Патентная документация ЕАПВ

 
Запрос :  ea201491784a*\id

больше ...
Термины запроса в документе


Полный текст патента

(57) Реферат / Формула:

В изобретении представлены антитела, которые специфически связываются с каллидином или des-Arg10-каллидином. В описании изобретения также представлены фармацевтические композиции, а также нуклеиновые кислоты, кодирующие антитела против каллидина или des-Arg10-каллидина, рекомбинантные векторы экспрессии и клетки-хозяева для получения таких антител или их фрагментов. Способы использования антител по изобретению для регуляции активности каллидина или des-Arg10-каллидина или детекции каллидина или des-Arg10-каллидина либо in vitro, либо in vivo также представлены в описании изобретения. В описании изобретения дополнительно представлены способы получения антител, которые специфически связываются с des-Arg-брадикинином и des-Arg10-каллидин-подобным пептидом.


2420-518567ЕА/030 АНТИТЕЛА ПРОТИВ ЛИГАНДОВ РЕЦЕПТОРА В1 БРАДИКИНИНА
РОДСТВЕННЫЕ ЗАЯВКИ
По настоящей заявке испрашивается приоритет
предварительной заявки США № 61/616845, поданной 28 марта 2012 года, и предварительной заявки Франции № 1350953, поданной 4 февраля 2 013 года. Описание каждой из них включено в настоящий документ в качестве ссылки в полном объеме.
ПРЕДПОСЫЛКИ СОЗДАНИЯ ИЗОБРЕТЕНИЯ
Рецептор В1 брадикинина вовлечен в патогенез воспалительных заболеваний и хронической боли. Модулируя воспаление ткани и почечный фиброз рецептор В1 также связан с патогенезом острой почечной недостаточности, а также хронических заболеваний почек, являющихся главными причинами терминальной стадии почечной недостаточности.
У человека основными агонистами рецептора В1 брадикинина являются кинины. Кинины являются биоактивными пептидами, продуцируемыми в результате протеолитического расщепления кининогеновых белков. Основными кининовыми агонистами рецептора В1 брадикинина являются декапептид каллидин и нонапептид des-Агдю-каллидин (образуется путем протеолитического расщепления с-концевой аргининовой формы каллидина). Таким образом, вещества, которые могут ингибировать связывание каллидина и des-Агдю-каллидина с рецептором В1 брадикинина, обладают возможностью лечения или профилактики развития патологических заболеваний, опосредованных рецептором В1 брадикинина.
Соответственно, в данной области существует потребность в новых веществах, ингибирующих связывание каллидина и des-Агдю-каллидина с рецептором В1 брадикинина, для использования в лечении патологических заболеваний человека, опосредованных рецептором В1 брадикинина.
СУЩНОСТЬ ИЗОБРЕТЕНИЯ
Настоящее изобретение представляет антитела, или их антиген-связывающие фрагменты, которые специфически связывают с каллидин и des-Агдю-каллидин и предотвращают связывание с рецептором В1 брадикинина. Такие антитела особенно эффективны
для лечения заболеваний или нарушений (например, боли или
фиброза) , связанных с каллидином и des-Агдю-каллидином.
Изобретение также представляет фармацевтические композиции, а
также нуклеиновые кислоты, кодирующие антитела против каллидина
и des-Агдю-каллидина, рекомбинантные векторы экспрессии и
клетки-хозяева для получения таких антител, или их фрагменты.
Способы использования антител, или их фрагментов, по настоящему
изобретению для детекции каллидина и des-Агдю-каллидина или для
модуляции активности каллидина и des-Агдю-каллидина как in
vitro так и in vivo, также входят в объем настоящего
изобретения. Настоящее изобретение также представляет способы
получения антител, которые специфически связываются с des-Arg9-
брадикинином и des-Агдю-каллидин-подобным пептидом.
Соответственно, в одном из аспектов изобретение представляет выделенное моноклональное антитело, или его антиген-связывающий фрагмент, которое:
a) специфически связывает каллидин или des-Агдю-каллидин, но не связывает брадикинин или des-Argg-брадикинин;
b) специфически связывает каллидин или des-Агдю-каллидин со значением KD менее 1x1 СГ10 М;
c) специфически связывает каллидин или des-Агдю-каллидин со значением KQff менее 1х104 сек-1; или
d) специфически связывает каллидином или des-Агдю-каллидин и ингибируют связывание с рецептором В1 брадикинина.
В одном из вариантов осуществления изобретения антитело или его антиген-связывающий фрагмент связывается с N-концевым остатком лизина каллидина или des-Агдю-каллидина.
В другом варианте осуществления изобретения антитело или его антиген-связывающий фрагмент ингибирует связывание каллидина или des-Агдю-каллидина с рецептором брадикинина 1.
В другом варианте осуществления изобретения антитело или его антиген-связывающий фрагмент специфически связываются с каллидин-подобным пептидом мыши (KLP).
В другом варианте осуществления изобретения антитело или его антиген-связывающий фрагмент содержит вариабельный домен
тяжелой цепи, содержащий аминокислотную последовательность HCDR3, выбранную из группы, состоящей из:
a) SEQ ID N0:7 [X1YX2X3DX4HAMX5Y] , где Xi представляет собой Y, F или Н,
Х2 представляет собой R, D, А, V, L, I, М, F, Y или W, Х3 представляет собой Y, F, W или Н, Х4 представляет собой D, Е или Y, и, Х5 представляет собой D или Е;
b) SEQ ID N0:63 [X1EYDGX2YX3X4LDX5] , где Xi представляет собой W или F,
Х2 представляет собой N или аминокислоты нет; Х3 представляет собой Y или S, Х4 представляет собой D или Р, и Х5 представляет собой F или Y;
c) SEQ ID N0:13;
d) SEQ ID N0:32;
e) SEQ ID N0:40;
f) SEQ ID N0:47; и
g) SEQ ID N0:55
В другом варианте осуществления изобретения антитело или его антиген-связывающий фрагмент содержит аминокислотную последовательность HCDR2, выбранную из группы, состоящей из:
a) SEQ ID N0:8 [YFXiPX2NGNTGYNQKFRG] , где
Xi представляет собой D, R, А, V, L, I, М, F, Y или W, и Х2 представляет собой Y, D, Е, N, или Q;
b) SEQ ID N0:64 [WXiDPENGDX2X3YAPKFQG] , где Xi представляет собой I или V,
Х2 представляет собой Т или S, и Х3 представляет собой G или D;
c) SEQ ID N0:14
d) SEQ ID N0:33;
e) SEQ ID N0:41;
f) SEQ ID N0:48; и
g) SEQ ID N0:56.
В другом варианте осуществления изобретения антитело или его антиген-связывающий фрагмент содержит аминокислотную
последовательность HCDR1, выбранную из группы, состоящей из:
a) SEQ ID N0:9 [GYSFTDYXiIY] , где Xi представляет собой N, W или Y;
b) SEQ ID N0:65 [GFNIKDYYXiH] , где Xi представляет собой L, или М;
SEQ
N0:15;
SEQ
N0:34;
SEQ
N0:42;
SEQ
N0:49; и
SEQ
NO:57 .
другом
варианте
его антиген-связывающий фрагмент содержит вариабельный домен легкой цепи, содержащий аминокислотную последовательность LCDR3, выбранную из группы, состоящей из:
SEQ ID N0:10
[QQ Xi X
2S X
3Р Х4Т] , где
представляет
собой Y,
F или Н,
представляет
собой Y,
Н или W,
представляет
собой Y,
Т или Н,
представляет
собой W,
F, Н или
SEQ ID N0:66
[QXiX2X3SX4PX5T] , где
представляет
собой Q
или
представляет
собой Y,
D или Н,
представляет
собой Y,
Н или W,
представляет
собой Y,
Т или Н,
представляет
собой W,
F, Н или
SEQ ID N0:69
' [XiQGTHFPYT] , где X
1 представляет
или М;
SEQ
N0:16;
SEQ
N0:35;
SEQ
N0:43;
SEQ
N0:50; и
SEQ
N0:58.
другом
варианте
его антиген-связывающий фрагмент содержит аминокислотную последовательность LCDR2, выбранную из группы, состоящей из:
a) SEQ ID N0:11 [WASTRXi] , где Xi представляет собой Е, D,
Q или N;
b) SEQ ID N0:67 [X2ASTRX2], где Xi представляет собой W или G, и
X2 представляет собой E, D, Q или N;
c) SEQ ID N0:17;
d) SEQ ID N0:36;
e) SEQ ID N0:51; и
f) SEQ ID N0:59.
В другом варианте осуществления изобретения антитело или его антиген-связывающий фрагмент содержит аминокислотную последовательность LCDR1, выбранную из группы, состоящей из:
a) SEQ ID N0:12 [KSSQSLL XiSSNQKN X2LA] , где Xi представляет собой W, Н, Y или F, и
Х2 представляет собой Н или Y;
b) SEQ ID N0:68 [KSSQSLLX1X2SX3QX4NX5LA] , где Xi представляет собой W, Н, Y или F,
Х2 представляет собой S или G, Хз представляет собой N или D, Х4 представляет собой К или R, Х5 представляет собой Н или Y.
c) SEQ ID N0:70 [KSSQSLLYSNGXiTYLN] , где Xi представляет
или
SEQ
N0:
18;
SEQ
N0:
37;
SEQ
N0:
44;
SEQ
N0:
52; и
SEQ
N0:
60 .
другом
варианте
антиген-связывающий фрагмент содержит вариабельный домен легкой цепи, содержащий аминокислотную последовательность LCDR3, выбранную из группы, состоящей из:
a) SEQ ID N0:10 [QQ Xi X2S Х3Р Х4Т], где
Xi представляет собой Y, F или Н,
Х2 представляет собой Y, F, Н или W,
Х3 представляет собой Y, F, Т или Н, и,
Х4 представляет собой W, Y, F, Н или L;
b) SEQ ID N0:66 [QX1X2X3SX4PX5T] , где
Xi представляет собой Q или N,
X2 представляет собой Y, F, D или H,
X3 представляет собой Y, F, H или W,
X4 представляет собой Y, F, T или H, и
X5 представляет собой W, Y, F, H или L;
c) SEQ ID N0:69 [XiQGTHFPYT] , где Xi представляет собой L
или M;
SEQ
N0:16;
SEQ
N0:35;
SEQ
N0:43;
SEQ
N0:50; и
SEQ
N0:58.
другом
варианте
его антиген-связывающий фрагмент содержит аминокислотную последовательность LCDR2, выбранную из группы, состоящей из:
a) SEQ ID N0:11 [WASTRXi] , где Xi представляет собой Е, D,
Q или N;
b) SEQ ID N0:67 [X2ASTRX2], где Xi представляет собой W или G, и
Х2 представляет собой Е, D, Q или N;
c) SEQ ID N0:17;
d) SEQ ID N0:36;
e) SEQ ID N0:51; и
f) SEQ ID N0:59.
В другом варианте осуществления изобретения антитело или его антиген-связывающий фрагмент содержит аминокислотную последовательность LCDR1, выбранную из группы, состоящей из:
SEQ ID N0:12
[KSSQSLL XiSSNQKN X2LA] ,
где
представляет
собой W, Н, Y или F, и
представляет
собой Н или Y;
SEQ ID N0:68
[KSSQSLLXiX2SX3QX4NX5LA] ,
где
представляет
собой W, Н, Y или F,
представляет
собой S или G,
представляет
собой N или D,
представляет
собой К или R,
Х5 представляет собой Н или Y.
с) SEQ ID N0:70 [KSSQSLLYSNGXiTYLN] , где Xi представляет собой К или Е;
b) SEQ ID N0:18,
c) SEQ ID N0:37,
d) SEQ ID N0:44,
e) SEQ ID N0:52; и
f) SEQ ID N0:60 В другом варианте осуществления изобретения антитело или
его антиген-связывающий фрагмент содержит вариабельный домен тяжелой цепи, содержащий аминокислотные последовательности доменов HCDR3, HCDR2 и HCDR1 с последовательностями SEQ ID N0:13, 14 и 15, соответственно, и одну или несколько аминокислотных замен в положениях, выбранных из группы, состоящей из HI, Н5, Н9, НИ, Н12, Н16, Н38, Н40, Н41, Н43, Н44, Н66, Н75, Н79, Н81, Н82А, Н83, Н87 и Н108 по Кабату.
В другом варианте осуществления изобретения антитело или его антиген-связывающий фрагмент содержит вариабельный домен легкой цепи, содержащий аминокислотные последовательности доменов LCDR3, LCDR2 и LCDR1 с последовательностями SEQ ID N0:16, 17 и 18, соответственно, и одну или несколько аминокислотных замен в положениях, выбранных из группы, состоящей из L5, L9, L15, L18, L19, L21, L22, L43, L63, L78, L79, L83, L85, L100 и L104 по Кабату.
В другом варианте осуществления изобретения антитело или его антиген-связывающий фрагмент содержит аминокислотную последовательность вариабельного домена тяжелой цепи, которая по меньшей мере на 90% идентична аминокислотной последовательности, выбранной из группы, состоящей из SEQ ID N0:19, 20, 21, 22, 24, 25, 38, 45, 53 и 61.
В другом варианте осуществления изобретения антитело или
его антиген-связывающий фрагмент содержит аминокислотную
последовательность вариабельного домена легкой цепи, которая по
меньшей мере на 90% идентична аминокислотной
последовательности, выбранной из группы, состоящей из SEQ ID N0:26, 27, 28, 29, 30, 31, 39, 46, 54 и 62.
В другом варианте осуществления изобретения антитело или
его антиген-связывающий фрагмент содержит аминокислотную
последовательность вариабельного домена легкой цепи, которая по
меньшей мере на 90% идентична аминокислотной
последовательности, выбранной из группы, состоящей из SEQ ID N0:26, 27, 28, 29, 30, 31, 39, 46, 54 и 62.
В другом варианте осуществления изобретения антитело или его антиген-связывающий фрагмент содержит вариабельный домен тяжелой цепи, содержащий аминокислотную последовательность, выбранную из группы, состоящей из SEQ ID N0:19, 20, 21, 22, 24, 25, 38, 45, 53 и 61.
В другом варианте осуществления изобретения антитело или его антиген-связывающий фрагмент содержит аминокислотную последовательность вариабельного домена легкой цепи, выбранную из группы, состоящей из SEQ ID N0:2 6, 27, 28, 29, 29, 30, 31, 39, 46, 54 и 62.
В другом варианте осуществления изобретения антитело или его антиген-связывающий фрагмент содержит аминокислотную последовательность, выбранную из группы, состоящей из SEQ ID N0:26, 27, 28, 29, 29, 30, 31, 39, 46, 54 и 62.
В другом варианте осуществления изобретения антитело или его антиген-связывающий фрагмент содержит аминокислотные последовательности вариабельного домена тяжелой цепи и легкой цепи SEQ ID N0:19 и 26, SEQ ID N0:20 и 27, SEQ ID N0:21 и 28; SEQ ID N0:22 и 28; SEQ ID N0:23 и 29; SEQ ID N0:24 и 30; SEQ ID N0:25 и 31; SEQ ID N0:38 и 39, SEQ ID N0:45 и 46, SEQ ID N0:53 и 54, или SEQ ID N0:61 и 62, соответственно.
В другом аспекте изобретение относится к антителу или его
антиген-связывающему фрагменту, которое специфически
связывается с каллидином и des-Агдю-каллидином, где антитело, или его антиген-связывающий фрагмент, конкурирует с антителом, содержащим аминокислотные последовательности вариабельного домена тяжелой цепи и легкой цепи SEQ ID N0:19 и 26, SEQ ID N0:38 и 39, SEQ ID N0:45 и 46, SEQ ID N0:53 и 54, или SEQ ID N0:61 и 62, соответственно, за связывание с каллидином и des-Агдю-каллидином.
В другом аспекте изобретение относится к выделенному моноклональному антителу или его антиген-связывающему фрагменту, которое конкурируют с антителом по любому из предшествующих пунктов, за связывание с каллидином и des-Агдю-каллидином и не связывается с брадикинином или des-Arg9-брадикинином.
В другом аспекте изобретение относится к выделенному моноклональному антителу или его антиген-связывающему фрагменту, которое специфически связывается с конформационным эпитопом каллидина (KD) или des-Агдю-каллидином (DAKD), который принимает кинк-конформацию в Pro 4, содержащую крутой поворот типа II в пролине 4 KD или DAKD. В одном из вариантов осуществления кинк-конформация в Pro 4 KD или DAKD дополнительно включает аминокислотные повторы сигмоидной формы, которые выравнивают гидрофобные боковые цепи аминокислот в виде пространственной многоуровневой структуры. В другом варианте осуществления антитело или его антиген-связывающий фрагмент включает (а) специфическое связывание с каллидином или des-Агдю-каллидином, в отвутствие связывания с брадикинином или desArgg-брадикинином; Ь) специфическое связывание с каллидином или des-Агдю-каллидином со значением KD менее lxlCT10 М; с) специфическое связывание с каллидином или des-Агдю-каллидином со значением KQff менее 1х104 сек-1; или d) специфическое связывание с каллидином или des-Агдю-каллидином и ингибирование связывания с рецептором В1 брадикинина.
В еще одном аспекте антитело или антиген-связывающий фрагмент по изобретению конъюгировано с диагностическим или терапевтическим средством.
В еще одном аспекте изобретение относится к выделеной
нуклеиновой кислоте, кодирующей аминокислотную
последовательность антитела или его антиген-связывающего фрагмента по изобретению.
В еще одном аспекте изобретение относится к рекомбинантному вектору экспрессии, содержащему нуклеиновую кислоту по изобретению.
В другом аспекте изобретение относится к клетке-хозяину, содержащей рекомбинантный вектор экспрессии по изобретению.
В другом аспекте изобретение относится к способу получения антитела, которое специфически связывается с каллидином и des-Агдю-каллидином, включающему культивирование клетки-хозяина по изобретению в условиях, при которых клетка-хозяин продуцирует антитело, которое специфически связывается с каллидином и des-Агдю-каллидином.
В другом аспекте изобретение относится к фармацевтической композиции, содержащей антитело или его антиген-связывающий фрагмент по изобретению и один или несколько фармацевтически приемлемых носителей.
В другом аспекте изобретение относится к способу лечения заболевания или нарушения, заболевания или нарушения, связанного с каллидином или des-Агдю-каллидином, причем способ включает введение фармацевтической композиции по изобретению индивиду, при необходимости.
В одном из вариантов осуществления заболеванием или нарушением является хроническая боль.
В другом аспекте изобретение относится к способу получения
антитела, которое специфически связывается с des-Argg-
брадикинином и des-Агдю-каллидин-подобным пептидом,
включающему: иммунизацию животного иммуногеном, содержащим пептид, где пептид состоит из аминокислотной последовательности SEQ ID N0:11, и где аргинин на амино конце пептида соединен с молекулой носителя опосредованно с помощью молекулы линкера так, что антитело, которое специфически связывается с des-Arg9-брадикинином, des-Агдю-каллидином и des-Агдю-каллидин-подобным пептидом, продуцируется иммунной системой животного.
В другом варианте осуществления изобретения способ дополнительно включает выделение из организма животного антитела, выделение нуклеиновой кислоты, кодирующей антитело или клеток иммунной системы, экспрессирующих антитело.
В одном из вариантов осуществления изобретения молекулой носителя является белок. В другом варианте осуществления белок является гемоцианином фиссуреллии (KLH). В другом варианте
осуществления молекула линкера содержит [Gly-Gly-Gly]п, где п равен по меньшей мере 1.
КРАТКОЕ ОПИСАНИЕ ФИГУР
На фигуре 1 представлены результаты анализа ELISA, показывающие связывание антитела ЕЕ1 с кининовыми пептидами.
На фигуре 2 представлены результаты измерений дифференциальной сканирующей калориметрии антитела F151.
На фигуре 3 представлено выравнивание аминокислотных последовательностей вариабельных доменов антитела F151 мыши и гуманизированного антитела F151. Все идентичные остатки перечислены в выравнивании, тогда как гомологичные остатки указаны знаком "+", а негомологичные остатки оставлены пустыми.
На фигуре 4 представлена карта распределения электронной плотности сайта связывания антигена комплекса антитело F151/каллидин.
На фигуре 5 представлена карта распределения электронной плотности сайта связывания антигена комплекса антитело F151/des-Arg10-каллидин.
На фигуре б представлено ленточное и каркасное изображение субъединицы Fv антитела F151, связанного с каллидином.
На фигуре 7 представлено выравнивание аминокислотных последовательностей вариабельных доменов легкой цепи характерных антител мыши против каллидина по изобретению. Аминокислотные остатки, которые взаимодействуют с каллидином, отмечены звездочками.
На фигуре 8 представлено выравнивание аминокислотных последовательностей вариабельных доменов тяжелой цепи характерных антител мыши против каллидина по изобретению. Аминокислотные остатки, которые взаимодействуют с каллидином, отмечены звездочками.
На фигуре 9 представлены результаты экспериментов in vivo, в которых определяли действие антитела ЕЕ1 на индуцированную формалином боль при остром воспалении.
На фигуре 10 представлены результаты экспериментов in vivo, в которых определяли действие антитела ЕЕ1 на индуцированную CFA механическую гиперчувствительность.
На Фигуре 11 представлены результаты экспериментов in vivo, в которых определяли действие антитела ЕЕ1 на индуцированную CFA тепловую гиперчувствительность.
На Фигуре 12 представлены результаты экспериментов in vivo, в которых определяли действие антитела ЕЕ1 на индуцированную CCI механическую гиперчувствительность.
На Фигуре 13 представлены результаты экспериментов in vivo, в которых определяли действие антитела ЕЕ1 на индуцированную CCI тепловую гиперчувствительность.
На Фигуре 14 представлены схематические карты экспрессионных конструкций VL и VH для получения варианта HC3a/LC3a гуманизированного антитела F151 с сайтами расщепления ДНК-эндонуклеазой, представленных в виде спрогнозированных последовательностей жирным шрифтом с подчеркиванием. На панели А изображена легкая цепь и на панели В изображена тяжелая цепь.
На Фигуре 15 представлено выравнивание аминокислотных последовательностей тяжелой цепи (А) и легкой цепи (В) F151 с ближайшими аминокислотными последовательностями зародышевой линии человека.
На Фигуре 16 представлено выравнивание тяжелой цепи (А) и легкой цепи (В) F151 с локусом тяжелой цепи (1-08 & 1-18) и локусом легкой цепи (V IV-B3) подсемейства VH1. Области CDR и зон Веньера выделены жирным шрифтом, и гуманизирующие мутации подчеркнуты.
На Фигуре 17 представлены (А) вторичная и (В) третичная структуры конформации полипептидного каркаса основной цепи каллидина (KD) в связанном состоянии с антителом F151, которое содержит крутой поворот типа II в пролине 4 (С).
ПОДРОБНОЕ ОПИСАНИЕ ИЗОБРЕТЕНИЯ
Настоящее изобретение относится к антителам, которые специфически связываются с каллидином и des-Агдю-каллидином и предотвращают связывание с рецептором В1 брадикинина. Такие антитела особенно подходят для лечения заболеваний или нарушений, связанных с каллидином и des-Агдю-каллидином (например, боли). Настоящее изобретение также относится к фармацевтическим композициям, а также к нуклеиновым кислотам,
кодирующим антитела против каллидина и des-Агдю-каллидина, рекомбинантным векторам экспрессии и клеткам-хозяевам для синтеза таких антител или их фрагментов. Также настоящее изобретение относится к способам применения антител по изобретению для обнаружения каллидина и des-Агдю-каллидина или для регуляции активности каллидина и des-Агдю-каллидина, либо in vitro, либо in vivo. I. Определения
Для лучшего понимания настоящего изобретения в первую очередь даны определения некоторым терминам.
В контексте настоящего изобретения термин "каллидин" относится к пептиду, содержащему или состоящему из аминокислотной последовательности KRPPGFSPFR (SEQ ID N0:1).
В контексте настоящего изобретения термин "des-Агдю-каллидин" относится к пептиду, содержащему или состоящему из аминокислотной последовательности KRPPGFSPF (SEQ ID N0:2).
В контексте настоящего изобретения термин "каллидин мыши" или "каллидиноподобный пептид" относится к пептиду, содержащему или состоящему из аминокислотной последовательности RRPPGFSPFR (SEQ ID N0:3).
В контексте настоящего изобретения термин "des-Агдю-каллидин мыши" или "des-Агдю-каллидиноподобный пептид" относится к пептиду, содержащему или состоящему из аминокислотной последовательности RRPPGFSPF (SEQ ID N0:4).
В контексте настоящего изобретения термин "брадикинин" относится к пептиду, содержащему или состоящему из аминокислотной последовательности RPPGFSPFR (SEQ ID N0:5).
В контексте настоящего изобретения термин "des-Arg9-брадикинин" относится к пептиду, содержащему или состоящему из аминокислотной последовательности RPPGFSPF (SEQ ID N0:6).
