточного альбумина (MCA; Sigma A3139). Уровни глюкозы в крови измеряли ежедневно в течение 7 дней, и определяли AUC. Расчет ED50 для снижения уровней глюкозы основан на AUC. Собирали гомогенаты печени при умерщвлении и измеряли уровни триглицеридов печени на клиническом анализаторе Hitachi Modular P.
На 7 день у получавших лечение носителем мышей наблюдалась гипергликемия со средним измеренным уровнем глюкозы в крови 387 ± 63.0 мг/дл (среднее ± SEM), тогда как у контрольных мышей ob/m без ожирения уровни глюкозы в крови составляли 162 ± 9,0 мг/дл (среднее ± SEM). Гомодимер белка FGF21, соответствующего последовательности SEQ ID NO: 5, понижал уровни глюкозы в крови до уровня, сравнимого с контролем ob/m без ожирения. ED50 гомодимера белка FGF21, соответствующего последовательности SEQ ID NO: 5, составила 2,796 нмоль/кг (95 % доверительный интервал = 1,1 - 7,0).
Последовательности
HPIPDSSPLLQFGGQVRQRYLYTDDAQQTECHLEIREDGTVGCAADQSPESLLQLICALICP
GVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFREDLICEDGYNVYQSEAHGLPLHLP
GDKSPHRXPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLRLVEPSQLRSPSFE
SEP ID NO; 2 - FGF21 дикого типа (Homo Sapiens)
HPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLICALK PGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLP GNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYA S
SEP ID NP; 3 - Сигнальный пептид трансферрина человека (hTrf)
MRLAVGALLVCAVLGLCLA
SEP ID NP; 4 - Сигнальный пептид связывающего белка-1 фактора роста фибробластов человека (hFGFP-1)
MKJC S LTLL SFLLL AAQ VLL VEG
SEP ID NP; 5 - Белок FGF21
ESKYGPPCPPCPAPEAAGGPSVFLFPPICPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWY
VDGVEVFINAKTICPREEQFNSTYRVVSVLTVLHQDWLNGICEYKCKVSNKGLPSSIEKTIS
KAKGQPREPQVYTLPPSQEEMTICNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPP
VLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGGGGGSGGG
GSGGGGSAHPIPDSSPLLQFGGQVRQRYLYTDDAQQTECHLEIREDGTVGCAADQSPES
LLQLICALICPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFREDLICEDGYNVYQSE
AHGLPLHLPGDKSPHRICPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLRLVEP
SQLRSPSFE
ESKYGPPCPPCPAPEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWY
VDGVEVFINAKTICPREEQFNSTYRVVSVLTVLHQDWLNGICEYKCKVSNKGLPSSIEKTIS
ICAKGQPREPQVYTLPPSQEEMTICNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPP
VLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGGGGGSGGG
GSGGGGSAHPIPDSSPLLQFGGQVRQRYLYTDDAQQTECHLEIREDGTVGCAADQSPES
LLQLICALICPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFREDLLEDGYNVYQSEA
HGLPLHLPGDKSPHRKPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLRLVEPS
QLRSPSFE
SEP ID NO; 7 - Белок FGF21
ESKYGPPCPPCPAPEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWY
VDGVEVFINAKTICPREEQFNSTYRVVSVLTVLHQDWLNGICEYKCKVSNKGLPSSIEKTIS
ICAKGQPREPQVYTLPPSQEEMTICNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPP
VLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGGGGGSGGG
GSGGGGSAHPIPDSSPLLQFGGQVRQRYLYTDDAQQTECHLEIREDGTVGCAADQSPES
LLQLICALICPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLICEDGYNVYQSEA
HGLPLHLPGDKSPHRKPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLRLVEPS
QLRSPSFE
SEP ID NP; 8 - Белок FGF21
ESKYGPPCPPCPAPEAAGGPSVFLFPPICPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWY
VDGVEVHNAKTICPREEQFNSTYRVVSVLTVLHQDWLNGICEYKCKVSNKGLPSSIEKTIS
ICAKGQPREPQVYTLPPSQEEMTICNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPP
VLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGGGGGSGGG
GSGGGGSAHPIPDSSPLLQFGGQVRQRYLYTDDAQQTECHLEIREDGTVGCAADQSPES
LLQLICALICPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFREDLLEDGYNVYQSEA
HGLPLHLPGDKSPHRICPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLRLVEPS
QLLSPSFLG
ESKYGPPCPPCPAPEAAGGPSVFLFPPICPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWY
VDGVEVFINAKTICPREEQFNSTYRVVSVLTVLHQDWLNGICEYKCKVSNKGLPSSIEKTIS
ICAKGQPREPQVYTLPPSQEEMTICNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPP
VLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGGGGGSGGG
GSGGGGSAHPIPDSSPLLQFGGQVRQRYLYTDDAQQTECHLEIREDGTVGCAADQSPES
LLQLICALICPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFREDLICEDGYNVYQSE
AHGLPLHLPGDKSPHRICPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLRLVEP
SQLLSPSFLG
SEP ID NO; 10 - Линкер (D
GGGGS
SEP ID NP; 11 - Линкер (3D
GGGGS GGGGS GGGGS A
SEP ID NP; 12 - Линкер (2D
GGGGSGGGGSA
SEP ID NP; 13 - (ДНЮ белка FGF21
GAGTCCAAATATGGTCCCCCATGCCCACCCTGCCCAGCACCTGAGGCCGCCGGGGG
ACCATCAGTCTTCCTGTTCCCCCCAAAACCCAAGGACACTCTCATGATCTCCCGGAC
CCCTGAGGTCACGTGCGTGGTGGTGGACGTGAGCCAGGAAGACCCCGAGGTCCAGT
TCAACTGGTACGTGGATGGCGTGGAGGTGCATAATGCCAAGACAAAGCCGCGGGAG
GAGCAGTTCAACAGCACGTACCGTGTGGTCAGCGTCCTCACCGTCCTGCACCAGGAC
TGGCTGAACGGCAAGGAGTACAAGTGCAAGGTCTCCAACAAAGGCCTCCCGTCCTC
CATCGAGAAAACCATCTCCAAAGCCAAAGGGCAGCCCCGAGAGCCACAGGTGTACA
CCCTGCCCCCATCCCAGGAGGAGATGACCAAGAACCAGGTCAGCCTGACCTGCCTG
GTCAAAGGCTTCTACCCCAGCGACATCGCCGTGGAGTGGGAAAGCAATGGGCAGCC
GGAGAACAACTACAAGACCACGCCTCCCGTGCTGGACTCCGACGGCTCCTTCTTCCT
CTACAGCAGGCTAACCGTGGACAAGAGCAGGTGGCAGGAGGGGAATGTCTTCTCAT
GCTCCGTGATGCATGAGGCTCTGCACAACCACTACACACAGAAGAGCCTCTCCCTGT
CTCTGGGTGGTGGTGGTGGCTCCGGAGGCGGCGGCTCTGGTGGCGGTGGCAGCGCT
CACCCCATCCCTGACTCCAGTCCTCTCCTGCAATTCGGGGGCCAAGTCCGGCAGCGG
TACCTGTACACCGACGACGCCCAGCAGACCGAGTGCCACCTGGAAATCCGGGAGGA
CGGCACCGTGGGCTGTGCCGCCGACCAGTCCCCTGAGTCCCTGCTGCAGCTGAAGGC
CCTGAAGCCTGGCGTGATCCAGATCCTGGGCGTGAAAACCTCCCGGTTCCTGTGCCA
GAGGCCTGATGGCGCCCTGTACGGCTCCCTGCACTTCGACCCTGAGGCCTGCTCCTT
CCGGGAGGACCTGAAGGAAGATGGCTACAACGTGTACCAGTCCGAGGCTCACGGCC
TGCCTCTGCATCTGCCTGGCGACAAGTCCCCCCACCGGAAGCCTGCTCCTAGGGGCC
CTGCCAGATTCCTGCCACTGCCTGGCCTGCCTCCAGCTCTGCCTGAGCCTCCTGGCAT
CCTGGCCCCTCAGCCTCCAGACGTGGGCTCCTCCGACCCTCTGCGGCTGGTCGAGCC
TTCCCAGCTGCGGAGCCCTAGCTTCGAG
SEP ID NO; 14 - Fc-фрагмент
ESKYGPPCPPCPAPEAAGGPSVFLFPPICPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWY VDGVEVFfNAKTICPREEQFNSTYRVVSVLTVLHQDWLNGICEYKCKVSNKGLPSSIEKTIS ICAKGQPREPQVYTLPPSQEEMTICNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPP VLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLG
SEQ ID NO; 15 - Консенсусная последовательность белка FGF21
ESKYGPPCPPCPAPEAAGGPSVFLFPPICPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWY
VDGVEVFfNAKTICPREEQFNSTYRVVSVLTVLHQDWLNGICEYKCKVSNKGLPSSIEKTIS
ICAKGQPREPQVYTLPPSQEEMTICNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPP
VLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGGGGGSGGG
GSGGGGSAHPIPDSSPLLQFGGQVRQRYLYTDDAQQTECHLEIREDGTVGCAADQSPES
LLQLICALICPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFREXJLX2EDGYNVYQS
EAHGLPLHLPGDKSPHRXPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLRLVE
PSQLX3SPSFX4X5
Xi представляет собой L или D X2 представляет собой L или К Хз представляет собой R или L Х4 представляет собой L или Е Х5 представляет собой G или отсутствует
ФОРМУЛА ИЗОБРЕТЕНИЯ
1. Гомодимер белка фактора роста фибробластов 21 (FGF21), последовательность аминокислот которого состоит из первого полипептида, соединенного со вторым полипептидом, при этом первый полипептид содержит Fc-фрагмент IgG4, второй полипептид содержит белок FGF21, имеющий последовательность аминокислот SEQ ID NO: 1, и при этом С-конец первого полипептида соединен с N-концом второго полипептида посредством линкера.