В контексте настоящего изобретения термин "антитело" относится к иммуноглобулиновым молекулам, содержащим четыре полипептидные цепи, две тяжелые (Н) цепи и две легкие (L) цепи, связанных друг с другом дисульфидными мостиками, а также их мультимерам (например, IgM). Каждая тяжелая цепь содержит вариабельный домен тяжелой цепи (сокращенно VH или VH) и
константную область тяжелой цепи (Сн или СН) . Константная
область тяжелой цепи содержит три домена Сн1, Сн2 и Сн3. Каждая
легкая цепь содержит вариабельный домен легкой цепи (сокращенно
VL) и константную область легкой цепи (CL или CL). Константная
область легкой цепи содержит один домен (CL1) . Области VH и VL
могут быть дополнительно разделены на области
гипервариабельности, называемые областями, определяющими комплементарность (CDR), чередующиеся с областями, которые являются более консервативными, названными каркасными доменами
(FR) . Каждая область VH и VL состоит из трех CDR и четырех FR, расположенных от амино-конца к карбокси-концу в следующем порядке: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4 .
В контексте настоящего изобретения термин "антиген-связывающий фрагмент" антитела включает любой природный, получаемый ферментативным путем, синтетический или полипептид или гликопротеин, полученные способами генной инженерии, которые специфически связываются с антигеном с образованием комплекса. Антиген-связывающие фрагменты антитела могут быть получены, например, из полноразмерных молекул антитела, используя любую подходящую стандартную методику, такую как протеолитическое расщепление или рекомбинантные технологии генетической инженерии, включая манипуляцию и экспрессию ДНК, кодирующую вариабельный и в некоторых случаях константный домены антитела. Неограничивающие примеры антиген-связывающих фрагментов включают: (i) фрагменты Fab; (ii) фрагменты F(ab')2/
(iii) фрагменты Fd; (iv) фрагменты Fv; (v) одноцепочечные молекулы Fv (scFv); (vi) фрагменты dAb; и (vii) минимальные распознающие единицы, состоящие из аминокислотных остатков, имитирующих гипервариабельную область антитела (например, выделенную область, определяющую комплементарность (CDR)). Другие сконструированные молекулы, такие как диатела, триатела, тетратела и минитела, также входят в рамки термина "антиген-связывающий фрагмент".
В контексте настоящего изобретения термин "CDR" или "область, определяющая комплементарность" означает несмежные антиген-связывающие сайты, обнаруживаемые в пределах
вариабельного домена полипептидов как тяжелой, так и легкой цепей. Эти отдельные области были описаны Rabat et al., J. Biol. Chem. 252, 6609-6616 (1977) и Rabat et al., Sequences of protein of immunological interest. (1991), и Chothia et al., J. Mol. Biol. 196:901-917 (1987) и MacCallum et al., J. Mol. Biol. 262:732-745 (1996), где определения включают перекрывающиеся или подгруппы аминокислотных остатков при сравнении друг с другом. Аминокислотные остатки, включающие CDR, как описано каждой из вышеприведенных ссылок, изложены для сравнения. В варианте осуществления изобретения, термин "CDR" представляет собой CDR, как описано Rabat, на основании сравнения последовательностей.
В контексте настоящего изобретения термин "каркасные аминокислотные остатки (FR)" относится к аминокислотам каркасного домена цепи Ig. Термин "каркасный домен" или "область FR" в контексте настоящего изобретения включает аминокислотные остатки, которые являются частью вариабельного домена, но не являются частью CDR (например, используя определение CDR, сформулированное Rabat). Таким образом, каркасный домен вариабельного домена состоит приблизительно из 100-120 аминокислот в длину, но включает только те аминокислоты, что находятся вне CDR.
В контексте настоящего изобретения термин "специфически связывается с" относится к способности антитела или его антиген-связывающего фрагмента связываться с антигеном со значением Rd, приблизительно равным по меньшей мере 1x10-6 М, 1х10~7 М, 1х10~8 М, 1х10~9 М, 1х10~10 М, 1х10-11 М, 1х10~12 М или более. Термин также включает способность антитела или его антиген-связывающего фрагмента связываться с антигеном с аффинностью, которая по меньшей мере в два раза выше аффинности неспецифического антигена. Однако, следует понимать, что антитело или его антиген-связывающий фрагмент способны специфически связываться с двумя или более антигенами, которые имеют сходную последовательность (например, каллидин или des-Argl0-каллидин и каллидин мыши или des-Argl0-каллидин мыши).
В контексте настоящего изобретения термин "антиген" относится к сайту связывания или к эпитопу, распознаваемому антителом или его антиген-связывающим фрагментом.
В контексте настоящего изобретения термин "вектор" предназначен для обозначения молекулы нуклеиновой кислоты, способной транспортировать другую нуклеиновую кислоту, с которой она связана. Один из типов вектора представляет собой "плазмиду", которая относится к кольцевой двухцепочечной петле ДНК, в которой дополнительные сегменты ДНК могут быть лигированы. Другой тип вектора является вирусным вектором, где дополнительные сегменты ДНК могут быть лигированы в вирусном геноме. Определенные вектора способны автономно реплицироваться в клетке-хозяине, в которую они были введены (например, бактериальные векторы, имеющие бактериальную точку начала репликации, и эписомальные векторы млекопитающих). Другие векторы (например, неэписомальные векторы млекопитающих) могут быть встроены в геном клетки-хозяина после введения в клетку-хозяин, и, таким образом, они реплицируются наряду с геномом хозяина. Более того, определенные векторы способны контролировать экспрессию генов, с которыми они функционально связаны. Такие векторы обозначают в настоящем документе как "рекомбинантные векторы экспрессии" (или просто, "векторы экспрессии"). В основном, векторы экспрессии в зависимости от использования в технологиях рекомбинантной ДНК, как правило, представлены в форме плазмид. Термины "плазмида" и "вектор" могут быть использованы взаимозаменяемо. Однако изобретение включает и другие формы векторов экспрессии, таких как вирусные векторы (например, дефектные по репликации ретровирусы, аденовирусы и адено-связанные вирусы), которые выполняют эквивалентные функции.
В контексте настоящего изобретения термин "клетка-хозяин" предназначен для обозначения клетки, в которую был введен рекомбинантный вектор экспрессии. Следует понимать, что этот термин предназначен для обозначения не только определенной клетки индивида, но и потомства такой клетки. Поскольку определенные модификации могут происходить в последующих
поколениях в виду либо мутации, либо влияния окружающей среды, такое потомство может быть в действительности не идентичным родительской клетке, но тем не менее это вариант находится в рамках термина "клетка-хозяин" в контексте настоящего изобретения.
В контексте настоящего изобретения термин "лечить" и "лечение" относится к терапевтическим или профилактическим мерам, описанным в настоящем документе. Способы "лечения" используют введение индивиду антитела или антиген-связывающего фрагмента по настоящему изобретению, например, индивиду, страдающему заболеванием или нарушением, связанным с каллидином и des-Агдю-каллидином (например, воспалительное заболевание) или предрасположенному к возникновению такого заболевания или нарушения, в целях профилактики, лечения, задержки, уменьшения тяжести или улучшения одного или нескольких симптомов заболевания или нарушения или рецидивирующего заболевания или нарушения, или в целях увеличения времени жизни индивида по сравнению с временем, ожидаемым в отсутствии такого лечения.
В контексте настоящего изобретения термин "заболевание или нарушение, связанное с каллидином или des-Агдю-каллидином" включает варианты течения заболевания и/или симптомы, связанные с течением заболевания, при которых обнаружены измененные уровни или активность каллидина или des-Агдю-каллидина. Характерные заболевания или нарушения, связанные с каллидином или des-Агдю-каллидином, но ими не ограничиваются, боль и фиброз.
В контексте настоящего изобретения термин "эффективное количество" относится к такому количеству антитела или его антиген-связывающего фрагмента, способному связывать каллидин или des-Агдю-каллидин, которое является достаточным для эффективного лечения, прогноза или диагностики заболевания или нарушения, связанного с каллидином или des-Агдю-каллидином, как описано в настоящем документе, при его введении индивиду. Терапевтически эффективное количество будет изменяться в зависимости от индивида и патологического состояния, на которое направлено лечение, веса и возраста индивида, тяжести
патологического состояния, пути введения и тому подобное,
которое без труда может быть определено специалистом в данной
области. Режим дозирования может находиться в диапазоне,
например, приблизительно от 1 нг до приблизительно 10000 мг,
приблизительно от 1 мкг до приблизительно 5000 мг,
приблизительно от 1 мг до приблизительно 1000 мг,
приблизительно от 10 мг до приблизительно 100 мг антитела или
его антиген-связывающего фрагмента по изобретению. Режимы
дозирования могут быть подобраны для получения оптимального
терапевтического ответа. Эффективное количество также является
таким количеством, при котором любые токсические или
нежелательные эффекты (т.е., побочные эффекты) антитела или его
антиген-связывающего фрагмента минимизированы или
перевешиваются полезными эффектам.
В контексте настоящего изобретения термин "индивид" включает человека или животного, отличного от человека.
В контексте настоящего изобретения термин "эпитоп" относится к антигенной детерминанте, которая взаимодействует со специфическим сайтом связывания антигена в вариабельном домене молекулы антитела, известной как паратоп. Один антиген может иметь более одного эпитопа. Таким образом, различные антитела могут связываться с различными областями антигена и могут иметь различные биологические эффекты. Эпитопы могут быть либо конформационными, либо линейными. Конформационный эпитоп формируется расположенными рядом в пространстве аминокислотами из различных сегментов линейной полипептидной цепи. Линейный эпитоп образуется близлежащими аминокислотными остатками в полипептидной цепи.
Следует отметить, что в настоящем описании и в прилагаемой формуле изобретения, формы единственного числа включают и множественное число, если из контекста явно не следует иного.
II. Антитела против каллидина или des-Агдю-каллидина
В одном из аспектов изобретение относится к антителам или их антиген-связывающим фрагментам, которые специфически связываются с каллидином или des-Агдю-каллидином. Характерные аминокислотные последовательности VH, VL и CDR антител по
изобретению представлены в Таблице 1.
Xi представляет собой W, Н, Y или F; и Хг представляет собой Н или Y.
F151 HCDR3
YYRYDDHAMDY
F151 HCDR2
YFDPYNGNTGYNQKFRG
F151 HCDR1
GYSFTDYNIY
F151 LCDR3
QQYYSYPWT
F151 LCDR2
WASTRES
F151 LCDR1
KSSQSLLYSSNQKNYLA
F151 VH
EIQLQQSGPELVKPGTSVKVSCKASGYSFTDYNIYWV KQSHGKSLEWIGYFDPYNGNTGYNQKFRGKATLTVDK S S S TAFMHLS S LT S DDSAVYYCANYYRYDDHAMDYWG QGTSVTVSS
F151
гуманизированная HC1
EIQLVQSGPEVKKPGASVKVSCKASGYSFTDYNIYWV KQSPGKSLEWIGYFDPYNGNTGYNQKFRGKATLTVDK SSSTAFMHLSSLTSEDSAVYYCANYYRYDDHAMDYWG QGTSVTVSS
F151
гуманизированная HC2a
QIQLVQS GAEVKKPGASVKVS CKAS GYS FT DYNIYWV KQSPGKGLEWIGYFDPYNGNTGYNQKFRGKATLTVDK SSSTAYMHLSSLTSEESAVYYCANYYRYDDHAMDYWG QGTSVTVSS
F151
гуманизированная HC2b
QIQLVQS GAEVKKPGASVKVS CKAS GYS FTDYNIYWV KQSPGKGLEWIGYFDPYNGNTGYNEKFRGKATLTVDK SSSTAYMHLSSLTSEESAVYYCANYYRYDDHAMDYWG QGTSVTVSS
F151
гуманизированная HC2c
QIQLVQS GAEVKKPGASVKVS CKAS GYS FTDYNIYWV KQSPGKGLEWIGYFDPYNGNTGYNQKFRGKATLTVDK SSSTAYMHLSSKTSE.ESAVY YCANY YRYDDHAMD YWG QGTSVTVSS
F151
гуманизированная НСЗа
QIQLVQS GAEVKKPGASVKVS CKAS GYS FTDYNIYWV RQAPGQGLEWIGYFDPYNGNTGYNQKFRGRATLTVDK S T S TAYME LRS LRS DDTAVYYCANYYRYDDHAMDYWG QGTLVTVSS
F151
гуманизированная НСЗЬ
QVQLVQS GAEVKKPGASVKVS CKAS GYS FT DYNIYWV RQAPGQGLEWMGYFDPYNGNTGYNQKFRGRVTMTTDT S T S TAYME LRS LRS DDTAVYYCANYYRYDDHAMDYWG
QGTLVTVSS
F151 VL
DIVMSQSPSSLAVSVGEKVTMSCKSSQSLLYSSNQKN YLAWYQQKPGQSPKPLIYWASTRESGVPDRFTGSGSG TDFTLTISSVKAEDLAIYYCQQYYSYPWTFGGGTKLE IK
F151
гуманизированная LCI
DIVMSQSPSSLAASVGDRVTMSCKSSQSLLYSSNQKN YLAWYQQKPGKSPKPLIYWASTRESGVPDRFTGSGSG TDFTLTISSVQAEDLAIYYCQQYYSYPWTFGGGTKLE IK
F151
гуманизированная LC2a
DIVMTQSPSSLSASVGDRVTJSCKSSQSLLYSSNQKN YLAWYQQKPGKSPKPLIYWASTRESGVPDRFSGSGSG TDFTLTISSVQAEDLATYYCQQYYSYPWTFGGGTKLE IK
F151
гуманизированная LC2b
DIVMTQSPSSLSASVGDRVTJSCKSSQSLLYSSNQKN YLAWYQQKPGKSPKPLIYWASTRESGVPDRFSGSGSG TDFTLTISSVQAEDKATYYCQQYYSYPWTFGGGTKLE IK
F151
гуманизированная LC3a
DIVMTQSPDSLAVSLGERATINCKSSQSLLYSSNQKN YLAWYQQKPGQPPKPLIYWASTRESGVPDRFSGSGSG TDFTLTISSLQAEDVAVYYCQQYYSYPWTFGQGTKVE IK
F151
гуманизированная LC3b
DIVMTQSPDSLAVSLGERATINCKSSQSLLYSSNQKN YLAWYQQKPGQPPKLLIYWASTRESGVPDRFSGSGSG TDFTLTISSLQAEDVAVYYCQQYYSYPWTFGQGTKVE IK
B21 HCDR3
WEYDGYYDLDY
B21 HCDR2
WIDPENGDTGYARKFQG
B21 HCDR1
GFNIKDYYLH
B21 LCDR3
LQGTHFPYT
B21 LCDR2
LVSKLDS
B21 LCDR1
KSSQSLLYSNGKTYLN
B21 VH
EVQLQQSGAELVRSGASVKLSCTASGFNIKDYYLHWV KQRPEQGLEWIGWIDPENGDTGYARKFQGKATMTADT SSNTVYLHLSSLTSEDTAVYYFNAWEYDGYYDLDYWG QGTSVTVSS
B21 VL
DWMTQTPLTLSVTIGQPASISCKSSQSLLYSNGKTY LNWLLQRPGQSPKRLIYLVSKLDSGVPDRFTGSGSGT DFTLKIIRVEAEDLGVYYCLQGTHFPYTFGGGTKLEI
С63 HCDR3
EDYGGDY
СбЗ HCDR2
EIRSKSNNYATHYAESVKG
СбЗ HCDR1
GFTFSNYWMN
СбЗ LCDR3
QQYYSYPYT
СбЗ LCDR2
WASTRES
СбЗ LCDR1
KSSQSLLYSSDQRNYLA
СбЗ VH
EVKLEESGGGLVQPGGSMKLSCVASGFTFSNYWMNWV RQS PEKGLEWVAEIRSKSNNYATHYAESVKGRFTISR DDSKSSVYLQMNNLRAEDTGIYYCIGEDYGGDYWGQG TSVTVSS
СбЗ VL
DIVMSQSPSSLAVSVGEKVTMSCKSSQSLLYSSDQRN YLAWYQQRSGQSPKLLIYWASTRESGVPDRFTGSGSG TDFTLTISSVKAEDLAVYYCQQYYSYPYTFGGGTKLE IK
122 HCDR3
FEYDGNYSPLDF
122 HCDR2
WVDPENGDSDYAPKFQ
122 HCDR1
GFNIKDYYMH
122 LCDR3
QNDHSYPLT
122 LCDR2
GASTRES
122 LCDR1
KSSQSLLNSGNQKNYLA
122 VH
EVQLQQSGAELVRSGASVKLSCTASGFNIKDYYMHWV KQRPEQGLEWIGWVDPENGDSDYAPKFQGKATMTADT SSNTVYLQFSSLTSEDTAVYYCNAFEYDGNYSPLDFW GQGTSVTVSS
122 VL
DIVMTQSPSSLSVSAGEKVTMSCKSSQSLLNSGNQKN YLAWYQQKPGQPPKLLIYGASTRESGVPDRFTGSGSG TDFTLTISSVQAEDLAVYYCQNDHSYPLTFGAGTKLE LK
154 HCDR3
FEYDGNYSPLDF
154 HCDR2
WVDPENGDSDYAPKFQG
154 HCDR1
GFNIKDYYMH
154 LCDR3
MQGTHFPYT
154 LCDR2
LVSKLDS
154 LCDR1
KSSQSLLYSNGETYLN
154 VH
EVQLQQSGAELVRSGASVKLSCTASGFNIKDYYMHWV KQRPEQGLEWIGWVDPENGDSDYAPKFQGKATMTADT SSNTVYLQFSSLTSEDTAVYYCNAFEYDGNYSPLDFW GQGTSVTVSS
154 VL
DWMTQTPLTLSVPIGQPASISCKSSQSLLYSNGETY LNWLLQRPGQSPKRLIYLVSKLDSGVPDRFTGSRSGT DFTLKISRVESEDLGVYYCMQGTHFPYTFGGGTKLEI К
В21/ 122/ 154 HCDR3 консенсус
X1EYDGX2YX3X4LDX5 где :
Xi представляет собой W или F;
Х2 представляет собой N или нет
аминокислоты;
Х3 представляет собой Y или S; Х4 представляет собой D или Р; и Х5 представляет собой F или Y.
В21/ 122/ 154 HCDR2 консенсус
WXiDPENGDX2X3YAPKFQG где:
Xi представляет собой I, или V; Х2 представляет собой Т, или S; и Х3 представляет собой G, или D.
В21/ 122/ 154 HCDR1 консенсус
GFNIKDYYXiH
где Xi представляет собой L, или М.
F151/C63/I22 LCDR3 консенсус
QX1X2X3SX4PX5T где:
Xi представляет собой Q или N; Хг представляет собой Y, F, D или Н; Х3 представляет собой Y, F, Н или W; Х4 представляет собой Y, F, Т или Н; и Х5 представляет собой W, Y, F, Н или L.
F151/C63/I22 LCDR2 консенсус
X1ASTRX2 где:
Xi представляет собой W или G; и
Хг представляет собой Е, D, Q или N
F151/C63/I22
KSSQSLLX1X2SX3QX4NX5LA
LCDR1 консенсус
где:
Xi представляет
собой
Y или F;
Х2 представляет
собой
или
Х3 представляет
собой
или
Х4 представляет
собой
или
Х5 представляет
собой
или
B21/I54 LCDR3
XiQGTHFPYT
консенсус
где:
Xi представляет
собой
или
B21/I54 LCDR2
LVSKLDS
Обе идентичные
B21/I54 LCDR1
KSSQSLLYSNGXiTYLN
консенсус
где:
Xi представляет
собой
или
В определенных вариантах осуществления антитело или его антиген-связывающий фрагмент, содержит одну или несколько аминокислотных последовательностей области CDR, выбранных из группы, состоящей из SEQ ID N0:7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 32, 33, 34, 35, 36, 37, 40, 41, 42, 43, 44, 47, 48, 49, 50, 51 52, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69 и 70.
В других вариантах осуществления изобретения антитело, или его антиген-связывающий фрагмент, содержит аминокислотные последовательности домена HCDR3, HCDR2 и HCDR1, выбранные из группы, состоящей из:
SEQ
NO:
3 и
SEQ
NO:
13,
15;
SEQ
NO:
32,
34;
SEQ
NO:
40,
42;
SEQ
NO:
47,
49;
SEQ
NO:
55,
57; и
SEQ
NO:
63,
65, соответственно
В других вариантах осуществления изобретения антитело, или его антиген-связывающий фрагмент, содержит аминокислотные
последовательности домена LCDR3, LCDR2 и LCDR1, выбранные из группы, состоящей из:
a) SEQ ID N0:10, 11 и 12,
b) SEQ ID N0:16, 17 и 18,
c) SEQ ID N0:35, 36 и 37,
d) SEQ ID N0:43, 17 и 44,
e) SEQ ID N0:50, 51 и 52,
f) SEQ ID N0:58, 59 и 60,
g) SEQ ID N0:66, 67 и 68; и
h) SEQ ID N0:69, 25 и 70, соответственно.
В других вариантах осуществления изобретения антитело, или его антиген-связывающий фрагмент, содержит аминокислотные последовательности домена HCDR3, HCDR2, HCDR1, LCDR3, LCDR2 и LCDR1, выбранные из группы, состоящей из:
a) SEQ ID N0:7, 8, 9, 10, 11 и 12;
b) SEQ ID N0:13, 14, 15, 16, 17 и 18;
c) SEQ ID N0:32, 33, 34, 35, 36 и 37;
d) SEQ ID N0:40, 41, 42, 43, 17 и 44;
e) SEQ ID N0:47, 48, 49, 50, 51 и 52; и
f) SEQ ID N0:55, 56, 57, 58, 59 и 60, соответственно.
В другом варианте осуществления изобретение относится к гуманизированным антителам или к их антиген-связывающим фрагментам, содержащим одну или несколько областей CDR (или их консервативно модифицированные варианты) из антител мыши, описанных в настоящем документе. Для получения гуманизированных антител по изобретению можно использовать дюбой способ гуманизации. Подходящие способы описаны в настоящем документе и конкретным образом рассмотрены в Примере 4.
В одном из конкретных вариантов осуществления гуманизированное антитело или его антиген-связывающий фрагмент содержит:
вариабельный домен тяжелой цепи, содержащий аминокислотные последовательности доменов HCDR3, HCDR2 и HCDR1, представленные в 13, 14 и 15, соответственно, и одну или несколько аминокислотных замен в положениях, выбранных из группы, состоящей из HI, Н5, Н9, НИ, Н12, Н16, Н38, Н40, Н41, Н43,
Н44, Н66, Н75, Н79, Н81, Н82А, Н83, Н87 и Н108; и/или
вариабельный домен легкой цепи, содержащий аминокислотные последовательности доменов LCDR3, LCDR2 и LCDR1, представленные в 16, 17 и 18, соответственно, и одну или несколько аминокислотных замен в положениях, выбранных из группы, состоящей из L5, L9, L15, L18, L19, L21, L22, L43, L63, L78, L79, L83, L85, L100 и L104 (по Кабат).
В других вариантах осуществления антитело, или его
антиген-связывающий фрагмент, содержит аминокислотные
последовательности области VH SEQ ID N0:19, 20, 21, 22, 24, 25, 38, 45, 53 и/или 61.
В других вариантах осуществления антитело, или его
антиген-связывающий фрагмент, содержит аминокислотные
последовательности области VL SEQ ID N0:26, 27, 28, 29, 29, 30, 31, 39, 46, 54 и/или 62.
В других вариантах осуществления антитело или его антиген-связывающий фрагмент содержит аминокислотные последовательности областей VH и VL, выбранные из группы, состоящей из: SEQ ID N0:19 и 26, SEQ ID N0:20 и 27, SEQ ID N0:21 и 28; SEQ ID N0:22 и 28; SEQ ID N0:23 и 29; SEQ ID N0:24 и 30; SEQ ID N0:25 и 31; SEQ ID N0:38 и 39, SEQ ID N0:45 и 46, SEQ ID N0:53 и 54, или SEQ ID N0:61 и 62, соответственно.
В определенных вариантах осуществления антитело или его антиген-связывающий фрагмент, содержит одну или несколько аминокислотных последовательностей области CDR, выбранных из группы, состоящей из SEQ ID N0:7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 32, 33, 34, 35, 36, 37, 40, 41, 42, 43, 44, 47, 48, 49, 50, 51, 52, 55, 56, 57, 58, 59 и 60, где одна или несколько аминокислотных последовательностей области CDR содержит по меньшей мере одну или несколько консервативных аминокислотных замен.
В рамках настоящего изобретения также рассматриваются "консервативные аминокислотные замены" в аминокислотных последовательностях CDR (например, SEQ ID N0:8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 32, 33, 34, 35, 36, 37, 40, 41, 42, 43, 44, 47, 48, 49, 50, 51, 52, 55, 56, 57, 58, 59 и 60) антител по
изобретению, т.е., модификации аминокислотной
последовательности, которые не отменяют связывание антитела с антигеном, например, каллидином или des-Агдю-каллидином. Консервативные аминокислотные замены включают замену аминокислоты одного класса аминокислотой того же класса, где класс определяется общими физико-химическими свойствами боковых цепей аминокислоты и высокими частотами замен в гомологичных природных белках по данным, например, стандартной матрицы замены частот Dayhoff или матрицы BLOSUM. Шесть основных классов боковых цепей аминокислот были выделены и включают: Класс I (Cys) ; Класс II (Ser, Thr, Pro, Ala, Gly) ; Класс III
(Asn, Asp, Gin, Glu) ; Класс IV (His, Arg, Lys); Класс V (He,
Leu, Val, Met) ; и Класс VI (Phe, Туг, Trp) . Например, замена
Asp на остаток другого класса III, такой как Asn, Gin или Glu,
является консервативной заменой. Таким образом, предсказанный
остаток заменимой аминокислоты в антителе против каллидина или
des-Агдю-каллидина, предпочтительно, замещают другим
аминокислотным остатком из того же класса. Способы идентификации консервативных замен аминокислот, которые не устраняют связывания антигена, хорошо известны в данной области
(см., например, Brummell et al. , Biochem. 32:1180-1187 (1993); Kobayashi et al. Protein Eng. 12 (10) : 879-884 (1999); и Burks et al. Proc. Natl. Acad. Sci. USA 94:412-417 (1997)).
В другом варианте осуществления настоящее изобретение относится к антителу против каллидина или des-Агдю-каллидина, или его антиген-связывающему фрагменту, которое содержит аминокислотную последовательность области VH и/или VL, которая на 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% или 99% идентична аминокислотной последовательности области VH SEQ ID N0:19, 20, 21, 22, 24, 25, 38, 45, 53 или 61, или аминокислотной последовательности области VL SEQ ID N0:26, 27, 28, 29, 29, 30, 31, 39, 46, 54 или 62, соответственно.
В другом варианте осуществления изобретение относится к антителу против каллидина или des-Агдю-каллидина, которое связывается с одним и тем же эпитопом и/или перекрестно
конкурируют с антителом или его антиген-связывающим фрагментом, содержащим аминокислотные последовательности области VH и VL SEQ ID N0:19 и 25, SEQ ID N0:38 и 39, SEQ ID N0:45 и 46, SEQ ID N0:53 и 54 или SEQ ID N0:61 и 62, соответственно. Такие антитела могут быть идентифицированы, используя общепринятые способы конкурентного связывания, включая, например, основанные на поверхностном плазмонном резонансе способы конкурентного связывания.
В определенных вариантах осуществления антитела по изобретению связываются с конформационным эпитопом каллидина
(KD) или desArglО-каллидина (DAKD), который принимает "Рго4 кинк"-конформацию. Как показано на фигуре 17, отличительной особенностью "Рго4 кинк"-конформации является крутой поворот типа II в полипептидном каркасе основной цепи KD или DAKD в Пролине 4. Как известно специалисту в данной области, конформация крутого поворота типа II содержит три остатка (XI-Х2-ХЗ) с карбонильным остатком XI, образующим водородную связь с N амида остатка ХЗ, который, как правило, является глицином
(см. Richardson JS. "The anatomy and taxonomy of protein
structure". Adv Protein Chem. 1981;34:167-339, которая включена
в настоящий документ в качестве ссылки). Соответственно, в
определенных вариантах осуществления изобретения конформация
крутого поворота типа II формируется мотивом Pro3-Pro4-Gly5 KD
или DAKD. В более конкретных вариантах осуществления
изобретения, "Рго4 кинк"-конформация дополнительно
характеризуется всеми или практически всеми оставшимися аминокислотами KD (1-2 и 6-9) или DAKD, образуя повторы сигмоидной формы, которые располагают гидрофобные боковые цепи в виде пространственной многоуровневой структуры.
III. Модифицированные антитела против каллидина или des-Агдю-каллидина
В определенных вариантах осуществления изобретения, антитела против каллидина или des-Агдю-каллидина по изобретению могут содержать одну или несколько модификаций. Модифицированные формы антител против каллидина или des-Агдю-каллидина по изобретению могут быть созданы, используя любой
способ, известный в данной области, i) Снижение иммуногенности
В определенных вариантах осуществления антитела против каллидина или des-Агдю-каллидина, или их антиген-связывающие фрагменты, по изобретению модифицируют для снижения их иммуногенности, используя общепринятые в данной области способы. Например, антитела, или их фрагменты, могут быть химерными, гуманизированными и/или деиммунизированными.
В одном из вариантов осуществления антитело, или его антиген-связывающие фрагменты по изобретению, могут быть химерными. Химерное антитело является антителом, в котором различные части антитела происходят из разных видов животных, таких как антитела, имеющие вариабельный домен моноклональных антител мыши и константный домен иммуноглобулина человека. Способы получения химерных антител, или их фрагментов, известны в данной области. См., например, Morrison, Science 229:1202 (1985); Oi et al. , BioTechniques 4:214 (1986); Gillies et al. , J. Immunol. Methods 125:191-202 (1989); патент США № 5807715; 48165 67; и 48163 97, которые включены в настоящий документ в качестве ссылки в полном объеме. Способы, разработанные для получения "химерных антител" (Morrison et al. , Proc. Natl. Acad. Sci. 81:851-855 (1984); Neuberger et al., Nature 312:604608 (1984); Takeda et al. , Nature 314:452-454 (1985)), могут быть использованы для синтеза указанных молекул. Например, генетическая последовательность, кодирующая специфичность связывания молекул антител мыши против каллидина или des-ArglO-каллидина, может быть присоединена к последовательности из молекулы антитела человека с подходящей биологической активностью. В контексте настоящего изобретения химерным антителом является молекула, в которой различные части получают из разных видов животных, такие, которые имеют вариабельный домен, полученный из моноклонального антитела мыши, и константный домен иммуноглобулина человека, например, гумманизированные антитела.
В другом варианте осуществления антитело или его антиген-связывающий фрагмент по изобретению является гуманизированным.
Гуманизированные антитела имеют специфичность связывания, содержащую одну или несколько областей, определяющих комплементарность (CDR) антитела, отличного от антитела человека, и каркасные домены из молекулы антитела человека. Как правило, каркасные аминокислотные домены каркасных доменов человека могут быть замещены соответствующим доменом из донорской CDR с целью изменения, предпочтительно, улучшения, связывания антигена. Эти каркасные замены идентифицированы способами, хорошо известными в данной области, например, путем моделирования взаимодействий CDR и каркасных аминокислотных остатков для идентификации каркасных остатков, значимых для связывания антигена, и сравнения последовательностей для идентификации нетипичных каркасных остатков в определенных положениях. (См., например, Oueen et al., патент США № 5585089; Riechmann et al., Nature 332:323 (1988), которые включены в настоящий документ в качестве ссылки в полном объеме). Антитела можно гуманизировать, используя различные способы, известные в данной области, например, CDR-пересадка ((ЕР 239400; публикация РСТ WO 91/09967; патент США № 5225539; 5530101; и 5585089), обшивка или изменение поверхности (ЕР 592106; ЕР 519596; Padlan, Molecular Immunology 28(4/5):489-498 (1991); Studnicka et al. , Protein Engineering 7(6):805-814 (1994); Roguska. et al., PNAS 91:969-973 (1994)), и перестановка цепей (патент США № 5565332).
В конкретном варианте осуществления используют способ гуманизации, который основан на молекулярной гибкости антитела в течение и при иммунном распознавании (см., WO2009/032661, который включен в настоящий документ в качестве ссылки в полном объеме). Гибкость белка относится к молекулярной подвижности белковой молекулы. Гибкость белкка - это способность полноразмерного белка, части белка или единичного аминокислотного остатка принимать множество конформаций, которые значительно отличаются друг от друга. Информацию о гибкости белка можно получить, проводя эксперименты по рентгеновской кристаллографии белка (см., например, Kundu et al. 2002, Biophys J 83:723-732.), эксперименты по ядерно
магнитному резонансу (см., например, Freedberg et al. , J Am Chem Soc 1998, 120(31):7916-7923) или проводя моделирование молекулярной динамики (MD). Моделирование MD белка осуществляют на компьютере, что позволяет определить движение всех атомов белка в течение периода времени путем вычисления физических взаимодействий атомов друг с другом. Результатом моделирования MD является траектория изучаемого белка в течение периода времени моделирования. Траектория представляет собой множество белковых конформаций, также называемых снапшотами, которые периодически фиксируют в течение периода моделирования, например, каждую 1 пикосекунду (пс) . Путем анализа множества снапшотов можно количественно оценить гибкость аминокислотных остатков белка. Таким образом, гибкий остаток - это остаток, который принимает множество различных конформаций в рамках полипептида, в котором находится данный остаток. Способы MD хорошо известны в данной области, см., например, Brooks et al. "Proteins: A Theoretical Perspective of Dynamics, Structure and Thermodynamics" (Wiley, New York, 1988). Некоторые программные обеспечения позволяют моделировать MD, такие как Amber (см. Case et al. (2005) J Comp Chem 2 6:1668-1688), Charmm (см. Brooks et al. (1983) J Comp Chem 4:187-217; и MacKerell et al. (1998) в "The Encyclopedia of Computational Chemistry" vol. 1:271-177, Schleyer et al., eds. Chichester: John Wiley & Sons) или Impact (см. Rizzo et al. J Am Chem Soc; 2 000; 122 (51) :12898-12900) .
Большинство комплексов белка обладают относительно большой и планарной заглубленной поверхностью, и было показано, что гибкость связывающихся партнеров обусловливает происхождение их пластичности, позволяя им конформационно приспосабливаться друг к другу (Structure (2000) 8, R137-R142). Таким образом, как было показано, примеры "индуцированного соответствия" играют важную роль в белок-белковых контактных поверхностях. Кроме того, постоянно накапливается целый ряд данных, демонстрирующих, что белки действительно связывают лиганды различных форм, размеров и состава (Protein Science (2002) 11:184-187) и что конформационное разнообразие, по-видимому,
является существенной составляющей способности распознавать различных партнеров (Science (2003) 299, 1362-1367). Гибкие остатки участвуют в связывании белок-белковых партнеров
(Structure (2006) 14, 683-693) .
Гибкие остатки могут принимать различные конформаций, обеспечивая множество областей взаимодействия, которые, по-видимому, распознаются В-клетками памяти и запускают иммуногенный ответ. Таким образом, антитело может быть гуманизировано путем модификации целого ряда остатков из каркасного домена таким образом, что множество конформаций и областей распознавания, представленных у модифицированного антитела, максимально схожи с таковыми, характерными для антитела человека. Это можно достичь модификацией ограниченного числа остатков путем: (1) построения гомологичной модели родительского mAb и проведения моделирования MD; (2) анализа гибких остатков и идентификации наиболее гибких остатков молекулы антитела, отличного от антитела человека, а также идентификации остатков или мотивов, которые предположительно являются источником гетерогенности или реакции деградации; (3) идентификации антитела человека, обладающего наиболее сходным множеством областей распознавания, как и родительское антитело;
(4) определения гибких остатков, подлежащих мутированию; и (5) проверки наличия известных эпитопов Т-клеток или В-клеток. Гибкие остатки могут быть обнаружены путем расчета MD, как описано в настоящем документе, используя предполагаемую модель растворителя, которая лежит в основе взаимодействия водного растворителя с атомами белка в течение периода времени моделирования.
Как только произошла идентификация набора гибких остатков в пределах вариабельных легкой и тяжелой цепей, идентифицируют набор каркасных участков вариабельных доменов тяжелой и легкой цепей человека, которые напоминают таковые представляющего интерес антитела. Это может быть сделано, например, с использованием поисковой программы BLAST на наборе гибких остатков, сравнивая с базой данных последовательности антител зародышевой линии человека. Это может быть также осуществлено
путем сравнения динамики родительского mAb с динамикой библиотеки канонических структур зародышевой линии. Аминокислотные остатки CDR и соседние остатки исключены из поиска для обеспечения сохранности высокой аффинности к антигену. Гибкие остатки затем замещают.
Если несколько аминокислотных остатков человека
демонстрируют схожие гомологии, то при выборе руководствуются
также природой остатков, которая, по-видимому, может влиять на
характеристики раствора гуманизированного антитела. Например, в
экспонированных гибких петлях предпочтительными будут полярные
остатки по сравнению с гидрофобными остатками. Остатки, которые
являются потенциальным источником нестабильности и
гетерогенности также подвергают мутированию, даже если
находятся в CDR. Это касается экспонированных метионинов, так
как образование сульфоксида может быть результатом действия
радикалов кислорода, протеолитического расщепления
кислотолабильных связей, таких как у дипептида Asp-Pro (Drug Dev Res (2004) 61:137-154), сайты дезамидирования, обнаруженные с экспонированным остатком аспарагина, за которым следует небольшая аминокислота, такая как Gly, Ser, Ala, His, Asn или Cys (J Chromatog (2006) 837: 35-43), и сайты N-гликозилирования, такие как сайт Asn-X-Ser/Thr. Как правило, экспонированные метионины замещают Leu, экспонированные аспарагины замещают глутамином или аспартатом, или изменяют последующий остаток. В случае сайта гликозилирования (Asn-X-Ser/Thr), изменяют либо остаток Asn, либо Ser/Thr.
Получаемую в результате последовательность
комбинированного антитела проверяют на наличие известных В-
клеточных или линейных Т-клеточных эпитопов. Поиск выполняют,
например, с помощью общедоступной базы данных Immune Epitope
Data Base (IEDB) (Plos Biol (2005) 3(3)e91). Если известный
эпитоп обнаруживают в пределах комбинированной
последовательности, извлекают и производят замену другого набора последовательностей человека. Таким образом, в отличие от способа изменения поверхности в соответствии с патентом США № 5639641, как В-клеточно-опосредованный, так и Т-клеточно
опосредованный иммуногенные ответы рассматриваются данным способом. Способ также позволяет избежать проблемы потери активности, которые иногда наблюдаются при пересадке CDR (патент США № 5530101). Кроме того, вопросы стабильности и растворимости также рассматриваются в процессе конструирования и отбора, результатом которого является создание антитела, которое оптимизировано в плане низкой иммуногенности, высокой аффинности к антигену и улучшенных биофизических свойств.
В некоторых вариантах осуществления деиммунизация может быть использована для снижения иммуногенности антитела или его антиген-связывающего фрагмента. В контексте настоящего изобретения термин "деиммунизация" включает изменение антитела или его антиген-связывающего фрагмента с целью модификации Т-клеточных эпитопов (см., например, W09852976A1, WO0034317A2). Например, последовательности VH и VL исходного антитела могут быть проанализированы, и может быть создана "карта" Т-клеточных эпитопов человека из каждой области V, демонстрирующая расположение эпитопов в зависимости от областей, определяющих комплементарность (CDR) и других ключевых остатков в пределах последовательности. Индивидуальные Т-клеточные эпитопы из карты Т-клеточных эпитопов анализируют с целью идентификации альтернативных аминокислотных замен с низким риском изменения активности получаемого в результате антитела. Создают ряд альтернативных последовательностей VH и VL, содержащий комбинации аминокислотных замен, и эти последовательности затем включают в состав целого спектра каллидин- или des-ArglO-каллидин-специфичных антител или их фрагментов для использования в способах диагностики и лечения, описанных в настоящем документе, которые затем тестируют на функциональные свойства. Как правило, создают и тестируют от 12 до 24 вариантов антител. Собранные гены тяжелой и легкой цепи, содержащие модифицированные V и С-области человека, затем клонируют в векторы экспрессии и получающиеся в результате плазмиды вводят в клеточные линии для продукции целого антитела. Затем проводят сравнительный анализ антител подходящими биохимическими и биологическими способами, и
идентифицируют оптимальный вариант.
ii) Эффекторные функции и модификации Fc
Антитела против каллидина или des-ArglО-каллидина по изобретению могут содержать константную область антитела
(например, константную область IgG, например, константную область IgG человека, например, константную область IgGl или IgG4 человека), которая опосредует одну или несколько эффекторных функций. Например, связывание компонента С1 комплемента с константной областью антитела может активировать систему комплемента. Активация комплемента имеет важное значение при опсонизации и лизисе патогенов клеток. Активация комплемента также стимулирует воспалительный ответ и может быть также вовлечена в аутоиммунную гиперчувствительность. Кроме того, антитела связываются с рецепторами на различных клетках через Fc-область путем взаимодействия сайта связывания Fc-рецептора в Fc-области антитела с Fc-рецептором (FcR) на клетке. Существует целый ряд Fc-рецепторов, которые специфичны к различным классам антител, включая IgG (гамма-рецепторы), IgE
(эпсилон-рецепторы), IgA (альфа-рецепторы) и IgM (мю-рецепторы). Связывание антитела с Fc-рецепторами на клеточных поверхностях вызывает ряд важных и разнообразных биологических ответов, включая поглощение и разрушение покрытых антителами частиц, клиренс иммунных комплексов, лизис покрытых антителами клеток-мишеней клетками-киллерами (называемый опосредованной антителами клеточной цитотоксичностью, или ADCC), высвобождение медиаторов воспаления, плацентарный перенос и контроль синтеза иммуноглобулинов. В предпочтительных вариантах осуществления изобретения антитела или их фрагменты по изобретению связываются с рецептором Fc-гамма. В альтернативных вариантах осуществления антитела против каллидина или des-ArglО-каллидина по изобретению могут содержать константную область, которая лишена одной или нескольких эффекторных функций (например, активность ADCC) и/или не обладает способностью связывать рецептор Fc.
Определенные варианты осуществления включают антитела против каллидина или des-ArglО-каллидина, в которых по меньшей
мере одна аминокислота в одном или нескольких доменах константной области делетирована или, в ином случае, изменена таким образом, чтобы обеспечить желаемые биохимические характеристики, такие как сниженные или повышенные эффекторные функции, способность нековалентной димеризации, повышенная способность локализоваться в месте расположения опухоли, пониженное время полужизни в сыворотке, или увеличенное время полужизни в сыворотке по сравнению с целым, неизмененным антителом примерно такой же иммуногенности. Например, определенные антитела или их фрагменты, предназначенные для использования в способах диагностики и лечения, описанные в настоящем документе, представляют собой антитела с делетированным доменом, которые содержат полипептидную цепь, подобную тяжелой цепи иммуноглобулина, но у которых отсутствует по меньшей мере часть одного или нескольких доменов тяжелой цепи. Например, в определенных антителах, один домен целиком константной области модифицированного антитела делетируют, например, весь или часть домена СН2 делетируют.
В некоторых других вариантах осуществления изобретения антитела против каллидина или des-ArglО-каллидина содержат константные области, происходящие из различных изотипов антител (например, константные области из двух или большего количества IgGl, IgG2, IgG3 или IgG4 человека). В других вариантах осуществления антитела против каллидина или des-ArglО-каллидина содержат химерный шарнир (т.е., шарнир, содержащий части шарнира, полученные из доменов шарнира различных изотипов антител, например, верхний домен шарнира из молекулы IgG4 и средний домен шарнира IgGl). В одном из вариантов осуществления изобретения антитела против каллидина или des-ArglО-каллидина содержат область Fc или ее часть из молекулы IgG4 человека и мутацию Ser22 8Pro (нумерация EU) в коровой шарнирной области молекулы.
В определенных антителах против каллидина или des-Argl0-каллидина, часть Fc может быть мутирована для повышения или уменьшения эффекторной функции, используя способы, известные в данной области. Например, делеция или инактивация (посредством
точечных мутаций или другими способами) домена константной области может уменьшать связывание Fc-рецептором циркулирующего модифицированного антитела, тем самым увеличивая локализацию в опухоли. В других случаях, возможна ситуация, когда модификации константной области по настоящему изобретению ослабляют связывание комплемента и, таким образом, уменьшают время жизни в сыворотке и неспецифическую связь конъюгированного цитотоксина. Тем не менее, другие модификации константной области могут быть использованы для модификации дисульфидных связей или олигосахаридных функциональных групп, обеспечивающих повышенную локализацию вследствие повышенной антигенной специфичности или пластичности. Полученные в результате физиологический профиль, биодоступность и другие биохимические эффекты модификаций, такие как локализация в опухоли, биораспределение и время жизни в сыворотке, могут быть без труда измерены и количественно определены, используя хорошо известные иммунологические способы без чрезмерной постановки экспериментов.
В определенных вариантах осуществления, домен Fc, используемый в составе антитела по изобретению, является вариантом Fc. В контексте настоящего изобретения термин "вариант Fc" относится к домену Fc, имеющему по меньшей мере одну аминокислотную замену относительно домена Fc дикого типа, из которого указанный домен Fc был получен. Например, там, где домен Fc получен из антитела IgGl человека, вариант Fc указанного домена Fc IgGl человека содержит по меньшей мере одну аминокислотную замену относительно указанного домена Fc.
Аминокислотная(ые) замена(ы) варианта Fc может располагаться в любом положении (т.е., аминокислотные положения согласно условным обозначениям EU) в пределах домена Fc. В одном из вариантов осуществления вариант Fc содержит замену в аминокислотном положении, расположенном в шарнирном домене или его части. В другом варианте осуществления вариант Fc содержит замену в аминокислотной положении, расположенном в домене СН2 или его части. В другом варианте осуществления вариант Fc содержит замену в аминокислотном положении, расположенном в
домене СНЗ или его части. В другом варианте осуществления вариант Fc содержит замены в аминокислотном положении, расположенном в домене СН4 или его части.
Антитела по изобретению могут использовать любой известный в данной области вариант Fc, который, как известно, улучшает
(например, снижает или увеличивает) эффекторную функцию и/или связывание FcR. Указанные варианты Fc могут включать, например, любую аминокислотную замену, рассмотренную в международных публикациях РСТ WO88/07089A1, W096/14339A1, W098/05787А1, W098/23289A1, W099/51642А1, W099/58572A1, WO00/09560А2, WO00/32767A1, WO00/42072A2, WO02/44215А2, WO02/060919А2, WO03/074569A2, WO04/016750А2, WO04/029207А2, WO04/035752А2, WO04/063351A2, WO04/074455А2, WO04/099249А2, WO05/040217А2, WO05/070963A1, WO05/077981А2, WO05/092925А2, WO05/123780А2, WO06/019447A1, WOO6/047350А2, и WO06/085967A2 или патентах США №№ 5648260; 5739277; 5834250; 5869046; 6096871; 6121022; 6194551; 6242195; 6277375; 6528624; 6538124; 6737056; 6821505; 6998253; и 7083784, каждая из которых включена в настоящий документ в качестве ссылки. В одном из характерных вариантах антитело по изобретению может содержать вариант Fc, содержащий аминокислотную замену в 2 68 положении EU (например, H2 68D или Н2 68Е). В другом иллюстративном варианте антитело по изобретению может содержать аминокислотную замену в 239 положении EU (например, S2 3 9D или S2 3 9E) и/или 332 положении EU
(например, I332D или I332Q).
В определенных вариантах осуществления антитело по изобретению может содержать вариант Fc, содержащий аминокислотную замену, которая меняет антиген-независимые эффекторные функции антитела, в частности, время жизни антитела в циркуляторном русле. Такие антитела проявляют либо повышенное, либо пониженное связывание с FcRn по сравнению с антителами, у которых отсутствуют эти замены, тем самым, имеют увеличенное или пониженное время жизни в сыворотке, соответственно. Предполагается, что варианты Fc с улучшенной аффинностью в отношении FcRn имеют более продолжительное время жизни в сыворотке, и такие молекулы используют в способах
лечения млекопитающих, где желательным является продолжительное время жизни назначаемого антитела, например, с целью лечения хронического заболевания или нарушения. Напротив, предполагают, что варианты Fc со сниженной аффинностью связывания FcRn имеют более короткое время жизни, и такие молекулы также могут ипользоваться, например, для введения млекопитающим, где укороченное время циркуляции является предпочтительным, например, при диагностической визуализации in vivo или в ситуациях, где исходное антитело обладает токсическими побочными эффектами в случае присутствия в циркуляции в течение длительных периодов времени. Варианты Fc со сниженной аффинностью связывания FcRn также с меньшей вероятностью проникают через плаценту и, таким образом, также могут использоваться для лечения заболеваний или нарушений у беременной женщины. Кроме того, другие области применения, в которых предпочтительной является сниженная аффинность связывания FcRn, включает такие области применения, в которых желательна локализация в головном мозге, почках и/или печени. В одном из иллюстративных вариантах измененные антитела по изобретению характеризуются сниженным транспортом через эпителий почечных клубочков из сосудистого русла. В другом варианте измененные антитела по изобретению характеризуются сниженным транспортом через гематоэнцефалический барьер (ГЭБ) из мозговой ткани в сосудистое пространство. В одном из вариантов осуществления антитело с измененным связыванием FcRn содержит домен Fc, имеющий одну или несколько аминокислотных замен в пределах "связывающей FcRn петли" домена Fc. Связывающая FcRn петля состоит из аминокислотных остатков 2 8 02 99 (по нумерации EU). Характерные аминокислотные замены, которые изменяют активность связывания FcRn, рассмотрены в международной публикации РСТ № WO05/047327, которая вставлена в настоящий документ в качестве ссылки. В определенных характерных вариантах осуществления изобретения антитела или их фрагменты по изобретению содержат домен Fc, имеющий одну или несколько представленных ниже замены: V2 8 4E, Н2 8 5Е, N2 8 6D, К290Е и S304D (нумерация EU).
В других вариантах осуществления изобретения антитела для
использования в способах диагностики и лечения, описанные в
настоящем документе, имеют константную область, например,
константная область тяжелой цепи IgGl или IgG4, которую
модифицируют для снижения или устранения гликозилирования.