2. Гомодимер по п. 1, отличающийся тем, что последовательность аминокислот Fc-фрагмента IgG4 представлена последовательностью SEQ ID NO: 14.
3. Гомодимер по любому из пп. 1 или 2, отличающийся тем, что последовательность аминокислот линкера представлена последовательностью SEQ ID NO: 11.
4. Гомодимер по любому из пп. 1-3, отличающийся тем, что последовательность аминокислот представляет собой:
ESKYGPPCPPCPAPEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQ FNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNK GLP S SIEKTISKAKGQPREPQ VYTLPP S QEEMTKNQ V SLTCL VKGFYP S DIAVEWE SNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHY TQKSLSLSLGGGGGSGGGGSGGGGSAHPIPDSSPLLQFGGQVRQRYLYTDDAQQ TECHLEIREDGTVGCAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALY GSLHFDPEACSFREDLKEDGYNVYQSEAHGLPLHLPGDKSPHRKPAPRGPARFLP LPGLPPALPEPPGILAPQPPDVGSSDPLRLVEPSQLRSPSFE (SEQ ID NO: 5).
5. Гомодимер по любому из пп. 1-4, отличающийся тем, что Fc-фрагмент IgG4 указанного белка гликозилирован.
6. Молекула ДНК, кодирующая полипептид, причем последовательность аминокислот указанного полипептида представлена последовательностью SEQ ID NO: 5.
7. Клетка-хозяин млекопитающего, трансформированная молекулой ДНК по п. 6, причем указанная клетка способна экспрессировать гомодимер, в котором
последовательность аминокислот каждого полипептида указанного гомодимера представлена последовательностью SEQ ID NO: 5.
8. Способ получения гомодимера, причем последовательность аминокислот каждого полипептида указанного гомодимера представлена последовательностью SEQ ID NO: 5; причем указанный способ включает следующие этапы:
i) культивирование клетки-хозяина млекопитающего, содержащей полинуклеотид, кодирующий полипептид, имеющий последовательность аминокислот SEQ ID NO: 5 в условиях, обеспечивающих экспрессию указанной полипептидной последовательности; и
н) выделение из указанной клетки-хозяина гомодимера, последовательность аминокислот каждого полипептида которого представлена последовательностью SEQ ID NO: 5.
9. Гомодимер, полученный способом по п. 8.
10. Фармацевтическая композиция, содержащая гомодимер по любому из пп. 1-5 или п. 9, и по меньшей мере один фармацевтически приемлемый носитель, разбавитель или вспомогательное вещество.
11. Способ лечения диабета 2-го типа, ожирения, дислипидемии и/или метаболического синдрома, включающий введение гомодимера по любому из пп. 1-5 или п. 9 нуждающемуся в таком лечении пациенту.
12. Гомодимер по любому из пп. 1-5 или п. 9 для применения в терапии.
13. Гомодимер по любому из пп. 1-5 или п. 9 для применения при лечении диабета 2-го типа, ожирения, дислипидемии и/или метаболического синдрома.
SEP ID NO; 1 - Белок FGF21
SEP ID NO; 6 - Белок FGF21
SEP ID NO; 9 - Белок FGF21