Например, антитело по изобретению может также содержать вариант
Fc, содержащий аминокислотную замену, которая приводит к
изменениям гликозилирования антитела. Например, указанный
вариант Fc может иметь сниженный уровень гликозилирования
(например, N- или О-сцепленное гликозилирование). В характерных
вариантах осуществления вариант Fc содержит сниженный уровень
гликозилирования N-сцепленного гликана, обнаруживаемого в норме
в аминокислотном положении 2 97 (нумерация EU). В другом
варианте осуществления изобретения, антитело имеет
аминокислотную замену вблизи или в пределах мотива
гликозилирования, например, мотив N-сцепленного
гликозилирования, который содержит аминокислотную
последовательность NXT или NXS. В частном варианте осуществления антитело содержит вариант Fc с аминокислотной заменой в аминокислотном положении 228 или 299 (нумерация EU). В более частном варианте осуществления изобретения, антитело содержит константную область IgGl или IgG4, содержащую мутацию S228P и Т299А (нумерация EU).
Характерные аминокислотные замены, которые обусловливают сниженный или измененный уровень гликозилирования, рассмотрены в международной публикации РСТ № WO05/018572, которая включена в качестве ссылки в настоящий документ. В предпочтительных вариантах осуществления антитела или их фрагменты по изобретению модифицируют для устранения гликозилирования. Такие антитела или их фрагменты могут быть названы "ад1у"-антителами или их фрагментами (например, < <ад1у"-антитела) . Не вдаваясь в теорию, предполагают, что "ад1у"-антитела, или их фрагменты, могут обладать улучшенной безопасностью и профилем стабильности in vivo. Характерные agly-антитела или их фрагменты включают агликозилированную область Fc антитела IgG4, которая лишена Fc-эффекторной функции, тем самым не допуская возможность
проявления Fc-опосредованной токсичности в отношении нормальных жизненно важных органов, которые экспрессируют каллидин или des-Argl0-каллидин. В других вариантах осуществления антитела или их фрагменты по изобретению содержат измененный гликан. Например, антитело может иметь сниженное число остатков фукозы на N-гликане в Asn297 области Fc, т.е., является афукозилированным. В другом варианте осуществления антитело может иметь измененное число остатков сиаловой кислоты на N-гликане в Asn2 97 области Fc.
iii) Ковалентное присоединение
Антитела против каллидина или des-ArglО-каллидина по изобретению могут быть модифицированы, например, путем ковалентного присоединения молекулы к антителу таким образом, что ковалентное присоединение не предотвращает специфическое связывание антитела с распознаваемым им эпитопом. Например, но не ими не ограничиваясь, антитела или их фрагменты по изобретению могут быть модифицированы путем гликозилирования, ацетилирования, пегилирования, фосфорилирования, амидирования, образования производных известными защитными/блокирующими группами, протеолитического расщепления, связывания с клеточным лигандом или другим белком и т.д. Любая из многочисленных химических модификаций может быть выполнена с помощью известных способов, включая, но но ими не ограничиваясь, специфическое химическое расщепление, ацетилирование, формилирование и т.д. Кроме того, производное может содержать одну или несколько неклассических аминокислот.
Антитела или его фрагменты по изобретению могут быть
дополнительно рекомбинантно слиты с гетерологичным полипептидом
на N- или С-конце или химически конъюгированы (включая
ковалентные и нековалентные конъюгации) с полипептидами или
другими соединениями. Например, антитела против каллидина или
des-ArglО-каллидина могут быть рекомбинантно сцеплены или
конъюгированы с молекулами, используемыми в качестве меток в
способах детекции и эффекторных молекул, таких как
гетерологичные полипептиды, лекарственные средства,
радионуклиды или токсины. См., например, публикации РСТ W0
92/08495; WO 91/14438; WO 89/12624; патент США № 5314995; и ЕР 396387.
Антитела против каллидина или des-ArglО-каллидина могут быть слиты с гетерологичными полипептидами для увеличения времени жизни in vivo или для использования в иммунологических анализах, используя способы, известные в данной области. Например, в одном из вариантов осуществления изобретения, ПЭГ может быть конъюгирован с антителами против каллидина или des-Argl О-каллидина по изобретению для увеличения их времени жизни in vivo. Leong, S. R., et al., Cytokine 16:106 (2001); Adv. in Drug Deliv. Rev. 54:531 (2002); или Weir et al. , Biochem. Soc. Transactions 30:512 (2002).
Более того, антитела против каллидина или des-ArglO-
каллидина по изобретению могут быть слиты с маркерными
последовательностями, такими как пептид для облегчения их
очистки или детекции. В предпочтительных вариантах
осуществления изобретения, маркерная аминокислотная
последовательность является гексагистидиновым пептидом, таким как метка, представленная в векторе pQE (QIAGEN, Inc., 9259 Eton Avenue, Chatsworth, Calif., 91311), в числе прочих, многие из которых доступны на коммерческом рынке. Как описано в Gentz et al., Proc. Natl. Acad. Sci. USA 86:821-824 (1989), например, гексагистидин обеспечивает подходящую очистку сцепленного белка. Другие пептидные метки, подходящие для очистки, включают, в числе прочего, метку "НА", которая соответствует эпитопу, полученному из гемагглютининового белка вируса гриппа (Wilson et al., Cell 37:767 (1984)), и метку "flag".
Антитела против каллидина или des-Argl0-каллидина по изобретению могут быть использованы в неконъюгированной форме или могут быть конъюгированы по меньшей мере с одной из многообразных молекул, например, для улучшения терапевтических свойств молекулы, для облегчения детекции мишени или для визуализации или терапии пациента. Антитела против каллидина или des-Argl0-каллидина по изобретению могут быть мечены или конъюгированы либо до очистки, либо после нее, если очистку проводят. В частности, антитела против каллидина или des-Argl0
каллидина по изобретению могут быть конъюгированы с терапевтическими средствами, пролекарствами, пептидами, белками, ферментами, вирусами, липидами, модификаторами биологического ответа, фармацевтическими веществами или ПЭГ.
Настоящее изобретение, кроме того, относится к антителам против каллидина или дез-ArglО-каллидина по изобретению, конъюгированным с диагностическим или терапевтическим средством. Антитела против каллидина или des-ArglО-каллидина могут быть использованы в диагностических целях, например, для мониторинга развития или прогрессирования иммуноклеточных нарушений (например, CLL) в рамках клинических испытаний, чтобы, например, определить эффективность конкретного лечения и/или схему профилактики. Детекция может быть упрощена посредством присоединения антител против каллидина или des-Argl О-каллидина к обнаруживаемому веществу. Примеры обнаруживаемых веществ включают различные ферменты, простетические группы, флуоресцентные вещества, люминесцентные вещества, биолюминесцентные вещества, радиоактивные вещества, позитрон-излучающие металлы с использованием различных позитронно-эмиссионных томографий и ионы нерадиоактивного парамагнитного металла. См., например, патент США № 4741900, рассматривающего ионы металлов, которые могут быть конъюгированы с антителами для использования в качестве диагностики по настоящему изобретением. Примеры подходящих ферментов включают пероксидазу хрена, щелочную фосфатазу, бета-галактозидазу или ацетилхолинэстеразу; примеры подходящих комплексов простетических групп включают стрептавидин/биотин и авидин/биотин; примеры подходящих флуоресцентных веществ включают умбеллиферон, флуоресцеин, изотиоцианат флуоресцеина, родамин, дихлортриазиниламинфлуоресцеин, дансилхлорид или фикоэритрин; пример люминесцентного вещества включает люминол; примеры биолюминесцентных веществ включают люциферазу, люциферин и экворин; и примеры подходящих радиоактивных веществ включают 1251, 1311, 111In или 99Тс.
Антитела против каллидина или des-Argl0-каллидина для применения в способах диагностики и лечения, описанных в
настоящем документе, могут быть конъюгированы с цитотоксинами
(такими как радиоизотопы, цитотоксические лекарственные
препараты или токсины), лекарственными средствами,
цитостатическими средствами, биологическими токсинами,
пролекарствами, пептидами, белками, ферментами, вирусами,
липидами, модификаторами биологического ответа,
фармацевтическими средствами, иммунологически активными лигандами (например, лимфокинами или другими антителами, где образованная в результате молекула связывается как с неопластической клеткой, так и эффекторной клеткой, такой как Т-клетка) или ПЭГ.
В другом варианте осуществления изобретения антитело против каллидина или des-ArglО-каллидина для применения в способах диагностики и лечения, описанных в настоящем документе, может быть конъюгировано с молекулой, которая снижает рост опухолевой клетки. В других вариантах осуществления изобретения, описанные композиции могут содержать антитела или их фрагменты, соединенных с лекарственными средствами или пролекарствами. При этом другие варианты осуществления настоящего изобретения включают применение антител или их фрагентов, конъюгрованных со специфическими биотоксинами или их цитотоксическими фрагментами, такими как рицин, гелонин, экзотоксин Pseudomonas или дифтерийный токсин. Выбор конъюгированного или неконъюгированного антитела для применения будет зависеть от типа и стадии рака, применения дополнительной терапии (например, химиотерапии или наружней лучевой терапии) и состояния пациента. Следует иметь в виду, что специалист в данной области может без труда сделать такой выбор с учетом описанных в настоящем документе принципов.
Следует иметь в виду, что в ранее приведенных исследованиях, противоопухолевые антитела, меченные изотопами, были успешно использованы для уничтожения опухолевых клеток на животных моделях, и в некоторых случаях на человеке. Характерные радиоизотопы включают: 90Y, 1251, 1311, 1231, lllln, 105Rh, 153Sm, 67Cu, 67Ga, 166Ho, 177Lu, 186Re и 188Re. Действие радионуклидов заключается в образовании ионизирующего
излучения, которое вызывает многочисленные разрывы цепей в ядерной ДНК, что приводит к клеточной гибели. Изотопы, используемые для получения терапевтических конъюгатов, как правило, дают альфа- или бета-частицы высокой энергии, которые имеют короткую длину пути. Такие радионуклиды уничтожают клетки, с которыми они находятся в непосредственной близости, например, опухолевыми клетками, к которым присоединился конъюгат или проник вовнутрь. Они оказывают небольшое влияние, или вовсе никакого влияния, на нелокализованные клетки. Радионуклиды, по существу, не являются иммуногенными.
IV. Экспрессия антител против каллидина или des-ArglO-каллидина, или их антиген-связывающих фрагментов
После методического этапа по выделению генетического материала для получения антител против каллидина или des-ArglO-каллидина по изобретению, как указано выше, гены, как правило, вводят в вектор экспрессии для введения в клетки-хозяина, которые могут быть использованы для получения желаемого количества заявленных антител или их фрагментов.
Термин "вектор" или "вектор экспрессии" используется в настоящем документе в рамках описания и формулы изобретения для обозначения векторов, используемых по настоящему изобретению, в качестве средства для введения внутрь клетки и экспрессии в ней мишеневого гена. Специалистам в данной области известно, что такие векторы без труда можно выбрать из группы, состоящей из плазмид, фагов, вирусов и ретровирусов. Как правило, векторы, совместимые с настоящим изобретением, будут включать селективный маркер, соответствующие сайты рестрикции для облегчения клонирования желаемого гена, и способность проникать внутрь клеток и/или реплицироваться в эукариотических или прокариотических клетках.
Многочисленные системы векторов экспрессии могут быть использованы в рамках настоящего изобретения. Например, один из классов векторов использует элементы ДНК, происходящие из вирусов животных, таких как вирус папилломы крупного рогатого скота, вирус полиомы, аденовирус, вирус коровьей оспы, бакуловирус, ретровирусы (RSV, MMTV или MOMLV) или вирус SV40.
Другие включают использование полицистронных систем с внутренними участками связывания рибосомы. Кроме того, клетки, которые интегрировали ДНК в свои хромосомы, могут быть отобраны путем введения одного или нескольких маркеров, которые позволяют идентифицировать трансфицированные клетки-хозяева. Маркер может обеспечить прототрофию ауксотрофному хозяину, биоцидную устойчивость (например, антибиотики) или устойчивость к тяжелым металлам, таким как медь. Селектируемый маркерный ген может либо напрямую быть связан с экспрессируемой последовательностью ДНК, либо быть введен в ту же самую клетку посредством котрансформации. Для оптимального синтеза мРНК также могут быть необходимы дополнительные элементы. Эти элементы могут включать сигнальные последовательности, сигналы сплайсинга, а также транскрипционные промоторы, энхансеры и сигналы терминации. В особо предпочтительных вариантах осуществления клонируемые гены вариабельного домена вводят в вектор экспрессии наряду с генами константного домена тяжелой и легкой цепей (предпочтительно, человека), искусственно созданные, как описано выше.
В других предпочтительных вариантах антитела против каллидина или des-ArglО-каллидина или их фрагменты по изобретению могут быть экспрессированы путем использования полицистронных конструкций. В таких экспрессионных системах, продукция целевых продуктов множественных генов, таких как тяжелая и легкая цепи антител, могут осуществляться с одной полицистронной конструкции. Эти системы, предпочтительно, используют участок внутренней посадки рибосомы (IRES) для обеспечения относительно высоких уровней полипептидов по изобретению в эукариотических клетках-хозяевах. Совместимые последовательности IRES рассмотрены в патенте США № 6193980, приведенный в настоящем документе в качестве ссылки. Специалисты в данной области понимают, что такие экспрессионные системы могут быть использованы для эффективного получения широкого спектра полипептидов, описанных в настоящей заявке.
В более общем смысле, как только вектор или последовательность ДНК, кодирующая антитело или его фрагмент,
был получен, вектор экспрессии может быть введен в подходящую
клетку-хозяин. Другими словами, клетки-хозяева могут быть
трансформированы. Введение плазмиды в клетку-хозяин может быть
выполнено различными способами, хорошо известными специалистам
в данной области. К ним относятся, помимо прочего, трансфекция
(включая электрофорез и электропорацию), слияние протопластов,
преципитация фосфатом кальция, слияние клеток с упакованной
ДНК, микроинъекция и инфицирование интактным вирусом. См.,
Ridgway, A. A. G. "Mammalian Expression Vectors" Chapter 24.2,
pp. 470-472 Vectors, Rodriguez and Denhardt, Eds.
(Butterworths, Boston, Mass. 1988). Наиболее предпочтительным
является введение плазмиды в клетку-хозяин посредством
электропорации. Трансформированные клетки культивируют в
условиях, подходящих для получения легких цепей и тяжелых
цепей, и анализируют их на предмет белкового синтеза тяжелой
и/или легкой цепи. Характерные способы анализа включают
иммуносорбентный ферментный анализ (ELISA),
радиоиммунологический анализ (RIA) или активируемый флуоресценцией сортерный анализ клеток (FACS), иммуногистохимия и тому подобное.
В контексте настоящего изобретения термин "трансформация" следует использовать в широком смысле для обозначения введения ДНК в реципиентную клетку-хозяин, которая изменяет генотип и впоследствии приводит к изменению реципиентной клетки.
В контексте настоящего изобретения "клетки-хозяева" относятся к клеткам, которые были трансформированы векторами, сконструированными с использованием технологии рекомбинантной ДНК и кодирующими по меньшей мере один гетерологичный ген. В описаниях процессов выделения полипептидов из рекомбинантных хозяев термины "клетка" и "клеточная культура" используются взаимозаменяемо для указания источника антитела, за исключением тех случаев, когда четко указано иное. Другими словами, выделение полипептида из "клеток" может означать либо выделения из клеточного осадка после центрифугирования, либо из клеточной культуры, содержащей как среду, так и суспендированные клетки.
В одном из вариантов осуществления изобретения линию
клеток-хозяев, используемую для экспрессии антитела, получают из млекопитающих; специалисты в данной области могут определить конкретные линии клеток-хозяев, которые наилучшим образом подходят для целевого продукта гена для экспрессии в них. Характерные линии клеток-хозяев включают, помимо прочего, DG4 4 и DUXB11 (линии клеток яичника китайского хомячка, DHFR минус), HELA (карцинома шейки матки человека), CVI (клеточная линия почек обезьяны) , COS (производная от CVI с антигеном SV4 0 Т) , R1610 (фибробласты китайского хомячка), BALBC/3T3 (фибробласты мышей), НАК (линия почек хомяка), SP2/0 (миеломы мыши), BFA-lclBPT (бычьи эндотелиальные клетки), RAJI (лимфоцит человека), 293 (почки человека). В одном из вариантов осуществления линия клеток обеспечивает измененное гликозилирование, например, афукозилирование, экспрессированных в ней антител (например, PER.C6.RTM. (Crucell) или клеточные линии СНО FUT 8-нокаут (Potelligent.RTM. Cells) (Biowa, Princeton, NJ) ) . В одном из вариантов осуществления изобретения могут быть использованы клетки NSO. Клетки СНО являются особенно предпочтительными. Линии клеток-хозяев, как правило, доступны на коммерческом рынке, американской коллекции культуры тканей или из литературных источников.
Продукция in vitro позволяет масштабное производство с получением огромных количеств целевых полипептидов. Способы культивирования клеток млекопитающих в условиях тканевой культуры известны в данной области и включают гомогенную суспензионную культуру, например, в аэролифтном реакторе или в реакторе непрерывного перемешивания, или иммобилизованная или заключенная в оболочку клеточная культура, например, в полых волокнах, микрокапсулах, на агарозных микрошариках или пьезоэлектрических головках. Если необходимо и/или желательно, растворы полипептидов могут быть очищены с помощью обычных способов хроматографии, например, гель-фильтрации, ионообменной хроматографии, хроматографии на ДЭАЭ-целлюлозе, и/или (иммуно-) аффинной хроматографии.
Гены, кодирующие антитела против каллидина или des-Argl0-каллидина или их фрагменты по изобретению могут быть также
экспрессированы в клетках, не являющихся клетками млекопитающих, таких как бактерии или дрожжи или растительные клетки. В связи с этим следует иметь в виду, что различные одноклеточные микроорганизмы, не относящиеся к млекопитающим, такие как бактерии, также могут быть трансформированы; т.е. одноклеточные микроорганизмы, которые обладают способностью расти в культурах или ферментации. Бактерии, которые подвержены трансформации, включают члены семейства энтеробактерий, такие как штаммы Escherichia coli или Salmonella; Bacillaceae, такие как Bacillus subtilis; Pneumococcus; Streptococcus и Haemophilus influenzae. Кроме того, следует понимать, что при экспрессии в бактериях, полипептиды могут стать частью телец включения. Полипептиды должны быть выделены, очищены и затем собраны в функциональные молекулы.
Кроме прокариот могут быть также использованы эукариотические микробы. Saccharomyces cerevisiae, или обычные пекарские дрожжи, являются наиболее широко используемыми среди эукариотических микроорганизмов, хотя ряд других штаммов являются общедоступными. Для экспрессии в Saccharomyces, обычно используется, например, плазмида YRp7, (Stinchcomb et al. , Nature, 282:39 (1979); Kingsman et al. , Gene, 7:141 (1979); Tschemper et al., Gene, 10:157 (1980)). Эта плазмида уже содержит ген TRP1, который представляет собой селективный маркер для мутантного штамма дрожжей, не способного расти в триптофане, например, АТСС № 44076 или РЕР4-1 (Jones, Genetics, 85:12 (1977)). Наличие дефекта по trpl в качестве характеристики генома дрожжевой клетки-хозяина в таком случае обеспечивает эффективные условия для обнаружения трансформации по клеточному росту в отсутствие триптофана.
V. Фармацевтические композиции и способы применения антител против каллидина или des-Argl0-каллидина.
В другом аспекте настоящее изобретение относится к фармацевтическим композициям, содержащим антитело против каллидина или дез-Argl0-каллидина или его фрагмент.
Способы получения и введения антител или их фрагментов по изобретению индивидом хорошо известны или могут быть легко
определены специалистами в данной области. Способ введения
антител или их фрагментов по изобретению может быть
пероральным, парентеральным, ингаляционным или местным. Термин
парентеральный в контексте настоящего изобретения включает
внутривенное, внутриартериальное, внутрибрюшинное,
внутримышечное, подкожное, ректальное или вагинальное применение. Внутривенный, внутриартериальный, подкожный и внутримышечный способы парентерального применения обычно являются предпочтительными. Хотя все эти способы введения четко рассматриваются в рамках настоящего изобретения, форма для введения будет представлять собой раствор для инъекций, в частности, для внутривенных или внутриартериальных инъекций или капельного способа введения. Как правило, подходящие фармацевтические композиции для инъекции могут содержать буфер (например, ацетатный, фосфатный или цитратный буфер), поверхностно-активное вещество (например, полисорбат), в некоторых случаях стабилизирующее средство (например, альбумин человека) и т.д. Тем не менее, в других способах, совместимых с идей настоящего изобретения, полипептиды могут быть доставлены напрямую к участку локализации неблагоприятной клеточной популяции, тем самым увеличивая воздействие терапевтического средства на пораженную ткань.
Препараты для парентерального применения включают стерильные водные или неводные растворы, суспензии и эмульсии. Примерами неводных растворителей являются пропиленгликоль, полиэтиленгликоль, растительные масла, такие как оливковое масло, и инъецируемые органические сложные эфиры, такие как этилолеат. Водные носители включают воду, спиртовые/водные растворы, эмульсии или суспензии, в том числе солевые и буферные среды. По настоящему изобретению фармацевтически приемлемые носители включают, помимо прочего, 0,01-0,1М и предпочтительно, 0,05 М фосфатный буфер или 0,8% физиологический раствор. Другие общепринятые парентеральные носители включают растворы фосфата натрия, декстрозу Рингера, декстрозу и хлорид натрия, раствор Рингера с лактатом или жирные масла. Внутривенные наполнители включают жидкие и
питательные наполнители, электролитные наполнители, такие как те, в основе которых находится декстроза Рингера, и тому подобное. Консерванты и другие добавки могут также присутствовать, такие как, например, противомикробные, антиоксидантные, хелатирующие средства, и инертные газы и тому подобное. В частности, фармацевтические композиции, подходящие для инъекционного использования, включают стерильные водные растворы (когда водорастворимые) или дисперсии и стерильные порошки для экстемпорального получения стерильных инъекционных растворов или дисперсий. В таких случаях композиция должна быть стерильной и должна быть жидкой до такой степени, чтобы обеспечить легкое введение с помощью шприца. Она должна быть стабильной в условиях производства и хранения и предпочтительно будет защищена от загрязняющего действия микроорганизмов, таких как бактерии и грибы. Носитель может быть растворителем или дисперсионной средой, содержащими, например, воду, этанол, полиол (например, глицерин, пропиленгликоль и жидкий полиэтиленгликоль и тому подобное.) и их подходящие смеси. Надлежащую текучесть можно поддерживать, например, путем использования покрытия, такого как лецитин, путем поддержания требуемого размера частиц в случае дисперсии и путем использования поверхностно-активных веществ. Предотвращение действия микроорганизмов может быть достигнуто с помощью различных антибактериальных и противогрибковых средств, например, парабенов, хлорбутанола, фенола, аскорбиновой кислоты, тимеросала и тому подобного. Во многих случаях будет предпочтительно включать изотонические вещества, например сахара, многоатомные спирты, такие как маннит, сорбит или хлорид натрия в композиции. Пролонгированная абсорбция инъекционных композиций может быть осуществлена путем включения в композицию вещества, которое задерживает абсорбцию, например, моностеарат алюминия и желатин.
В любом случае, стерильные инъекционные растворы могут быть получены путем введения активного соединения (например, антитела самого по себе или в комбинации с другими активными веществами) в требуемом количестве в соответствующий
растворитель с одним ингредиентом или их комбинацией, перечисленных в настоящем документе, в соответствии с требованиями, с последующей стерилизацией фильтрованием. Как правило, дисперсии получают введением активного соединения в стерильный наполнитель, который содержит основную дисперсионную среду и требуемые другие ингредиенты из тех, которые перечислены выше. В случае стерильных порошков для получения стерильных инъекционных растворов предпочтительными способами получения являются вакуумная сушка и лиофилизация, в результате применения которых получают порошок активного ингредиента плюс любой дополнительный требуемый ингредиент из их ранее стерилизованного фильтрацией раствора. Препараты для инъекций обрабатывают, помещают в контейнеры, такие как ампулы, мешки, бутылки, шприцы или флаконы, и герметизируют в стерильных условиях в соответствии с методами, известными в данной области. Кроме того, препараты могут быть упакованы и проданы в форме набора, такого как те, которые описаны в одновременно рассматриваемых патентных заявках США серийный № 09/259337 и серийный № 09/259338, каждая из которых включена в настоящий документ в качестве ссылки. Такие изделия, предпочтительно, имеют наклейки или вкладыши, указывающие на то, что связанные с ними композиции подходят для лечения индивида, страдающего от или предрасположенного к аутоиммунным или опухолевым заболеваниям.
Эффективные дозы стабилизированных антител или их фрагментов по настоящему изобретению для лечения описанных выше патологических состояний изменяются в зависимости от многих различных факторов, включая способы применения, сайт-мишень, физиологическое состояние пациента, является ли пациент человеком или животным, другие применяемые лекарственные препараты, и является ли лечение профилактическим или терапевтическим. Как правило, пациентом является человек, но млекопитающие, отличные от человека, включая трансгенных млекопитающих, также могут подвергаться лечению. Лечебные дозировки могут быть оттитрованы с использованием общепринятых методов, известных специалистам в данной области, с целью
оптимизации безопасности и эффективности.
Для пассивной иммунизации антителом по изобретению, дозировка может изменяться в диапазоне, например, приблизительно от 0, 0001 до 100 мг/кг, и чаще от 0,01 до 5 мг/кг (например, 0,02 мг/кг, 0,2 5 мг/кг, 0,5 мг/кг, 0,7 5 мг/кг, 1 мг/кг, 2 мг/кг и т.д.) веса тела хозяина. Например, доза может составлять 1 мг/кг массы тела или 10 мг/кг массы тела или в диапазоне 1-10 мг/кг, предпочтительно, по крайней мере, 1 мг/кг. Дозы промежуточного значения в указанных диапазонах также предназначены для рассмотрения в рамках настоящего изобретения.
Индивидам могут быть назначены такие дозы ежедневно, по альтернативным дням, еженедельно или в соответствии с любой другой схемой, определенной эмпирическим путем. Характерное лечение включает введение нескольких доз в течение длительного периода времени, например, по меньшей мере шести месяцев. Дополнительные характерные схемы лечения включают введение один раз в каждые две недели или раз в месяц или раз в каждые З-б месяцев. Характерные схемы применения включают 1-10 мг/кг или 15 мг/кг по следующим подряд дням, 30 мг/кг по альтернативным дням или 60 мг/кг еженедельно. В некоторых методах, два или более моноклональных антитела с различными специфичностями связывания назначают одновременно, и в этом случае дозу каждого назначенного антитела можно снизить в пределах указанных диапазонов.
Антитела или их фрагменты по изобретению могут быть назначены для многократного применения. Интервалы между разовыми дозами могут составлять, например, день, неделю, месяц или год. Интервалы могут быть также нерегулярными в соответствии с измерениями в крови уровней полипептида или молекулы-мишени у пациента. В некоторых методах дозу подбирают для получения определенной концентрации антитела или токсина в плазме, например, 1-1000 мкг/мл или 25-300 мкг/мл. Кроме того, антитела или их фрагменты могут быть введены как композиции с пролонгированным высвобождением, в случае, если требуется менее частое применение. Доза и частота изменяются в зависимости от
времени жизни антитела в организме пациента. Как правило, гуманизированные антитела обладают самым протяженным временем жизни по сравнению с химерными антителами и антителами, не являющимися антителами человека. В одном из вариантов осуществления, антитела или их фрагменты по изобретению могут быть использованы в неконъюгированной форме. В другом варианте осуществления, антитела по изобретению могут быть использованы несколько раз в конъюгированной форме. В еще одном варианте осуществления, антитела или их фрагменты по изобретению могут быть использованы в неконъюгированной форме, затем в конъюгированной форме или наоборот.
Доза и частота приема могут изменяться в зависимости от того, является ли лечение профилактическим или терапевтическим. В случае профилактического применения, композиции, содержащие антитела по настоящему изобретению или их смесь, используются пациентом, у которого нет болезненного состояния, для повышения резистентности у пациента. Такое количество называют "профилактически эффективной дозой". В случае такого использования, точные количества также зависят от состояния здоровья пациента и общего иммунитета, но, как правило, находятся в диапазоне от 0,1 до 25 мг на дозу, предпочтительно от 0,5 до 2,5 мг на дозу. Относительно низкую дозу используют при относительно нечастых интервалах в течение длительного периода времени. Некоторые пациенты продолжают получать лечение до конца своей жизни.
При терапевтическом применении, иногда требуются относительно высокие дозы (например, приблизительно от 1 до 400 мг/кг антитела на дозу, где дозы от 5 до 25 мг являются наиболее часто используемыми в случае радиоиммуноконъюгатов и более высокие дозы в случае конъюгированных молекул цитотоксин-лекарственное средство) при относительно коротких интервалах до тех пор, пока не будет снижено или остановлено прогрессирование заболевания, и предпочтительно, пока у пациента не будет отмечено частичное или полное облегчение симптомов заболевания. Затем патенту может быть назначена профилактическая схема приема лекарственного средства.
В одном из вариантов осуществления изобретения индивиду может быть введена молекула нуклеиновой кислоты, кодирующая полипептид по изобретению (например, в составе вектора). Дозы для нуклеиновых кислот, кодирующих полипептиды, находятся в диапазоне приблизительно от 10 нг до 1 г, 100 нг до 100 мг, 1 мкг до 10 мг, или 30-300 мкг ДНК на одного пациента. Дозы для инфекционных вирусных векторов изменяются от 10-100 или более вирионов на дозу.
Терапевтические средства могут использоваться
парентерально, местно, внутривенно, перорально, подкожно,
внутриартериально, интракраниально, внутрибрюшинно,
интраназально или внутримышечно для профилактического и/или терапевтического лечения. Внутримышечная инъекция или внутривенная инфузия являются предпочтительными для применения антитела по изобретению. В некоторых методах, терапевтические антитела или их фрагменты вводят непосредственно в черепную коробку. В некоторых методах, антитела или их фрагменты применяют в виде композиции с пролонгированным высвобождением или устройства, такого как устройство Medipad(tm).
Средства по изобретению в некоторых случаях могут быть использованы в комбинации с другими средствами, которые эффективны в лечении нарушения или патологического состояния у нуждающегося в лечении (например, профилактическом или терапевтическом). Предпочтительными дополнительными средствами являются средства, которые используются в данной области и стандартным образом при определенном нарушении.
Эффективные однократные лечебные дозы (например, терапевтически эффективные количества) 90У-меченых антител по изобретению находятся в диапазоне приблизительно от 5 до приблизительно 7 5 мКи, более предпочтительно, в диапазоне приблизительно от 10 до приблизительно 4 0 мКи. Эффективные однократные лечебные некостномозговые аблационные дозы 1311-меченые антитела находятся в диапазоне приблизительно от 5 до приблизительно 7 0 мКи, более предпочтительно, в диапазоне приблизительно от 5 до приблизительно 4 0 мКи. Эффективные однократные лечебные аблационные дозы (т.е., может
потребоваться трансплантация аутологичного костного мозга) 1311-меченых антител находятся в диапазоне приблизительно от 30 до приблизительно 600 мКи, более предпочтительно, в диапазоне приблизительно от 50 до менее чем приблизительно 500 мКи. В отношении химерного модифицированного антитела, вследствие более длительного времени жизни в циркуляторном русле по отношению к антителам мыши, эффективные однократные лечебные некостномозговые аблационные дозы меченых йодом-131 химерных антител находятся в диапазоне приблизительно от 5 до приблизительно 4 0 мКи, более предпочтительно, приблизительно менее 30 мКи. Критерии визуализации, например, для метки ИИп, как правило, составляют приблизительно менее 5 мКи.
Несмотря на то, что огромный клинический опыт накоплен в отношении 1311 и .90Y, другие радиоактивные метки известны в данной области и были использованы для аналогичных целей. Тем не менее, используются другие радиоизотопы для формирования изображения. Например, дополнительные радиоизотопы, которые совместимы с объемом настоящего изобретения, включают, помимо прочего, 1231, 1251, 32Р, 57Со, 64Cu, 67Cu, 77Br, 81Rb, 81Кг, 87Sr, 113In, 127Cs, 129Cs, 1321, 197Hg, 203Pb, 206Bi, 177Lu, 186Re, 212Pb, 212Bi, 47Sc, 105Rh, 109Pd, 153Sm, 188Re, 199Au, 225Ac, 211A 213Bi. В этом отношении альфа-, гамма- и бета-излучатели совместимы с настоящем изобретением. Кроме того, принимая во внимание настоящее описание изобретения, утверждается, что специалист в данной области может легко определить, какие радионуклиды совместимы с выбранным курсом лечения без излишнего экспериментирования. С этой целью, дополнительные радионуклиды, которые уже были использованы в клиническом диагнозе, включают 1251, 1231, 99Тс, 43К, 52Fe, 67Ga, 68Ga, а также 111In. Антитела могут быть также мечены различными радионуклидами для возможного использования в направленной на мишень иммунотерапии (Peirersz et al. Immunol. Cell Biol. 65: 111-125 (1987)). Эти радионуклиды включают 188Re и 186Re, а также 199Au и 67Cu в меньшей степени. Патент США № 5460785 предоставляет дополнительные данные в отношении таких радиоизотопов и включен в настоящий документ в качестве ссылки.
Как обсуждалось ранее, антитела или их фрагменты по
изобретению можно использовать в фармацевтически эффективном
количестве для in vivo лечения нарушений у млекопитающих. В
связи с этим, следует иметь в виду, что будет составлена
рецептура описанных антител или их фрагменты таким образом,
чтобы облегчить их применение и способствовать стабильности
активного вещества. Предпочтительно, фармацевтические
композиции по настоящему изобретению содержат фармацевтически
приемлемый, нетоксичный, стерильный носитель, такой как
физиологический раствор, нетоксичные буферы, консерванты и тому
подобное. В рамках настоящей заявки, под фармацевтически
эффективным количеством антитела по изобретению,
конъюгированного или неконъюгированного с терапевтическим средством, следует понимать количество, достаточное для получения эффективного связывания с мишенью и достижения положительной динамики, например, для улучшения симптомов заболевания или нарушения или для обнаружения вещества или клетки. В случае опухолевых клеток, полипептид, предпочтительно, будет обладать способностью взаимодействовать с определенными иммунореактивными антигенами на неопластических или иммунореактивных клетках и обеспечивать увеличение гибели этих клеток. Конечно, фармацевтические композиции по настоящему изобретению могут быть применены в виде одной или нескольких доз для обеспечения фармацевтически эффективного количества полипептида.
В рамках настоящего изобретения антитела по изобретению
могут быть назначены человеку или другому животному в
соответствии с вышеуказанными способами лечения в количестве,
достаточном для получения терапевтического или
профилактического эффекта. Полипептиды по изобретению могут быть назначены такому человеку или другому животному в обычной лекарственной форме, полученной комбинированием антитела по изобретению с общепринятым фармацевтически приемлемым носителем или разбавителем в соответствии с известными способами. Специалист в данной области подтвердит, что форма и свойства фармацевтически приемлемого носителя или разбавителя диктуется
количеством активного ингредиента, с которым он должен быть объединен, способом применения и другими хорошо известными параметрами. Кроме того, специалисты в данной области подтвердят, что смесь, содержащая один или несколько видов полипептидов по настоящему изобретению, может оказаться особенно эффективной.
VI. Способы лечения связанных с каллидином или des-ArglO-каллидином заболеваний или нарушений
Антитела против каллидина или des-ArglО-каллидина или их фрагменты по изобретению могут быть эффективны для противодействия активности каллидина или des-ArglО-каллидина. Соответственно, в другом аспекте, настоящее изобретение относится к способам лечения связанных с каллидином или des-Argl О-каллидином заболеваний или нарушений путем введения индивиду, при необходимости, фармацевтической композиции, содержащей одно или несколько антител против каллидина или des-Argl О-каллидина антитело или их антиген-связывающего фрагмента по изобретению.
Связанное с каллидином или des-ArglО-каллидином заболевание или нарушение, на которое направлено лечение, включает, помимо прочего, патофизиологические состояния, такие как воспаление, травма, ожоги, шок, аллергия, острая или хроническая боль и фиброз, например, фиброз почек. В некоторых характерных вариантах осуществления антитела по изобретению могут быть предназначены для лечения фиброза почек и связанного острого повреждения почек, а также хронических заболеваний почек, которые являются основными причинами терминальной стадии почечной недостаточности.
Специалист в данной области с помощью общепринятых экспериментов сможет определить, какое эффективное, нетоксическое количество антитела (или дополнительного терапевтического средства) требуется для лечения связанного с каллидином или des-ArglО-каллидином заболевания или нарушения. Например, терапевтически активное количество полипептида может изменяться в соответствии с такими факторами, как стадия заболевания (например, стадия I по сравнению со стадией IV) ,
возраст, пол, медицинские осложнения (например,
иммуносупрессивные патологические состояния или заболевания) и вес индивида, и способностью антитела вызывать желаемый ответ у индивида. Схему приема лекарственного средства можно изменять для обеспечения оптимального терапевтического ответа. Например, несколько разделенных доз можно вводить ежедневно, или доза может быть пропорционально снижена в зависимости от требований терапевтической ситуации. Как правило, однако, полагают, что эффективная доза находится в диапазоне приблизительно от 0,05 до 100 миллиграммов на килограмм веса тела в день и, более предпочтительно, приблизительно от 0,5 до 10 миллиграммов на килограмм веса тела в день.
VII. Иллюстративный пример
Настоящее изобретение дополнительно иллюстрировано
следующими примерами, которые не должны быть истолкованы как
дополнительное ограничение. Содержание списка
последовательностей, фигуры и все ссылки, патенты и опубликованные патентные заявки, приведенные в данной заявке, специально включены в настоящий документ в качестве ссылки.
Кроме того, в соответствии с настоящим изобретением могут быть использованы общепринятые способы молекулярной биологии, микробиологии и рекомбинантной ДНК в данной области. Такие способы подробно описаны в литературе. См., например, Sambrook, Fritsch & Maniatis, Molecular Cloning: A Laboratory Manual, Second Edition (1989) Cold Spring Harbor Laboratory Press, Cold Spring Harbor, New York (herein "Sambrook et al. , 1989"); DNA Cloning: A Practical Approach, Volumes I and II (D.N. Glover ed. 1985); Oligonucleotide Synthesis (M.J. Gait ed. 1984) Nucleic Acid Hybridization [B.D. Hames & S.J.Higgins eds
(1985) ]; Transcription And Translation [B.D. Hames & S.J Higgins, eds. (1984)]; Animal Cell Culture [R.I. Freshney, ed
(1986) ]; Immobilized Cells And Enzymes [IRL Press, (1986)]; В Perbal, A Practical Guide To Molecular Cloning (1984); F.M Ausubel et al. (eds.), Current Protocols in Molecular Biology John Wiley & Sons, Inc. (1994).
Пример 1: Получение гибридом: иммунизация мышей пептидом
каллидина, конъюгированного с KLH, и получение антител против лигандов BKR1 человека
Цель заключалась в разработке перекрестно реактивных антител против каллидина (KD; SEQ ID N0:1) и des-arg-каллидина
(DAKD; SEQ ID N0:2), что будет ингибировать связывание этих лигандов с BKR1 человека. Как правило, иммунизацию мышей KD, конъюгированного с KLH через дополнительные цистеины либо на С, либо на N-конце пептида, использовали для получения спленоцитов мыши для слияния с клеточными линиями миеломы мыши в качестве партнера слияния для получения гибридом.
Кратко, протокол иммунизации был следующим: мыши BALB/c
(не подвергавшиеся какому-либо воздействию самки в возрасте 82 0 недель) были иммунизированы внутрибрюшинно смесью одинаковых количеств KLH-KD и KD-KLH в фосфатно-солевом буферном растворе
(PBS) в качестве антигена в общем количестве 100 мкг на мышь, смешанного в соотношении 1:1 с адъювантной системой Sigma Adjuvant System (Sigma каталожный #6322) в общем объеме 200 мкл на мышь (день 0) . На 21 день мышей иммунизировали смесью одинаковых количеств KLH-KD и KD-KLH в PBS в качестве антигена в общем количестве 50 мкг на мышь, смешанного в соотношении 1:1 с адъювантной системой Sigma Adjuvant System (Sigma каталожный #6322) в общем объеме 200 мкл на мышь. На 30-й день собирали образцы крови для оценки титра антител, специфичных к KD. На 51 день мышей иммунизировали для слияния смесью одинаковых количеств KLH-KD и KD-KLH в PBS в качестве антигена в общем количестве 50 мкг на мышь, смешанного в соотношении 1:1 с адъювантной системой Sigma Adjuvant System (Sigma каталожный #6322) в общем объеме 200 мкл на мышь. На 55 день мышей забивали в С02-камере, образцы крови собирали посредством пункции сердца, и селезенку извлекали для получения гибридомы.
Гибридомы были получены путем слияния клеток миеломы мыши, которые дефицитны по аденозинфосфорибозилтрансферазе (APRT), с клетками селезенки от мышей, иммунизированных специфическими антигенами. Система отбора, использующая среду HAT
(гипоксантин, азасерин и тимидин) уничтожает все, кроме клеток слияния, которые являются APRT+. Эффективные гибридомы должны
также сохранять тяжелую цепь иммуноглобулина (Igh), один из локусов легкой цепи иммуноглобулина и секретировать функциональные антитела.
Среда получения гибридомы (IMDM) была приготовлена путем объединения следующих компонентов: 500 мл среды Дульбекко, модифицированной по способу Исков Iscove's Modified Dulbecco's Medium (HyClone SH30259.01), 50 мл эмбриональной телячьей сыворотки (HyClone SH30070.03), 5 мл L-глутамина (Gibco Invitrogen каталожный # 25030), 5 мл заменимых аминокислот (Gibco Invitrogen каталожный # 11140050), 5 мл пирувата натрия (Gibco Invitrogen каталожный # 11360070), 5 мл 0,1% пенициллина-стрептомицина (Gibco Invitrogen каталожный # 15140148) . Среда была профильтрована перед использованием. Среда роста была получена путем объединения следующих компонентов: 1000 мл бессывороточной среды (Gibco Hybridoma SFM # 12045), 100 мл 10% фетальной бычьей сыворотки HyClone SuperLow IgG Defined FBS # SH30898.03 и 10 мл пенициллина/стрептомицина. Среда для замораживания состояла из 45 мл инактивированной нагреванием FBS (HyClone SH30070.03) и 5 мл ДМСО, стерилизованной через фильтр. Другие материалы включали следующее: HAT (50х) получали из Sigma-Aldrich (# Н0262); Hybridoma Fusion и Cloning Supplement (50X) (Roche Diagnostics 11 363 735 001); 0,4% трипановый синий (Invitrogen каталожный # 15250-061 или T10282); ПЭГ 1500 в 75 мМ 50% Hepes вес/объем (Roche каталожный # 783641 (10783641001). Все реагенты, кроме HAT и Hybridoma Fusion и Cloning Supplement, были использованы при 37°С.
биотин-KRPPGFSPF
b-DAKD
KRPPGFSPF-биотин
DAKD-b
KLH-KRPPGFSPF
KLH-DAKD
KRPPGFSPF-KLH
DAKD-KLH
RRPPGFSPFR
подобный каллидину пептид
KLP
биотин-RRPPGFSPFR
b-KLP
RRPPGFSPFR-биотин
KLP-b
KLH-RRPPGFSPFR
KLH-KLP
RRPPGFSPFR-KLH
KLP-KLH
RRPPGFSPF
Подобный
desArglОкаллидину пептид
DAKLP
биотин-RRPPGFSPF
b-DAKLP
RRPPGFSPF-биотин
DAKLP-b
KLH-RRPPGFSPF
KLH-DAKLP
RRPPGFSPF-KLH
DAKLP-b
RPPGF
брадикинин!-5
BK15
биотин-RPPGF
b-BK15
Вкратце, за три или четыре дня до слияния клеток, мышей иммунизировали целевым антигеном либо внутрибрюшинно, либо внутривенно. В день слияния клеток, мышь была умерщвлена в С02-камере, образцы крови были собраны посредством пункции сердца, и селезенка была извлечена и помещена в 10 мл бессывороточной IMDM в чашку Петри. Участвующие в слиянии клетки миеломы FO (АТСС номер CRL-1646)/ Х63 Ад8.653 (АТСС номер CRL1580) растили в логарифмическую фазу, затем разводили за день до слияния (1:2 и 1:5), и собирали в 20 мл центрифужные пробирки, центрифугировали и ресуспендировали осадок в 10 мл IMDM. Осадок два раза промывали бессывороточной средой IMDM. Все центрифугирования выполняли при 157 0 об/мин в течение 5 мин. Последнее ресуспендировали выполняли в 10 мл бессывороточной среды IMDM. Соединительная ткань удаляли от селезенки. В селезенку вводили 1 мл бессывороточной IMDM, предварительно нагретой до 37°С, шприцом на 1 мл и иглой 25 размера. Спленоциты выдавливали из фиброэластической оболочки пинцетом и промывали два раза в 10 мл бессывороточной IMDM (включая начальное центрифугирование) и ресуспендировали в 10 мл бессывороточной IMDM. Клетки подсчитывали в автоматизированном счетчике клеток Countess Automated Cell Counter.
Участвующие в слиянии клетки и спленоциты объединяли в одну 50 мл пробирку в соотношении 1:2 - 1:10 (по числу клеток) и центрифугировали при 97 0 об/мин в течение 10 мин (медленное центрифугирование) с образованием рыхлого осадка. После "медленного" центрифугирования с осторожностью отбирали супернатант, не затрагивая осадка, но сводя к минимуму количество жидкости над клетками для того, чтобы не разводить PEG 1500. Оставшуюся среду сохраняли и вновь добавляли после добавления PEG (ниже). Предварительно нагретый PEG 1500 (37°С, общий объем 1 мл) добавляли по каплям к клеточному осадку в течение 1 мин, и клетки смешивали после каждой добавленной капли PEG. Осадок инкубировали с PEG в течение еще 1 минуты с последующим добавлением 10 мл бессывороточной среды IMDM в течение 1 минуты таким образом, что первый 1 мл из 10 мл добавляют в течение 3 0 сек. Клетки подвергали медленному
центрифугированию при 97 0 об/мин в течение 10 мин, и супернатант сливали. В (2) 100 мл емкости добавляли следующее: 7 0 мл IMDM с 10% FBS, 2 мл HAT и 2 мл Hybridoma и Fusion Cloning Supplement. Клетки ресуспендировали в 10 мл IMDM с добавлением 10% FBS и помещали в (2) 50 мл пробирки (5 мл клеток/пробирка), и добавляли 25 мл IMDM с 10% FBS. Полученные в результате 30 мл переносили в емкости, содержащие 70 мл HBSS/HAT/cloning supplement, и 200 мкл клеток/лунка вносили пипеткой в (10) 9б-луночных планшета. Процесс слияния клеток был готов к скрининговому анализу способом ELISA (50 мкл) приблизительно через 10-14 дней, или когда среда в лунках становилась желтого цвета. После первичного скрининга отбирали положительные клоны, нумеровали и переносили в 24-луночный планшет в количестве 50 0 мкл на лунку IMDM с добавлением 10% FBSHI. Супернатанты гибридом анализировали способом ELISA на стрептавидином покрытии с нанесенными N- и С-концевыми биотинилированными пептидами (см., ниже).
Пример 2: Характеристика и отбор гибридом, экспрессирующих антитела против лигандов BKR1 человека
Супернатанты гибридом подвергали скринингу способом ELISA на стрептавидином покрытии с нанесенными N- и С-концевыми биотинилированными пептидами (см., например, те, которые указаны в Таблице 2), а затем были определены кинетики связывания антител для подтвержденных положительных клонов гибридом.
Способность антител в супернатантах гибридом связывать пептид лиганда BKR1 оценивали способом ELISA. DAKD-биотинилированные или KD-биотинилированные пептиды наносили на 9б-луночную плашку SA в забуференном фосфатом солевом буфере (PBS) в течение часа при комнатной температуре при 5 мкг/мл, и сайты неспецифического связывания блокировали 1% бычьим сывороточным альбумином (BSA) в буфере PBS. Эта плашка была использована для выполнения первичного и вторичного скрининга неочищенных супернатантов гибридом. Супернатанты гибридом были добавлены к плашкам для связывания с покрытыми пептидами КД или DAKD. После часовой инкубации плашку промывали, и детектировали
связанные антитела с использованием пероксидазы хрена (HRP),
конъюгированной с вторичными антителами (HRP-козий антимышиный
IgG (H+L): Jackson ImmunoResearch Labs # 115-035-166) и
выраженность реакции определяли по субстрату 2,2-азино-бис (3-
этилбензотиазолин-б-сульфоновой кислоте) (ABTS) (Roche
diagnostics # 11 204 521 001) . Данные были проанализированы с использованием Excel. Антитела, демонстрирующие положительные сигналы (в 2 раза выше ELISA-сигнала разведения сыворотки 1:10000), были отобраны и подвергнуты повторному скринингу дважды для подтверждения. Подтвержденные положительные клоны гибридом были отобраны и классифицированы по скорости диссоциации-связывания на Biacore.
Для анализа кинетики связывания антител используемыми инструментами были BIACORE 2000 или BIACORE 3000 (GE Healthcare), предназначенные для анализа биомолекулярного взаимодействия (BIA) в режиме реального времени. Использовали чип SA сенсорного устройства (GE Healthcare) со стрептавидином, ковалентно иммобилизованным на карбоксиметилированном декстрановом матриксе. Каждый чип сенсорного устройства имеет четыре параллельных проточных ячеек (Fc). Каждый биотинилированный пептид лиганда BKR1 или BKR2 был иммобилизован в одной из проточных ячеек со 2 по 4 (Fc2 по Fc4) в чипе SA для скрининга скорости диссоциации-связывания и скрининга селективности. Проточная ячейка 1 (Fcl) была зарезервирована, и в ней был иммобилизован случайный пептид (биотинилированный на одном конце) с длиной пептида, равной или близкой таковой тестируемых пептидов лигандов, в качестве отрицательного контроля. В скрининговых анализах супернатанты клеточных культур клонов гибридом, отобранных с помощью первичного скрининга временно экспрессируемых гуманизированных вариантов, наносили поверх иммобилизованных пептидов. Среды культур клеток гибридом также наносили на поверхность чипа в качестве контрольной пробы, чтобы установить базовую линию. После вычитания сигналов Fcl и пустых буферных серий, скорость диссоциации антител из супернатантов к каждому пептиду анализировали и классифицировали с помощью программного
обеспечения BIAevaluation. Только те клоны антител, которые
продемонстрировали превосходные (kd <10-4 1/с) скорости
диссоциации-связывания, были отобраны для субклонирования и
дальнейшей характеристики. В кинетическом анализе
соответствующие биотинилированные пептиды, идентифицированные в скрининге тестирования антител, были иммобилизованы в ячейках с Fc2 по Fc4, в то время как Fcl с иммобилизованным случайным пептидом был использован в качестве контрольной ячейки. Были сделаны серии двукратных разведений каждого очищенного антитела, выбранного по результатам скрининга, в рабочем буфере (1 х HBS-EP буфер, GE Healthcare) в диапазоне от 0,1 до 10 нМ. Скорость ассоциации связывания, скорость диссоциации и аффинность в целом были вычислены в BIAevaluation. Кинетики связывания антител для каждого антитела всегда подтверждали в повторенных трижды анализах с помощью Biacore.
В общей сложности, 8 мышей было иммунизировано смесью KLH-KD/KD-KLH и KLH-DAKD/DAKD-KLH, и клетки селезенки участвовали в слиянии с помощью перечисленных выше протоколов. После первичного скрининга приблизительно 7 68 0 клонов гибридом способом ELISA с DAKD-биотином и KD-биотином, только 7 6 клонов оказались положительными и были отобраны для ранжирования скорости диссоциации-связывания в Biacore 3000/2000 в стрептавидиновых чипах (SA) с иммобилизованными DAKD-биотин и KD-биотин. Среди них, 8 клонов гибридом со скоростью диссоциации-связывания <= 10~4 субклонировали, секвенировали, очищали и в дальнейшем характеризовали (см. Таблицу 3).
(HM)
b-BK
ELISA
Biacore (KD,M)
BK-b
ELISA
Biacore (KD,M)
8, 57 E-09
FLIPR (нМ)
b-KD
ELISA
Biacore (KD,M)
KD-b
ELISA
Biacore (KD,M)
8,4 E-ll
2,21 E-10
2,9 E-ll
2,9 E-ll
7,8 E-ll
7, 53 E-10
NTD
NTD
(15 нМ)М)
FLIPR (нМ)
3, 0
3, 0
7,3
8,3
NA = отсутствуют данные, отрицательный сигнал в ELISA NS = неспецифическое связывание NTD = не подлежит измерению
-* = остаточное связывание (низкие значения RU в Biacore)
На основании результатов, представленных в Таблице 3, пять клонов с уникальными последовательностями были отобраны для кинетических исследований. Эти антитела обладали высокой селективностью связывания с DAKD-биотином, KD-биотином, DAKLP-биотином и KLP-биотином (см. Таблицу 4) . Они не связываются с другими кининовыми пептидами или пептидами, биотинилированными по N-концу.
Была выполнена дополнительная иммунизация набором иммуногенов (см. список пептидов, Талица 2) для получения антител, блокирующих лиганды BKR1, DABK и DAKD грызунов, а также антител с другими специфичностями связывания против различных членов пептидов семейства кининов. В Таблице 5 перечислены последовательности тяжелой и легкой цепи полученных антител.
В21
EVOLOOSGAELVRSGASVKLSCTASGFNIKDYYLHWVKORPEOGLEWIGWIDPENGDTGYARKFOGKAT MTADTSSNTVYLHLSSLTSEDTAVYYFNAWEYDGYYDLDYWGOGTSVTVSSAKTTPPS
СбЗ
EVKLEESGGGLVQPGGSMKLSCVASGFTFSNYWMNWVROSPEKGLEWVAEIRSKSNNYATHYAESVKGR FTISRDDSKSSVYLQMNNLRAEDTGIYYCIGEDYGGDYWGQGTSVTVSSAKTTPPS
F151
mlgGl/K
EIOLOOSGPELVKPGTSVKVSCKASGYSFTDYNIYWVKOSHGKSLEWIGYFDPYNGNTGYNOKFRGKAT LTVDKSSSTAFMHLSSLTSDDSAVYYCANYYRYDDHAMDYWGOGTSVTVSSAKTTPPS
122
EVOLOOSGAELVRSGASVKLSCTASGFNIKDYYMHWVKORPEOGLEWIGWVDPENGDSDYAPKFOGKAT MTADTSSNTVYLQFSSLTSEDTAVYYCNAFEYDGNYSPLDFWGQGTSVTVSSAKTTPPS
154
EVOLOOSGAELVRSGASVKLSCTASGFNIKDYYMHWVKORPEOGLEWIGWVDPENGDSDYAPKFOGKAT MTADTSSNTVYLQFSSLTSEDTAVYYCNAFEYDGNYSPLDFWGQGTSVTVSSAKTTPPS
Антитело
Изотип
SEQ ID NO:
Последовательность легкой цепи
В21
102
ELDIVMTOTTLTLSVTIGOPASISCKSSOSLLYSNGKTYLNWLLORPGOSPKRLIYLVSKLDSGVPDRF TGSGSGTDFTLKIIRVEAEDLGVYYCLOGTHFPYTFGGGTKLEIKRADAAPTVSIFPPSKLELY
СбЗ
103
ELDIVLTOSPSSLAVSVGEKVTMSCKSSOSLLYSSDORNYLAWYOORSGOSPKLLIYWASTRESGVPDR
IgGl/k
FTGSGSGTDFTLTISSVKAEDLAVYYCOOYYSYPYTFGGGTKLEIKRADAAPTVSIFPPSKLELY
F151
104
ELDIVMTOTPSSLAVSVGEKVTMSCKSSOSLLYTSNOKNYLAWYOOKPGOSPKPLIYWASTRESGVPDR FTGSGSGTDFTLTISSVKAEDLAIYYCOOYYSYPWTFGGGTKLEIKRADAAPTVSIFPPSKLELY
122
105
ELDIVITOTTLSLSVPIGOPASISCKSROSLLYSNGETYLNWLLQRPGOSPKRLIYLVSKLDSGVPDRF TGSRSGTDFTLKISRVESEDLGVYYCMOGTHFPYTFGGGTKLEIKRADAAPTVSIFPPSKLELY
154
106
ELDIVITOSTLTLSVPIGOPASISCKSSOSLLYSNGETYLNWLLORPGOSPKROIYLVSKLDSGVPDRF TGSRSGTDFTLKISRVESEDLGVYYCMOGTHFPYTFGGGTKLEIKRADAAPTVSIFPPSKLELY
В21
mlgGl/K
DWMTOTPLTLSVTIGOPASISCKSSOSLLYSNGKTYLNWLLQRPGOSPKRLIYLVSKLDSGVPDRFTG SGSGTDFTLKIIRVEAEDLGVYYCLQGTHFPYTFGGGTKLEIKRADAAPT
СбЗ
DIVMSOSPSSLAVSVGEKVTMSCKSSOSLLYSSDORNYLAWYOQRSGOSPKLLIYWASTRESGVPDRFT GSGSGTDFTLTISSVKAEDLAVYYCOOYYSYPYTFGGGTKLEIKRADAAPT
F151
DIVMSOSPSSLAVSVGEKVTMSCKSSOSLLYSSNQKNYLAWYQQKPGOSPKPLIYWASTRESGVPDRFT GSGSGTDFTLTISSVKAEDLAIYYCQQYYSYPWTFGGGTKLEIKRADAAPT
122
DIVMTOSPSSLSVSAGEKVTMSCKSSOSLLNSGNQKNYLAWYOOKPGOPPKLLIYGASTRESGVPDRFT GSGSGTDFTLTISSVOAEDLAVYYCONDHSYPLTFGAGTKLELKRADAAPT
154
DVVMTOTPLTLSVPIGOPASISCKSSOSLLYSNGETYLNWLLQRPGOSPKRLIYLVSKLDSGVPDRFTG SRSGTDFTLKISRVESEDLGVYYCMOGTHFPYTFGGGTKLEIKRADAAPT
Одно нижнее подчеркивание = область CDR; Двойное нижнее подчеркивание = ключевые аминокислоты для идентификации CDR
Пример 3. Получение антител-имитаторов для исследования на
мышах
Антитело-имитатор, подлежащее использованию в
исследованиях на мышах, необходимых для обеспечения возможности связывать и нейтрализовать лиганды BKR1 грызунов, DABK и DAKLP
(мышиный эквивалент DAKD). Для получения требуемого антитела-имитатора мышей сначала иммунизировали DABK и/или DAKD с KLH, напрямую конъюгированного с N-концами пептидов. Клоны гибридом, положительных по биотин-ОАВК/биотин-ОАКО (биотинилирование непосредственно на N-конце пептида) по результатам скрининга способом ELISA, были отобраны для увеличения в количестве и очистки. Антитела, перечисленные в Семействе 7 (см. Таблицу 12), которые демонстрировали высокие аффинности связывания с биотин-DABK, биотин-DAKLP и биотин-DAKD, были отобраны по результатам способа прямого связывания на Biacore (Таблица 10). Однако эти антитела Семейства 7 не демонстрировали никакого связывания с нативными, немодифицированными пептидами DABK и DAKD в конкурентном ELISA, и не обладали нейтрализующей функциональной активностью в методе притока кальция в Системе функционального скрининга лекарственных средств (FDSS)
(Hamamatsu Photonics К.К., Japan). Кроме того, биотин-DABK и биотин-DAKD полностью утрачивали биологическую активность в анализе FDSS по сравнению с нативными, немодифицированными пептидами DABK и DAKD (данные не показаны).
Было высказано предположение, что непосредственное присоединение к N-концу KLH и биотина предотвращало формирование нативной конформаций DARK и DAKD. С целью восстановления нативной конформаций пептидов, конъюгированных с KLH и биотином, были сконструированы и добавлены к N-концу DABK и/или DAKD линкеры с намерением "смягчения" влияния присоединения KLH/биотина на конформацию пептида. Сначала были попробованы и протестированы полиглициновые линкеры в связи с их простыми, неполярными и нейтральными свойствами, руководствуясь результатами моделирования. Результаты анализа FDSS показали, что линкер Gly-Gly-Gly (3G) был лучшим в соответствии с его способностью восстанавливать биоактивности
пептидов DABK и DAKD, конъюгированных с KLH и биотином (данные не показаны). Поэтому, KLH-3G-DABK был выбран для иммунизации мышей. И биотин-SG-DABK, и биотин-SG-KD были использованы в основанных на связывании скрининговых исследованиях (ELISA и Biacore). Несколько специфичных для DABK/DAKD антител (Семейство 3, см. таблицу 13) было идентифицировано в этом новом цикле отбора антител-имитаторов гибридом. ЕЕ1 был выбран в качестве ведущего антитела-имитатора на основании его превосходной аффинности связывания и нейтрализующей активности против нативных DABK/DAKD и отсутствия перекрестной реактивности к другим пептидам (см. Таблицы 6-12).
Антитела с различными свойствами были получены при использовании различных иммуногенов, перечисленных в Таблице 13. Антитела семейства 4 были специфичны к лигандам рецепторов BKR2, ВК и KD. Антитела семейства 5 специфически связываются с С-концом ВК и DABK. Антитела семейства б связывают ВК, DABK и DAKD, но не связываются с KD.
Были проанализированы дополнительные линкеры на предмет их связывания с антителом-имитатором ЕЕ1 по их способности встраиваться в связывающий DABK/DAKD карман в ЕЕ1, в том числе более длинные полиглициновые линкеры, полиаланиновые линкеры и уже существующие линкеры, такие как полиэтиленгликолевый (PEG2) линкер и линкер аминокапроновой кислоты (Ahx) (б-углеродный инертный линкер). Все линкерные пептиды были синтезированы на заказ фирмой Abgent (Can Diego, СА). Все протестированные биотинилированные пептиды с линкерами (биотин-линкер-DABK/DAKD) хорошо связывались с ЕЕ1, указывая на то, что любые инертные N-концевые линкеры помогали пептидам DABK и DAKD сохранять их нативную биологически активную конформацию в случае связывания с биотином и другими молекулами. Напротив, наблюдали отсутствие связывания или очень слабое связывание с ЕЕ1 биотин-DABK и биотин-DAKD, пептидов, которые имеют прямое N-концевое конъюгирование с биотином (см. Фиг. 1).
Кинетики связывания полученных антител приведены в Таблицах 5-11. Затем все полученные антитела были классифицированы в виде семейств, и их специфичности связывания
приведены ниже в Таблице 12. В Таблице 13 представлены последовательности тяжелой и легкой цепи антител, которые вошли в состав семейства 1 и семейства 2 на основании их специфичности связывания (см. Таблицу 12).
Таблица б
Сводная информация по кинетическим данным антител против
Сводная информация по кинетическим данным антител против пептидов b-3G-KLP и b-3G-KD
Клон
b-3G-KLP
b-3G-KD
Ка(1/Мс)
Kd(l/c)
KD (M)
Ka(1/Mc)
Kd(l/c)
KD (M)
DD2 0
3,8Е+05
5,7E-04
1,5E-09
n/b
n/b
n/b
UR11
n/b
n/b
n/b
1,2E+05
1,3E-03
1,1E-08
DD7
1,5Е+05
2,1E-03
1,5E-08
2,2E+05
1,8E-03
8,4E-09
ЕЕ1
4,OE+05
2,1E-03
5,3E-09
n/b
n/b
n/b
ЕЕЗб
n/b
n/b
n/b
n/b
n/b
n/b
UR2 9
n/b
n/b
n/b
n/b
n/b
n/b
JK3
n/b
n/b
n/b
LR4
n/b
n/b
n/b
n/b
n/b
n/b
LR16
n/b
n/b
n/b
n/b
n/b
n/b
LR6
n/b
n/b
n/b
n/b
n/b
n/b
LR12
n/b
n/b
n/b
n/b
n/b
n/b
NR1
n/b
n/b
n/b
n/b
n/b
n/b
NR15
n/b
n/b
n/b
n/b
n/b
n/b
n/b = нет связывания; ND = не определено
Сводная информация по кинетическим данным антител против
пептидов DABK-b и DAKLP-b
Клон
DABK-b
DAKLP-b
Ка(1/Мс)
Kd(l/c)
KD (M)
Ka(1/Mc)
Kd(l/c)
KD (M)
DD2 0
n/b
n/b
n/b
n/b
n/b
n/b
UR11
n/b
n/b
n/b
n/b
n/b
n/b
DD7
n/b
n/b
n/b
n/b
n/b
n/b
ЕЕ1
n/b
n/b
n/b
n/b
n/b
n/b
ЕЕЗб
n/b
n/b
n/b
n/b
n/b
n/b
UR2 9
1,5E+06
5,8E-05
3, 9E-
3,OE+06
2,1E-03
6,8E-10
JK3
n/b
n/b
n/b
n/b
n/b
n/b
LR4
n/b
n/b
n/b
n/b
n/b
n/b
LR16
n/b
n/b
n/b
n/b
n/b
n/b
LR6
n/b
n/b
n/b
n/b
n/b
n/b
LR12
n/b
n/b
n/b
n/b
n/b
n/b
NR1
n/b
n/b
n/b
n/b
n/b
n/b
NR15
n/b
n/b
n/b
n/b
n/b
n/b
n/b = нет связывания; ND = не определено
Таблица 10
Сводная информация по кинетическим данным антител против
пептидов ВК-Ь и Ь-ВК.
Клон
BK-b
b-BK
Ka(1/Mc)
Kd(l/c)
KD (M)
Ka(1/Mc)
Kd(l/c)
KD (M)
DD2 0
n/b
n/b
n/b
n/b
n/b
n/b
UR11
n/b
n/b
n/b
n/b
n/b
n/b
DD7
n/b
n/b
n/b
n/b
n/b
n/b
ЕЕ1
n/b
n/b
n/b
n/b
n/b
n/b
ЕЕЗб
n/b
n/b
n/b
n/b
n/b
n/b
UR2 9
1,5E+06
1,OE-04
7, 2E-
n/b
n/b
n/b
JK3
n/b
n/b
n/b
n/b
n/b
n/b
LR4
n/b
n/b
n/b
n/b
n/b
n/b
LR16
n/b
n/b
n/b
n/b
n/b
n/b
LR6
n/b
n/b
n/b
n/b
n/b
n/b
LR12
n/b
n/b
n/b
n/b
n/b
n/b
NR1
n/b
n/b
n/b
8,69E+04
8,77E-
1,01E-08
NR15
n/b
n/b
n/b
2,95E+05
1,09E-
3,68E-09
n/b =
нет связывания; ND
= не определено
Таблица 11
Сводная информация по кинетическим данным антител против
пептидов b-DABK и b-DAKD
Клон
b-DABK
b-DAKD
Ka(1/Mc)
Kd(l/c)
KD (M)
Ka(1/Mc)
Kd(l/c)
KD (M)
DD2 0
n/b
n/b
n/b
n/b
n/b
n/b
UR11
n/b
n/b
n/b
n/b
n/b
n/b
DD7
n/b
n/b
n/b
n/b
n/b
n/b
ЕЕ1
n/b
n/b
n/b
n/b
n/b
n/b
ЕЕЗб
n/b
n/b
n/b
n/b
n/b
n/b
UR2 9
n/b
n/b
n/b
n/b
n/b
n/b
JK3
n/b
n/b
n/b
n/b
n/b
n/b
LR4
1,48E+05
1,04E-03
7,15E-
3,27E+05
7,63E-
2,36E-09
LR16
4,34E+05
4,38E-05
1,01E-
2,07E+05
3,39E-
1,65E-08
LR6
n/b
n/b
n/b
n/b
n/b
n/b
LR12
2,91E+05
5,40E-04
3,63E-09
n/b
n/b
n/b
NR1
n/b
n/b
n/b
n/b
n/b
n/b
NR15
n/b
n/b
n/b
n/b
n/b
n/b
п/Ь =
нет связывания; ND
= не определено
Сводная информация по кинетическим данным антител против
пептидов b-DAKLP и b-KD
Clone
b-DAKLP
b-KD
Ка(1/Мс)
Kd(l/c)
KD (M)
Ka(1/Mc)
Kd(l/c)
KD (M)
DD2 0
n/b
n/b
n/b
n/b
n/b
n/b
UR11
n/b
n/b
n/b
n/b
n/b
n/b
DD7
n/b
n/b
n/b
n/b
n/b
n/b
ЕЕ1
n/b
n/b
n/b
n/b
n/b
n/b
ЕЕЗб
n/b
n/b
n/b
n/b
n/b
n/b
UR2 9
n/b
n/b
n/b
n/b
n/b
n/b
JK3
n/b
n/b
n/b
n/b
n/b
n/b
LR4
1,84E+05
2,58E-04
1,40E-09
n/b
n/b
n/b
LR16
2,34E+05
1,11E-
4,74E-10
n/b
n/b
n/b
LR6
6,80E+05
4,01E-
7,45E-10
n/b
n/b
n/b
LR12
n/b
n/b
n/b
n/b
n/b
n/b
NR1
n/b
n/b
n/b
1,66E+05
5,81E-
3,56E-08
NR15
n/b
n/b
n/b
7,66E+05
5,66E-
7,41E-09
n/b = нет связывания; ND = не определено
Был использован функциональный анализ для дополнительной характеристики семи семейств полученных антител. Проведение сигнала через рецептор В1 брадикинина сопряжено с белком Gq, поэтому активацию рецептора можно контролировать путем опосредованной белком Gq активации IP3 и последующей мобилизации кальция. Клетки НЕК с mBKRl (рекомбинантным рецептором В1 брадикинина мыши) или MRC5 (эндогенная экспрессия рецепторов В2 брадикинина (АТСС CCL-171)) были использованы для измерения мобилизации кальция.
Вкратце, ген Bdkrbl мыши (последовательность приведена
ниже) амплифицировали на кДНК легкого мыши (Biochain, Cat #
С1334152) с использованием праймеров ПЦР 804_cGWY_F: 5'-
AAAAGCAGGCTTAGGAGCGGCCGCCATGGCGTCCCAGGCCTCGCTG-3' (SEQ ID
N0:107) и 804_cGWY_R: 5'-
CAAGAAAGCTGGGTCGGATCCTTATAAAGTTCCCAGAACCCTGGTC-3' (SEQ ID
N0:108) и полимеразы Pfu (Agilent Technologies, каталожный номер # 600264) и клонировали в pDONR201 с использованием смеси фермента клоназы BP (Invitrogen, каталожный номер # 11789-020). Параллельно, вектор экспрессии рЕАК8 (EDGE Biosystems) был
модифицирован путем вставки N-концевой метки НА (GСATАСССATACGACGТ СССAGAC ТACGС Т, GenBank SEQ ID N0:109 CY100443) в рЕАК8, линеаризованную EcoRI и HindiII (вектор РЕАК8-пНА), и последующей вставки кассеты В Gateway (Invitrogen, каталожный номер # 11828-029) в рЕАК8_пНА, расщепленную EcoRI и Notl с образованием тупых концов полимеразой Кленова (NEB, каталожный номер # M0210S), в результате чего был получен вектор pEAK8_nHA_DEST. Затем Bdkrbl мыши был субклонирован в pEAK8_nHA_DEST с помощью клоназы LR (Invitrogen, каталожный номер # 11791-100) . Затем клетки 293-PSC были трансфицированы плазмидой рЕАК8-Bdkrbl, используя реагент для трансфекции Fugene б. Через 24 часа после трансфекции клетки были помещены в условия селекции антибиотиком (пуромицином), и условия селекции поддерживалась для получения стабильной клеточной линии. Наличие гена Bdkrbl в полученных стабильных клеточных линиях было подтверждено с помощью ОТ-ПЦР в реальном времени, и с помощью электрофореза в агарозном геле. Экспрессию рецептора В1 брадикинина на клеточной поверхности выявляли путем использования антитела против N-концевой-НА метки (Covance, каталожный номер # MMS-101Р) на B1R брадикинина на приборе FACS. Функциональная активность рецептора В1 брадикинина была продемонстрирована в анализе мобилизации кальция с использованием селективных агонистов.
Ген Bdkrbl, субклонированный в клетки: ATGGCGTCCCAGGCCTCGCTGAAGCTACAGCCTTCTAACCAAAGCCAGCAGGCCCCTCCCAAC ATCACCTCCTGCGAGGGCGCCCCGGAAGCCTGGGATCTGCTGTGTCGGGTGCTGCCAGGGTTT GTCATCACTGTCTGTTTCTTTGGCCTCCTGGGGAACCTTTTAGTCCTGTCCTTCTTCCTTTTG CCTTGGCGACGATGGTGGCAGCAGCGGCGGCAGCGCCTAACCATAGCAGAAATCTACCTGGCT AACTTGGCAGCTTCTGATCTGGTGTTTGTGCTGGGCCTGCCCTTCTGGGCAGAGAACGTTGGG AACCGTTTCAACTGGCCCTTTGGAAGTGACCTCTGCCGGGTGGTCAGCGGGGTCATCAAGGCC AACCTGTTCATCAGCATCTTCCTGGTGGTGGCCATCAGTCAGGACCGCTACAGGTTGCTGGTA TACCCCATGACCAGCTGGGGGAACCGGCGGCGACGGCAAGCCCAAGTGACCTGCCTGCTCATC TGGGTAGCTGGGGGCCTCTTGAGCACCCCCACGTTCCTTCTGCGTTCCGTCAAAGTCGTCCCT GATCTGAACATCTCTGCCTGCATCCTGCTTTTCCCCCACGAAGCTTGGCACTTTGTAAGGATG GTGGAGTTGAACGTTTTGGGTTTCCTCCTCCCATTGGCTGCCATCCTCTACTTCAACTTTCAC
ATCCTGGCCTCCCTGAGAGGACAGAAGGAGGCCAGCAGAACCCGGTGTGGGGGACCCAAGGAC AGCAAGACAATGGGGCTGATCCTCACACTGGTAGCCTCCTTCCTGGTCTGCTGGGCCCCTTAC CACTTCTTTGCCTTCCTGGATTTCCTGGTCCAGGTGAGAGTGATCCAGGACTGCTTCTGGAAG GAGCTCACAGACCTGGGCCTGCAGCTGGCCAACTTCTTTGCTTTTGTCAACAGCTGCCTGAAC CCACTGATTTATGTCTTTGCAGGCCGGCTCTTTAAGACCAGGGTTCTGGGAACTTTATAA (GenBank NM_007539; SEQ ID N0:110).
Клетки HEK mBKRl или MRC5 высевали в 384-луночные плашки с прозрачным дном в питательную среду и обеспечили им возможность прикрепиться за ночь. Затем питательную среду удаляли, клетки промывали в буфере для анализа (HBSS, 20 мМ HEPES, 2,5 мМ пробенецида), а затем добавляли 0,5 мкМ Fluo-4AM, проницаемый для клетки и чувствительный к кальцию краситель, 0,04% плюрониловую кислоту в течение 1 ч при 37°С. Происходит расщепление сложного эфира AM, и краситель кальция остается в цитоплазме. Спустя 1 час клетки промывали, чтобы удалить избыток красителя, и на клетках оставались 2 0 мкл остаточного буфера. Исследуемые вещества добавляли в виде 2х растворов в функциональную систему скрининга лекарственных веществ производства Hamamatsu (FDSS), и контролировали кинетические параметры мобилизации кальция в течение по меньшей мере 4 минут. Результатом активации рецептора B1R или B2R является опосредованная Galpha q активация фосфолипазы С и опосредованная IP3 мобилизация кальция. Краситель Fluo-4 хелатирует высвобождаемый кальций, и наблюдается устойчивое изменение флуоресценции. Результаты были экспортированы в виде максимальных-минимальных относительных единиц флуоресценции для нормализации различий в плотности клеток или концентрации красителя по всей плашке.
Активность лиганда определяли каждый день путем построения кривых ответа на концентрацию лиганда, и приблизительная ЕС7 08 0 концентрация лиганда была выбрана для инкубации с антителами. ЕС8 0 концентрация была выбрана потому, что она соответствует линейному диапазону кривой детекции, и было вполне достаточное окно, чтобы увидеть снижение с использованием антагонистов или снижающих уровень лигандов антител. Кривая зависимости "доза-эффект" позволила связывание
лиганда в концентрации ЕС8 0, и степень истощения лиганда контролировали по изменению флуоресценции. Результаты были нормированы на реакцию на буфер и лиганд ЕС8 0, и была посчитана ЕС50 для истощения лиганда. Затем результаты были представлены как молярное отношение, которое соответствует концентрации антител, которая снижает на 50% ответ лиганда (т.е., ЕС50 антитела), деленной на используемую концентрацию лиганда. Теоретический максимум должен составлять 0,5, так как одна единица антитела должна обладать способностью снижать уровень 2 единиц лиганда, но на практике авторы изобретения обнаружили более низкие значения, что может быть отражением отсутствия чувствительности способа детекции низких концентраций лиганда, а не стехиометрического ограничения для антитела. Результаты этих экспериментов приведены в таблицах 14-16.
Все антитела семейства 1 и семейства 2 (см. Таблицу 13) продемонстрировали превосходные кинетики связывания с помощью Biacore (Таблица 3) и нейтрализующую активность согласно измерениям мобилизации кальция в отношении пептидов DAKD и KD (Таблицы 14 и 15). Антитела были дополнительно проанализированы на их термическую стабильность и пригодность последовательности для гуманизации. Было отдано предпочтение F151 для гуманизации вследствие его термической стабильности, отсутствия проблемных аминокислотных остатков в областях CDR и перекрестной реактивности с лигандом мыши KLP и DAKLP.
UR2 9
0, 60
0, 12
IA2 0 0
IA3 0 0
UR11
6, 99
1, 61
19, 65
14, 95
11, 09
3, 13
LR4
IA10 0
IA4 0 0
IA4 0 0
LR6
IA10 0
IA10 0
LR12
IA10 0
IA10 0
LR16
IA10 0
IA10 0
Примечание: Антитела были предварительно инкубированы с заданной концентрацией лиганда, как правило, ЕС70-80 для активации мобилизации кальция у рецептора В1 брадикинина. Смесь антитело-лиганд была добавлена к клеткам НЕК mBKRl, предварительно инкубированных с красителем, чувствительным к кальцию (Fluo-4AM или Fluo-8AM) на приборе Hamamatsu FDSS6000, и контролировали мобилизацию кальция. Данные были экспортированы в виде максимальной-минимальной относительной флуоресценции биологического ответа, и была вычислена IC50 для истощения лиганда, используя сигмоидальную кривую аппроксимации в программе Graph Pad Prism V4.03. Данные были представлены в виде молярного отношения для истощения лиганда антителом с целью стандартизации различных концентраций лиганда, который был использован для различных экспериментов. Молярное отношение для истощения лиганда = [IC50 антитела]/[лиганд]
SD = стандартное отклонение; ND = Не определено; IA10 0 = Неактивен при 100 нМ; IA2 0 0 = Неактивен при 2 00 нМ; IA3 0 0 = Неактивен при 300 нМ; IA4 0 0 = Неактивен при 4 00 нМ
Характеристика истощения кининового лиганда с помощью мобилизации кальция в фетальных клетках
фибробластов легкого MRC5
истощение ВК
истощение KD
истощение KLP
Семейство
Антитело
ВК (среднее значение молярного отношения)
молярного отношения
KD (среднее значение молярного отношения)
молярного отношения
KLP (среднее значение молярного отношения)
молярного отношения
F151
IA10 0
0, 14
0, 05
0, 15
0, 02
В21
IA10 0
0,33
122
IA10 0
0,22
154
IA10 0
0,30
СбЗ
IA10 0
0,23
ЕЕ1
IA3 0 0
IA3 0 0
IA150
DD2 0
IA600
IA600
IA150
DD7
7, 11
3, 62
17,37
12, 11
4,27
JK3
IA3 0 0
IA3 0 0
МВКЗ
22, 11
14, 10
3,46
2, 64
9, 45
NR15
15,26
11,51
4,34
2, 55
11, 18
NR1
39, 31
42, 15
32, 58
UR2 9
1, 15
0,86
0,30
0, 08
0,41
UR11
5,41
0, 80
25,21
4, 54
1, 53
LR4
IA10 0
IAIOO
LR6
IAIOO
IAIOO
LR12
IAIOO
IAIOO
LR16
IAIOO
IAIOO
Примечание: Антитела были предварительно инкубированы с заданной концентрацией лиганда, как правило, ЕС70-80 для активации мобилизации кальция у рецептора В2 брадикинина. Смесь антитело-лиганд была добавлена к клеткам фибробластов фетального легкого MRC5 (АТСС CCL-171), предварительно инкубированных с красителем, чувствительным к кальцию (Fluo-4AM или Fluo-8AM) на приборе Hamamatsu FDSS6000, и контролировали мобилизацию кальция. Данные были экспортированы в виде максимальной-минимальной относительной флуоресценции биологического ответа, и была вычислена IC50 для истощения лиганда, используя сигмоидальную кривую аппроксимации в программе Graph Pad Prism V4.03. Данные были представлены в виде молярного отношения для истощения лиганда антителом с целью стандартизации различных концентраций лиганда, который был использован для различных экспериментов. Молярное отношение для истощения лиганда = [IC50 антитела]/[лиганд]
SD = стандартное отклонение; ND = Не определено; IA100 = Неактивен при 100 нМ; IA150 = Неактивен при 150 нМ; IA300 = Неактивен при 300 нМ; IA400 = Неактивен при 400 нМ; IA600 = Неактивен при 600 нМ
Пример 5: Конструирование F151: Гуманизация, стабилизация и мутация нежелательных мотивов последовательности 1 . ГУМАНИЗАЦИЯ
Используемый протокол гуманизации было описан в PCT/U808/74381 (US201100272 бб), который включен в настоящий документ в качестве ссылки в полном объеме. Последовательности вариабельной легкой (VL) и вариабельной тяжелой (VH) цепей F151 мыши были использованы для создания модели гомологии анти-DAKD/KD F151 LC и НС в молекулярной операционной среде (МОЕ; v. 2009.10; Химическая Компьютерная Группа). Были использованы следующие матрицы: каркасный участок легкой цепи - 1SBS (93% идентичность в областях каркасного участка) , каркасный участок тяжелой цепи - 2VXT (84% идентичность в областях каркасного участка), LI - 1LVE (93% идентичность), L2 - 1EEU (100% идентичность), L3 - 2R56 (93% идентичность), HI - 1NJ9 (95% идентичность), Н2 - 2VXU (76% идентичность) и НЗ - 1HIL (49% идентичность). Матрицы были доступны в банке белковых данных RCSB, размещенном в сети Интернет на сайте rcsb.org, управляемый Rutgers и Калифорнийским университетом в Сан-Диего (Berman, Н.М; Westbrook J.; Feng. Z.; Gilliland, G.; Bhat, T.N.; Weissig, H.; Shindyalov, I.N.; Bourne, P.E. The Protein Data Bank, Nucleic Acids Research, 2000, 28, 285-242.). Модель гомологии была впоследствии энергетически минимизирована с помощью стандартных методик, внедренных в МОЕ. Впоследствии было проведено моделирование молекулярной динамики (MD) минимизированной трехмерной модели гомологии F151 мыши с ограничениями по белковому каркасу при температуре 500 К в течение 1,1 наносекунд (не) в общепринятом неявно заданном растворителе. Десять различных конформаций были получены из первого MD, запускаемого каждые 100 пикосекунд (пс) в течение последней 1 не. Каждая из этих разнообразных конформаций была подвергнута моделированию MD, без ограничений по белковому каркасу и при температуре 300 К в течение 2,3 не. Для каждого из 10 запусков MD, последние 2 000 моментальных снимков, один в каждую пс, из динамики MD были затем использованы для вычисления, для каждой аминокислоты F151 мыши, ее
среднеквадратическое отклонение (rmsd) по сравнению с референсном медоидном положении. Сравнивая среднее значение rmsd всех аминокислот F151 мыши на 10 отдельных запусках MD определенной аминокислоты с общим средним значением rmsd всех аминокислот F151 мыши, решали является ли аминокислота достаточно гибкой, как было показано во время MD, чтобы рассматриваться в качестве вероятного кандидата для взаимодействия с Т-клеточными рецепторами и отвечающего за активацию иммунного ответа. 62 аминокислоты были идентифицированы как пластичные в антителе F151 мыши, за исключением CDR и его непосредственного ближайшего окружения на расстоянии 5 А.
Затем подвижность 28 наиболее гибких аминокислот F151 мыши в течение 2 0 не (10 х 2 не) сравнивали с подвижностью соответствующих гибких аминокислот 4 9 моделей гомологии зародышевой линии человека, для каждой из которых был запуск 10x2 не моделирований MD. Были построены 4 9 моделей зародышевой линии человека путем систематического комбинирования 7 наиболее распространенных легких цепей зародышевой линии человека (vkl, vk2, vk3, vk4, vlambdal, vlambda2, vlambda3) и 7 наиболее распространенных тяжелых цепей зародышевой линии человека (vhla, vhlb, vh2, vh3, vh4, vh5, vh6). Vkl-vhlb антитело зародышевой линии человека показало 0,8 0 схожесть четырехмерной структуры их пластичных аминокислот по сравнению с пластичными аминокислотами антитела F151 мыши; таким образом, антитело vkl-vhlb зародышевой линии было использовано для гуманизации антитела F151, делая упор на пластичных аминокислотах. Для попарной аминокислотной связи между аминокислотами vkl-vhlb F151 мыши, 2 последовательности были выровнены, основываясь на оптимальной трехмерной суперпозиции альфа-углеродов 2 соответствующих моделей гомологии (см. Фиг. 15 для выравнивания F151 LC и F151 НС с vkl и vhlb, соответственно).
2. СТАБИЛИЗАЦИЯ
Два подхода были использованы для повышения стабильности антитела.
a) ОСНОВАННЫЙ НА ЗНАНИЯХ МЕТОД
Было предложено мутировать аминокислоты легкой и тяжелой цепей с низкой частотой встречаемости при сопоставлении с их соответствующими каноническими последовательностями, за исключением CDR, с образованием наиболее часто встречаемых аминокислот (AAGth > 0,5 ккал/моль; Е. Monsellier, Н. Bedouelle. J. Mol. Biol. 362, 2006, p. 580-593) . Этот первый список консенсусных мутаций для легкой цепи (LC) и тяжелой цепи
(НС) был ограничен аминокислотами, обнаруженными в ближайшей зародышевой линии человека (vkl-vhlb). Предлагаемые изменения в непосредственной близости от CDR (зона "Верньер" размером 5 Ангстрем, J. Mol. Biol. 224, 1992, p. 487-499) были удалены из рассмотрения. В результате получили 5 стабилизирующих мутаций в LC (см. Таблицу 19) и 4 стабилизирующие мутации в НС (см. Таблицу 20) . Другие критерии были приняты во внимание, чтобы рассмотреть эти мутации для потенциальной стабилизации антитела F151 анти-DAKD/KD. Эти критерии были благоприятными изменениями гидрофобности на поверхности или основанной на молекулярной механике предсказанной стабилизации мутанта. Кроме того, успешные по литературным данным дополнительные стабилизирующие мутации (Е. Monsellier & Н. Bedouelle. J. Mol. Biol., 362, 2006, p. 580-593; B.J. Steipe et al. J. Mol. Biol, 1994, 240, 188-192) были рассмотрены (см. Таблицы 16-22). Одно из этих изменений было включено ниже в качестве стабилизирующей мутации
(D89E) в последовательности НС2а, НС2Ь и НС2с. Другое предлагаемое изменение (Q62E) была включено в вариант НС2Ь.
b) Подходы, основанные на 3D и MD
Подходы, основанные на 3D и MD, ранее были опубликованы (Seco J, Luque FJ, Barril X., J Med Chem. 2009 Apr 23;52 (8) :2363-71; Malin Jonsson et al. , J. Phys. Chem. В 2003, 107, 5511-5518). Гидрофобные участки антитела были четко идентифицированы путем анализа моделирования молекулярной динамики Fab в двухкомпонентном растворителе (2 0% изопропанол в воде, моделирование 2 0 не производства). Мутации лизина были затем введены в непосредственной близости от этих участков в качестве попытки предотвращения агрегации. Был проведен
дополнительный анализ с использованием гидрофобной поверхностной карты в рамках программного обеспечения SchrodingerЛs maestro (v. 8.5.2 07). Используя комбинацию этих двух способов, были предложены мутации 2 Lys, 1 в тяжелой цепи и 1 в легкой цепи.
3. ГУМАНИЗАЦИЯ ПУТЕМ ПЕРЕСАДКИ
Ранее сообщалось о гуманизации с использованием методики пересадки (Peter Т. Jones, Paul Н. Dear, Jefferson Foote, Michael S. Neuberger & Greg Winter Nature, 1986, 321, 522-525). Используемый процесс гуманизации начали с идентификации зародышевых линий человека, ближайших к легким и тяжелым цепям анти-DAKD/KD. Это осуществляется путем выполнения BLAST-поиска в сравнении со всеми зародышевыми линиями человека, которые были системно пронумерованы (все возможные комбинации доменов V & J для цепей каппа и лямбда; домены V, D и J для тяжелых цепей).
Следующие ближайшие зародышевые линии человека были идентифицированы с 83% и 62% идентичностью последовательностям легких цепей (LC) и тяжелых цепей (НС) анти-DAKD/KD F151, соответственно (см. Фиг. 16). Использование внутренней зародышевой линии VBASE обнаружило сходство легкой цепи с локусом V IV-B3 (-83% идентичность) и сходство тяжелой цепи с локусом 1-08 и 1-18 (~62% идентичность) подсемейства VH1. Области CDR (определенные с помощью МОЕ) и участки Верньера (как определено в Foote & Winter, J. Mol. Biol., 1992, 224, 487-499) выделены жирным шрифтом. Гуманизирующие мутации, подчеркнутые линией, были получены путем выполнения попарного сравнения 2 выравниваемых последовательностей, за исключением аминокислотных остатков CDR и зоны Верньер, как определено выше. В другом варианте гуманизации только CDR были исключены из сравнения.
4. МУТИРОВАНИЕ НЕЖЕЛАТЕЛБНЫХ МОТИВОВ ПОСЛЕДОВАТЕЛБНОСТЕЙ Были рассмотрены следующие мотивы последовательностей:
Asp-Pro (кислото-неустойчивая связь), Asn-X-Ser/Thr
(гликозилирование, X = любая аминокислота, но Pro), Asp-Gly/Ser/Thr (образование сукцинимида/изо-asp в гибких
областях), Asn-Gly/His/Ser/Ala/Cys (открытые сайты
дезамидирования), и Met (окисление в открытых участках). Среди других критериев, домены VL и VH F151 мыши были отобраны из других антител мыши, так как F151 мыши не имело открытых нежелательных мотивов последовательностей, но их вводят в некоторые гуманизированные варианты.
Каждый из LC3a, LC3b, НСЗа и НСЗЬ имеет потенциально
проблематичные сукцинимидные сайты, которые были
идентифицированы. Эти сайты не были модифицированы в предлагаемых последовательностях, так как вовлеченные остатки потенциально вовлечены в Н-связанной сети (визуальный анализ модели гомологии). Эти положения также обнаруживают в ряде других структур антител. Кроме того, в обоих НСЗа и НСЗЬ, строгая гуманизация путем пересадки будет включать замену Serll5 на Met. Этот метионин экспонирован. Замена на лейцин в этом положении предлагается в качестве гуманизирующей мутации, так как она является общим аминокислотным остатком среди многих близких последовательностей зародышевой линии человека.
Полученные в результате гуманизированные
последовательности были сопоставлены на предмет сходства с последовательностями базы данных International Epitope Database (IEDB) (находится в сети Интернет на сайте immuneepitope.com; версия Июнь 2009 года; Vita F, Zarebski L, Greenbaum JA, Emami H, Hoof I, Salimi N, Damle R, Sette A, Peters B. The immune epitope database 2.0. Nucleic Acids Res. 2010 Jan;38(Database issue):D854-62. Epub 2009 Nov 11), чтобы гарантировать, что ни одна из последовательностей не содержит никаких известных эпитопов В- или Т-клеток человека (70% идентичность последовательности, используемая в качестве уровня отсечки для результатов, полученных путем BLAST-поиска, и рассматривающая только результаты от человека).
5. ИСХОДНЫЕ ПОСЛЕДОВАТЕЛБНОСТИ ВАРИАБЕЛБНЫХ ДОМЕНОВ F151
МЫШИ
CDR выделены жирным шрифтом, и области Верньера (как определено в Foote & Winter, J. Mol. Biol., 1992, 224, 487-499) подчеркнуты.
Легкая цепь (SEQ ID N0:26)
DI_VMSQSPSS WYQQKPGQSP ISSVKAEDLA
LAVSVGEKVTMSCKSSQSLLYSSNQKNYLA
KPLIYWASTRESGVPDRFTGSGSGTDFTLT IYYCQQYYSYPWTFGGGTKLEIK
Индекс
соответствия
зародышевой
линии
83%
Z4 6 615_1_V_X67 8 58_1_J [V IV-B3] Тяжелая цепь (SEQ ID N0:19) EIQLQQSGPELVKPGTSVKVSCKASGYSFTDYNIYWVKQS HGKS LEWIGY FDPYNGNTGYNQKFRGKATLTVDKS S S TAF MHL S S L T S DDSAVYYCANYYRYDDHAMDYWGQGT SVTVS S
Индекс соответствия зародышевой линии = 62% с Z12 316_1_VX97 051_4_D_X97 051_5_J [VH1 1-18]
6. СКОНСТРУИРОВАННЫЕ ПОСЛЕДОВАТЕЛЬНОСТИ а) Предпосылки
Были предложены 5 версий для легкой цепи (LCI, LC2a, LC2b, LC3a, и LC3b) и 5 версий тяжелой цепи (НС1, НС2а, НС2Ь, НСЗа, и НСЗЬ).
LC1 содержит 5 гуманизирующих мутаций, идентифицированных с помощью протокола четырехмерной гуманизации. LC2a привнес дополнительные 5 стабилизирующие мутации. LC2b добавил 1 мутацию лизина для предотвращения агрегации. LC3a содержит 15 мутаций, полученных из трансплантата вплоть до ближайшей последовательности зародышевой линии человека и сохраняющих аминокислотные остатки мыши CDR и области Верньера. LC3b содержал 16 мутаций, полученных из CDR-трансплантата с одной дополнительной гуманизирующей мутацией.
НС1 имеет б гуманизирующих мутаций, идентифицированных протоколами внутреннего пользования. НС2а привнесла 5 дополнительных стабилизирующих мутаций, в то время как НС2Ь содержит б дополнительных стабилизирующих мутаций по сравнению с НС1. НС2с содержит 1 мутацию Lys помимо стабилизирующих мутаций НС2а, чтобы помочь предотвратить агрегацию. НСЗа содержит 19 мутаций, полученных из трансплантата вплоть до ближайшей последовательности зародышевой линии человека и сохраняющих мышиные аминокислотные остатки CDR и области Верньера. НСЗЬ содержит 25 мутаций, полученных из CDR
трансплантата.
Были предложены в общей сложности б комбинаций (приведены в Таблице 16) :
- LC1 х НС1 (мутации, направленные только на гуманизацию) LC2a х НС2а (мутации, направленные на гуманизацию и стабилизацию)
LC2a х HC2b (мутации, направленные на гуманизацию и стабилизацию)
LC2b х НС2с (мутации, направленные на гуманизацию, стабилизацию и "анти-агрегацию")
LC3a х НСЗа (мутации, направленные в основном на гуманизацию трансплантатом + областью Верньера)
LC3b х НСЗЬ (мутации, направленные на гуманизацию трансплантатом)
Ser22
Ser22
Asn
Asn
Gln48
Gln42
Lys
Lys
Lys
Ser49
Ser43
Pro
Pro
Pro52
Pro46
Leu
Thr69
Thr63
Ser
Ser
Ser
Ser
Val84
Val78
Leu
Leu
Lys85
Lys79
Gin
Gin
Gin
Gin
Gin
Leu89
Leu83
Lys
Val
Val
Ile91
Ile85
Thr
Thr
Val
Val
Glyl06
GlylOO
Gin
Gin
Leu110
Leu104
Val
Val
Мутации
Lys38
Lys38
Arg
Arg
Ser40
Ser40
Ala
Ala
His41
His41
Pro
Pro
Pro
Pro
Pro
Pro
Lys43
Lys43
Gin
Gin
Ser44
Ser44
Gly
Gly
Gly
Gly
Gly
Ile48
Ile48
Met
Gln62
Gln61
Glu
Lys67
Lys66
Arg
Arg
Ala68
Ala67
Val
Leu70
Leu69
Met
Val72
Val71
Thr
Lys74
Lys73
Thr
Ser76
Ser75
Thr
Thr
Phe80
Phe79
Tyr
Tyr
Tyr
Tyr
Tyr
His82
His81
Glu
Glu
Ser84
Ser82A
Arg
Arg
Leu 86
Leu82C
Lys
Thr87
Thr83
Arg
Arg
Asp89
Asp85
Glu
Glu
Glu
Glu
Asp90
Asp86
Glu
Glu
Glu
Ser91
Ser87
Thr
Thr
Serll5
Serl08
Leu
Leu
Мутации:
а) Сконструированные последовательности легкой цепи: Никаких потенциально проблематичных известных эпитопов Т-
клеток или В-клеток не было обнаружено во всех предложенных
вариантах.
LCI (SEQ ID N0:27), гуманизирующие мутации подчеркнуты, CDR и области Верньера выделены жирным шрифтом:
DIVMSQSPSSLAASVGDRVTMSCKSSQSLLYSSNQKNYLA WYQQKPGKSP KPLIYWASTRESGVPDRFTGSGSGTDFTLT ISSVQAEDLAIYYCQQYYSYPWTFGGGTKLEIК
LC2a (SEQ ID N0:28), гуманизирующие мутации подчеркнуты, CDR и области Верньера выделены жирным шрифтом, мутации стабилизации выделены курсивом (Т в положении 5, S в положении 12, I в положении 21, S в положении 69, Т в положении 91, показанные ниже):
DIVMTQSPS SLSASVGDRVTJSCKSSQSLLYSSNQKNYLA
WYQQKPGKSPKPLIYWASTRESGVPDRFSGSGSGTDFTLT
IS SVQAEDLA TYYCQQYYSYPWTFGGGTKLEIK
LC2b (SEQ ID N0:29), гуманизирующие мутации подчеркнуты, CDR и области Верньера выделены жирным шрифтом, мутации стабилизации выделены курсивом (Т в положении 5, S в положении 12, I в положении 21, S в положении 69, Т в положении 91, показанные ниже) и мутация анти-агрегации представляет собой К в положении 89:
DIVMTQSPSSLSASVGDRVTJSCKSSQSLLYSSNQKNYLA
WYQQKPGKSPKPLIYWASTRESGVPDRFSGSGSGTDFTLT
IS SVQAEDKA TYYCQQYYSYPWTFGGGTKLEIK
LC3a (SEQ ID N0:30), трансплантированные мутации показаны подчеркнутой линией и CDR и области Верньера выделены жирным шрифтом:
DIVMTQSPDSLAVSLGERATINCKSSQSLLYSSNQKNYLA WYQQKPGQPPKPLIYWASTRESGVPDRFSGSGSGTDFTLT IS SLQAEDVAVYYCQQYYSYPWTFGQGTKVEIK
LC3b (SEQ ID N0:31), трансплантированные мутации показаны подчеркнутой линией и CDR и области Верньера выделены жирным шрифтом:
DIVMTQSPDSLAVSLGERATINCKSSQSLLYSSNQKNYLA
WYQQKPGQPPKLLIYWASTRESGVPDRFSGSGSGTDFTLT IS SLQAEDVAVYYCQQYYSYPWTFGQGTKVEIK
Следует отметить, что L в положении 52 представляет собой аминокислотный остаток области Верньера, который мутирован в человеческий.
с) Сконструированные последовательности тяжелой цепи
НС1 (SEQ ID N0:20), гуманизирующие мутации подчеркнуты,
CDR и области Верньера выделены жирным шрифтом:
EIQLVQSGPEVKKPGASVKVSCKASGYSFTDYNIYWVKQS
PGKS LEWIGYFDPYNGNTGYNQKFRGKATLTVDKSS S TAF
MHL S S L T SEDSAVYYCANYYRYDDHAMDYWGQGT SVTVS S
HC2a (SEQ ID N0:21), гуманизирующие мутации подчеркнуты,
CDR и области Верньера выделены жирным шрифтом, мутации
стабилизации выделены курсивом (Q в положении 1, А в положении
9, G в положении 44, Y в положении 80 и Е в положении 90,
представленные ниже):
QIQLVQSGAEVKKPGASVKVSCKASGYSFTDYNIYWVKQS Р GK GLЕWIGYFDPYNGNTGYNQKFRGKATLTVDKSS S TAY MHL S S L T SEESAVYYCANYYRYDDHAMDYWGQGT SVTVS S
HC2b (SEQ ID N0:22), гуманизирующие мутации подчеркнуты, CDR и области Верньера выделены жирным шрифтом, мутации стабилизации выделены курсивом (Q в положении 1, А в положении 9, G в положении 44, Е в положении 62, Y в положении 80 и Е в положении 90, представленные ниже): QIQLVQSGAEVKKPGASVKVSCKASGYSFTDYNIYWVKQS Р GK GLEWIGYFDPYNGNTGYNQKFRGKATLTVDKSS S TAY MHL S S L T SEESAVYYCANYYRYDDHAMDYWGQGT SVTVS S
Никаких эпитопов человека не было идентифицировано для последовательности НС2Ь в базе данных IEDB.
НС2с (SEQ ID N0:23), гуманизирующие мутации подчеркнуты, CDR и области Верньера выделены жирным шрифтом, мутации стабилизации выделены курсивом (Q в положении 1, А в положении 9, G в положении 44, Y в положении 80 и Е в положении 90, представленные ниже) и мутации анти-агрегации представляет собой К в положении 86:
QIQLVQSGAEVKKPGASVKVSCKASGYSFTDYNIYWVKQS
P GK GLEWIGYFDPYNGNTGYNQKFRGKATLTVDKSS S TAY MHLSSKTSEESAVYYCANYYRYDDHAMDYWGQGTSVTVSS
НСЗа (SEQ ID N0:24), трансплантированные мутации, подчеркнутые линией, и CDR и области Верньера выделены жирным шрифтом:
QIQLVQSGAEVKKPGASVKVSCKASGYSFTDYNIYWVRQA PGQGLEWIGYFDPYNGNTGYNQKFRGRATLTVDKST S TAY MELRS LRS DDTAVYYCANYYRYDDHAMDYWGQGTLVTVS S
LC3b (SEQ ID N0:25), трансплантированные мутации, подчеркнутые линией, и CDR и области Верньера выделены жирным шрифтом:
QVQLVQSGAEVKKPGASVKVSCKASGYSFTDYNIYWVRQA Р G Q G L EWMGY FD PYNGN TGYNQKFRGRVTM T T D T S T S TAY MELRS LRS DDTAVYYCANYYRYDDHAMDYW GQGTLVTVS S
Важно отметить, что следующие аминокислотные остатки области Верньера мутированы в человеческие: V в положении 2, М в положении 48, V в положении 68, М в положении 70 и Т в положении 7 4.
Никаких эпитопов человека не было идентифицировано для последовательности НСЗЬ в базе данных IEDB.
НСЗЬ индекс соответствия зародышевой линии = 83% с Z12316_1_V_J00235_1_D_U42590_1_J[1-18/DP-14].
Ile-91
Thr
1,27255
На основании компьютерного моделирования, представленного в Таблице 16, ДНК вариабельного домена легкой цепи (VL) и тяжелой цепи (VH) гуманизированного F151 была оптимизирована по кодонам для экспрессии в НЕК2 93, и гены синтезировали в GeneArt (дочерняя компания Life Technologies). Синтезированные фрагменты ДНК были клонированы в кодирующий константную область легкой цепи (CL) вектор, pFF0362 (А. Человеческий вектор Карра LC) по сайтам ApaLI/BsiWI и в кодирующие константные области тяжелой цепи (CHI, СН2 и СНЗ) вектора, pFF0363 (В. вектор IgGl человека НС) по сайтам ApaLI/Apal, соответственно. Полученные в результате плазмиды pFF04 60, содержащие полноразмерную последовательность LC, и pFF04 66, содержащие полноразмерную последовательность НС гуманизированных вариантов F151, были совместно трансфицированы и временно экспрессированы в системе Freestyle(tm) 293 Expression System (Invitrogen/Lifе Technologies, каталожный номер К9000-01).
Шесть гуманизированных вариантов, представленных в Таблице 16, характеризовались различными параметрами, такими как кинетика связывания (рассмотрено выше), а также химические и физические свойства, такие как термостабильность, которые обычно используются в данной области.
Характеристика была проведена в две ступени. Ступень 1 включала дифференциальную сканирующую калориметри. (DSC), представленную в Таблице 2 4 и на фигуре 2. Кратко, для экспериментов DCS, антитела диализовали против фосфатно-солевого буферного раствора. Концентрации антител были измерены
с помощью поглощения в УФ. Антитела были разведены до 1 мг/мл с помощью PBS. Сканирования были выполнены с использованием прибора Calorimetry Sciences Corporation N-DSC II, используя капиллярную кювету объемом 0,3268 мл с PBS в контрольной кювете. Скорость сканирования составила 2°С/мин, и образцы были просканированы от 20°С до 100°С.
Все варианты, кроме HC3b/LC3b, продемонстрировали сопоставимые с исходным антителом аффинности связывания. Вариант HC3a/LC3a был выбран среди других вариантов на основании других физико-химических свойств, таких как данные SEC, стабильность и отсутствие агрегации (см. Таблицы 23-25) .
HC3a/LC3a
HC3b/LC3b
Ка(1/Мс)
Kd(l/c)
KD (М)
Ка(1/Мс)
Kd(l/c)
KD (М)
DAKD-b
5,ОбЕ+05
1,28Е-05
2,53Е-11
3,85Е+05
5,15Е-
1,35Е-10
KD-b
4,27Е+05
2,95Е-
6,78Е-12
2,51Е+05
3,02Е-06
1,44Е-11
DAKLP-b
4,65Е+05
1,42Е-
3,05Е-11
7,04Е+04
2,76Е-
4,05Е-
KLP-b
5,02Е+05
5,43Е-
1,0 6Е-
5,39Е+05
2,72Е-
5, 26Е-10
Для сравнения: Ka(l/Mc) антитела mF151 составило 7,84Е+05 для DAKD-b, 8,30Е+05 для KD-b, 1,81Е+0б для DAKLP-b, и 1,12Е+0б для KLP-b
НСЗЬ/ LC3b
Термостабильность = инкубация при 4°С (контроль) и 45°С в течение 3 дней; невосстановленных условиях; Стабильность = 2 цикла замораживания/оттаивания; LC-MS восстановлен/дегликозилирование
Аббревиатура: Ад=агрегация, Бед=деградация, X = данные не представлены
ID-гель был в восстановлен и
Белок
ЕIQLQQSGPELVKPGTSVKVSCKASGYSFTDYNIYWVKQSHGKSL EWIGYFDPYNGNTGYNOKFRGKATLTVDKSSSTAFMHLSSLTSDD SAVYYCANYYRYDDHAMDYWGQGT SVTVS S
DIVMSQSPSSLAVSVGEKVTMSCKSSQSLLYSSNQKNYLAWYQ QKPGOSPKPLIYWASTRESGVPDRFTGSGSGTDFTLTISSVKA EDLAIYYCQQYYSYPWTFGGGTKLEIK
(SEQ ID N0:19)
(SEQ ID N0:26)
Гуманизированное F151 (HC3a/LC3a)
Ген
CAGATTCAGCTGGTGCAGTCTGGCGCCGAAGTGAAGAAACCTGGC GCCAGCGTGAAGGTGTCCTGCAAGGCCAGCGGCTACAGCTTCACC GACTACAACATCTACTGGGTCCGACAGGCTCCAGGCCAGGGACTG GAATGGATCGGCTACTTCGACCCCTACAACGGCAACACCGGCTAC AAC СAGAAG TTCCGGGG СAGAG С СAC С С T GAC С G T G GACAAGAG С AC СAG СAC С G С С ТАСAT G GAAC T G С G GAG С С T GAGAAG С GAC GAC ACCGCCGTGTACTACTGCGC СAAC TAC TACAGATAC GAC GAC СAC GCCATGGACTACTGGGGCCAGGGCACCCTGGTCACCGTGTCCTCT (SEQ ID N0:129)
GACATCGTGATGACCCAGAGCCCCGACAGCCTGGCCGTGTCTC T G G G С GAG CGGGCCACCAT СAAC T G СAAGAG СAG С СAGAG С С T GCTGTACTCTAGCAACCAGAAGAACTACCTGGCCTGGTATCAG CAGAAGCCCGGCCAGCCCCCCAAGCCCCTGATCTACTGGGCCA GCACCCGCGAGAGCGGCGTGCCCGATAGATTTTCCGGCAGCGG CTCCGGCACCGACTTCACCCTGACCATCAGCAGCCTGCAGGCC GAG GAC GTGGCCGTG TAC TAC T G С СAG СAG ТАС ТАСAG С ТАС С CCTGGACCTTCGGCCAGGGCACCAAGGTGGAAATCAAG (SEQ ID NO:130)
Белок
QIQLVQSGAEVKKPGASVKVSCKASGYSFTDYNIYWVRQAPGQGL
DIVMTQSPDSLAVSLGERATINCKSSQSLLYSSNQKNYLAWYQ
EWIGYFDPYNGNTGYNQKFRGRATLTVDKSTSTAYMELRSLRSDD TAVYYCANYYRYDDHAMDYWGQGTLVTVSS
QKPGQPPKPLIYWASTRESGVPDRFSGSGSGTDFTLTISSLQA EDVAVYYCQQYYSYPWTFGQGTKVEIK
(SEQ ID N0:24)
(SEQ ID N0:30)
Одиночное подчеркивание = область CDR; двойное подчеркивание = ключевые аминокислоты для идентификации CDR
Для сопоставления легкой и тяжелой цепей исходного F151 с гуманизированным вариантом F151 (HC3a/LC3a) см. Фиг. 3.
Пример 7. Кристаллическая структура гуманизированного антитела F151 против лиганда BRK1 каллидина и des-arglO-каллидина
Кристаллические структуры Fab гуманизированного F151 (HC3a/LC3a), связывающиеся с каллидином или des-ArglO-каллидином, были определены, и проанализированы молекулярные взаимодействия.
Каллидин в виде порошка был приобретен у Phoenix Pharmaceuticals (Каталожный номер 009-37). Для получения белка Fab, ДНК области VH тяжелой цепи (НС) от гуманизированного НСЗа F151 была клонирована в 6xHis меченый СН1 вектор pFF0366. Плазмида легкой цепи (LC), используемая в настоящем документе, была такой же, как таковая исходной LC3a F151, используемой в гуманизации F151 (см. Пример 5) . Клетки НЕК293 были совместно трансфицированы двумя плазмидами для экспрессии Fab. Белок Fab был очищен с помощью кобальтовой смолы, буфер заменен на 50 мМ MES рН 6,0, 50 мМ NaCl до концентрирования приблизительно до 9 мг/мл. Очищенный белок Fab F151 смешивали с каллидином в молярном соотношении 1:2 и подготавливали для скринингового анализа кристаллизации. Скрининговый анализ кристаллизации был выполнен в широком диапазоне условий. Лучший кристалл наблюдали в условиях В10, В12 и G10 из набора Hampton Research screening kit PEG/ION HT. Кристаллы были защищены от действия низких температур 2 0% глицерином в качественном буфере и заморожены для сбора данных дифрактометрии. Данные рентгеноструктурного анализа для обоих комплексов были собраны на Canadian Light Source, пучок излучения CMCF-08ID. Rmerge для комплекса F151-KD составляет 8,9% и I/s(I) = 20,2, в то время как эти же параметры для F151-DAKD составляют 7,7% и 18,5, соответственно. Структура F151-KD была определена молекулярной заменой в Phaser, используя координаты Fab из PDB входа 3QOS, обрабатывая домены VL-VH и CL-CH1 как независимые единицы. Структура была уточнена в autoBuster при разрешении 2,07 А в пространственной группе P2i2i2i с Rfactor величиной 0,205 и Rfree величиной
0,228. Структура F151-DAKD была определена с использованием координат F151-KD. Структура была уточнена в autoBuster при разрешении 1,86 А, в пространственной группе Р212121 с Rfactor величиной 0,232 и Rfree величиной 0,238.
Выбранный список кининовых пептидов
Карты электронной плотности, представленные на фиг. 4 и 5, отображают связывание каллидина (KD) и des-Argl0-каллидина (DAKD) с Fab F151 и однозначно определяют положение каждой аминокислоты. В случае каллидина электронной плотности для последнего С-концевого остатка ArglO нет. Это согласуется с наблюдением о том, что DAKD, у которого отсутствует С-концевой остаток аргинина (показано в Таблице 27 ниже), связывается одинаково хорошо с F151, как KD. Значения IC50 для F151 в клеточном анализе нейтрализации FDSS в отношении KD и DAKD составляют 0,12 нМ и 0,09 нМ, соответственно. В обоих случаях электронная плотность слабее по направлению к С-концам пептидов. Поскольку Phe9 в KD имеет несколько лучшую электронную плотность, чем в DAKD, вполне возможно, что присутствие дополнительного аргинина на С-конце KD стабилизирует С-конец этого пептида при связывании с F151, хотя этот аргинин сам по себе не достаточно стабилен, чтобы его можно было наблюдать с помощью рентгеновских лучей. Поскольку две структуры практически идентичны (rms между KD и DAKD составляет 0,139 для атомов углерода и 0,328 для всех атомов), все последующие обсуждения основаны на структуре F151-KD.
KD связан с его N-концом, погруженным в область стыка Fv субъединиц легкой и тяжелой цепей, как показано на Фигуре 6. Область стыка легкой и тяжелой цепей заполнена ароматическими аминокислотами, включая Tyr-L42, Tyr-L93, Tyr-L100, Trp_L102, Phe-L104 и Tyr-H35, Trp-H47, Tyr-H50, Tyr-H99, Trp-HHO, стабилизирующие друг друга посредством стекинг-взаимодействий и гидрофобных взаимодействий. Аминокислотные остатки каждой из CDR легких и тяжелых цепей вносят вклад в связывание. Аминокислотные остатки вдоль легкой и тяжелой цепей, которые участвуют во взаимодействии с KD, как отображается на CDR, показаны на фиг. 7 и 8. НЗ CDR тяжелой цепи представляет собой самую длинную петлю и одну из наиболее часто используемых во взаимодействии с KD, образуя боковую поверхность для KD. Петля стабилизировалась в основном за счет взаимодействий с двумя другими CDR, HI и Н2 тяжелой цепи, а именно, солевого мостика между Asp-H101 и Arg-H52 (стабилизируя HI и НЗ), взаимодействия арен-Н между Туг-Н102 и Туг-Н54 (стабилизируя Н2 и НЗ), Н-связи между Asp-H108 и Туг-Н35 и Н-связи между His-H105 и Tyr-L55 (стабилизируя НЗ и L2).
Сравнивая взаимодействующие аминокислотные остатки KD среди получаемых антител, можно видеть, что существует сходство между антителами, и некоторых из них объединяло использование определенных аминокислот для KD-взаимодействия, чем других. Например, в легкой цепи F151, СбЗ и 122 используются более схожие аминокислоты в их CDR для связывания KD, в то время как В21 и 154 были более похожими. По тяжелой цепи F151 и С83 были удивительно не похожими друг на друга и на В21, 122 и 154. Последние три, по-видимому, образуют группу по подобию. СбЗ особенно интересно своей тяжелой цепью, а именно тем, что длина петли в Н2 и НЗ более отличается от всех остальных. Рассматривая Fab в целом, В21 и 154 были наиболее тесно связаны.
В кристаллической структуре, авторы изобретения обнаружили, что KD участвует в рационально организованной водородной связи и гидрофобных взаимодействиях с Fab. N-конец KD погружен в Fab и в нем сосредоточены более интенсивные
взаимодействия, в то время как С-конец, главным образом, является гидрофильным. За исключением первых 4 остатков (Lys-Arg-Pro-Pro), другие остатки KD постепенно распространяются в основной массе растворителя. Амидиновая группа боковой цепи Lysl заякорена Glu-L61 (L: легкая цепь) посредством солевых мостиков, в то время как аминоконцевая аминогруппа Lysl образует солевой мостик с Asp-H108 (Н: тяжелая цепь). Амидиновая группа боковой цепи Lysl также нависает над ароматическим кольцом Tyr-L55, участвующего в катионных взаимодействиях. Такие интенсивные взаимодействия с вовлечением Lysl плотно заякоривают аминоконец KD в Fab. Это также объясняет важность Lysl в связывании KD с F151. Без него (т.е., брадикинин) никакого детектируемого связывания с hF151 или F151 невозможно измерить. Подобно Lysl, Arg2 взаимодействует с Fab посредством солевого мостика. Гуанидиновая группа Arg2 взаимодействует с боковой цепью Asp-H104. Боковая цепь Arg2 также связана водородными связями с карбонильным кислородом основной цепи Arg-H101. Кроме того, кислород основной цепи Рго8 связан водородными связями с боковой цепью Arg-H101. Туг-Н102 наполовину интеркалирован в Phe8 и Рго9, участвуя в гидрофобных взаимодействиях с KD. Помимо прямого взаимодействия, также наблюдают обеспечиваемые водой многочисленные водородные связи между KD и Fab. Интересно также отметить, что остатки тирозина наиболее часто используются при взаимодействии по сравнению с другими аминокислотами; 9 из 16 остатков, отмеченных звездочками на фмг. 7 и 8, являются тирозинами. Все остатки в F151, окружающие KD, по-видимому, играют роль в связывании лиганда, за исключением Asn-НЗЗ, который близко расположен к Рпеб боковой цепи, но несовместим по полярности и у него отсутствуют другие важные взаимодействия. Замена на ароматические/гидрофобные остатки, такие как Тгр или Туг, к взаимодействию с Phe8, по-видимому, является быстрым выбором, если рассматривается созревание аффинности. Эти две ароматические аминокислоты в действительности обнаруживают в других антителах (Тгр в СбЗ, и Туг в В21, 122, 154) . Таблица 28, представленная ниже, предоставляет подробный анализ 16
взаимодействующих с KD аминокислотных остатков, отмеченных на Фигуре 7 и 8, ив ней изложены функциональные замены, которые могут быть сделаны в областях CDR, которые не должны нарушать связывание антигена.
Список аминокислотных остатков, обнаруженных вокруг связывающего KD кармана, и их роль в связывании KD и потенциальные функциональные замены (аминокислотных остатков легкой цепи в ячейках серых тонов
Тгр, His и Phe
Glu-L.61
-Формирование ключевых солевых мостиков с боковой цепью Lysl
-Asp, Gin, ASN (Asp уже есть в B21 и 154, Фиг. 7)
Tyr-L97
-Н-связь с N амида Trp-L56
-Формирование кармана для протяженной боковой цепи Argl
-Ароматическая а.к., такая как Phe или His (слишком ограниченное пространство для Тгр)
Tyr-L98
-Наряду с Tyr-L31 и Tyr-L38 образует три ортогональные плоскости, окружающие поворот на 90град KD в Рго4
Другие ароматические а.к., такие как Phe, Тгр или His
Tyr-L100
-Формирование поверхности кармана для РгоЗ -Часть контактирующих поверхностей кластеров ароматических а.к. между цепями L/H, дополнительно включая Tyr-L42, Tyr-L93, Тгр L102, Phe-L104 и Туг-Н35, Тгр-Н47, Туг-Н50, Туг-Н99, Тгр-ННО
-Частичное стекинг-взаимодействие с Туг-Н50
-Ароматические а.к., такие как Phe (лучшие гидрофобные взаимодействия с РгоЗ)
-Другими рассматриваемыми вариантами являются Thr (в В21 и 154) и His (в 122)
Trp-L102
-Часть контактирующих поверхностей кластеров ароматических а.к. между цепями L/H -Стекинг-взаимодействие с Тгр-Н47
-Другие ароматические а.к., такие как Туг (в СбЗ и В21), Phe и His -Другой гидрофобный остаток, такой как L (в 122)
Asn-H33
- Рядом с боковой цепью Рпеб, но несовместим по полярности, никаких других ролей не
-Замена ароматической/гидрофобной а.к., такой как Тгр (встречается в
рассматривается; может быть мишенью для созревания аффинности
СбЗ) или Туг (встречается в В21, 122, 154)
Asp-H52
-Солевой мостик с Arg-HlOl, стабилизирующий петли HI и НЗ
-Мутируют в виде пары с Arg-HlOl с образованием обратно заряженной а. к., такой как Arg-H52/Asp-H101, или пары гидрофобных а.к. (Leu, Не, Val, Met, Phe, Туг, Тгр, Ala) с образованием кластера с Phe6 KD.
Tyr-H54
-Рядом с Рго8, но нет специфических взаимодействий
-Рядом с Arg-HlOl, но нет взаимодействий зарядов
-Мутируют с образованием отрицательно заряженной а.к. для стабилизации Arg-Н101, такой как D или Е (встречается в В21, 122 и 154) или N или Q, также для обеспечения Н-связи с карбонильным 0 Pro8 (A Lys в СбЗ, который может быть обратно заряжен с образованием Glu)
Tyr-H99
-Часть ароматического межповерхностного взаимодействия между цепями Н и L -Н-связь с Asn-НЗЗ -Ограниченное пространство
-Мутируют до образования малых ароматических а.к., за исключением W, таких как Phe и His
Arg-HlOl
-Н-связь с амидом Рго8
-поддерживается Asp-H52 (солевой мостик)
-Мутируют в виде пары с Asp-H52 с образованием обратно заряженной а. к.,
такой как Arg-H52/Asp-H101, или пары гидрофобных а.к. для образования кластера с Рпеб KD
Tyr-H102
-Наполовину интеркаляция в Phe9 и Pro8, гидрофобные взаимодействия с KD
-Phe может быть предпочтительнее, Тгр или His могут также подойти
Asp-H104
-Ключевой остаток в образовании солевого мостика с Arg2
-Glu для поддержания солевого мостика с Arg2
Большего размера а.к. для заполнения бреши от РгоЗ, такие как Туг, как показано в В21, 122 и 154
Asp-H108
-Ключевой остаток в образовании солевого мостика с N-концевым -NH3+ KD
-Н-связь с Tyr-НЗЗ, стабилизирующая петлю НЗ -Консервативный остаток! Нет в CDR
-Glu
Анализ конформационного эпитопа каллидина (KD) или des-Агдю-каллидина (DAKD) выявил, что он принимает "Рго 4 кинк"-конформацию. Как показано на Фигуре 17, отличительной чертой "Рго 4 кинк"-конформации является крутой поворот типа II в полипептидном каркасе основной цепи KD или DAKD в Пролине 4 (см. статью Richardson JS. "The anatomy and taxonomy of protein structure." Adv Protein Chem. 1981;34:167-339, включенную в настоящий документ в качестве ссылки). "Рго 4 кинк"-конформация может быть дополнительно определена всеми или значительной частью всех оставшихся аминокислот KD (1-2 и 6-9) или DAKD, принимая вид повторов сигмоидной формы, которые располагают гидрофобные боковые цепи в виде пространственной многоуровневой структуры.
Пример 8: Фармакология in vivo антител против лигандов BKR1 в моделях боли
Примеры по настоящему изобретению иллюстрируют in vivo эффективность антител против лигандов рецептора BKR1 в различных доклинических моделях острой и хронической боли в соответствии с модифицированным методиками, описанными в (а) Saddi GM and Abbott FV., Pain (2000), 89:53-63; (b) Chen et al., Molecular Pain (2010), 2:6-13 and (c) Bennett GJ and Xie YK., Pain (1988), 33:87-107.
Животные
Эксперименты были выполнены с использованием взрослых самцов мышей OF1 (2 0-3 0 г) для исследований формалина и взрослых самцов мышей C57BI/6J (25-30 г) для исследований CFA и CCI. Мышей содержали в комнате с контролируемой температурой в условиях 12-часового цикла свет-темнота. Обеспечение пищей и водой было без ограничений. Для всех экспериментов мышей акклиматизировали в помещении лаборатории в течение по меньшей мере 2 часов до начала тестирования. Никакой рандомизации не было выполнено для исследований. Экспериментаторы, выполняющие поведенческие тесты были знакомы с видом лечения; однако они не были осведомлены о гипотезе исследования. Все процедуры были одобрены "Comite d' Experimentation pour la Protection de 1'Animal de Laboratoire" (Комитет по уходу и использованию
животных) sanofi-aventis recherche & developpement и проводились в соответствии с французским законодательством (Постановление N 87-848 - 19 октября 1987 - и решение - 19 апреля 1988), следуя Европейской директиве 86/609/ЕЕС.
А. Формалин-индуцированная боль острого воспаления
Формалиновый тест используют для измерения ноцицептивной и воспалительной боли. Действительно, внутриподошвенная инъекция формалина индуцирует начальную острую ноцицептивную поведенческую реакцию (0-12 минут), за которой следует вторая опосредованная воспалением реакция (15-45 минут), что связано с возбудимостью спинного мозга.
Формальдегид (37%, Sigma) разводили в физиологическом растворе (объем/объем) для получения 2,5% концентрации формальдегида (т.е., " 6,2 5% концентрации формалина). Мыши были аккуратно зафиксированы, и 2 0 мкл этого раствора вводили подкожно в дорсальную часть одной задней лапы. Поведенческие реакции оценивали сразу после инъекции формалина, затем - с 3-минутными интервалами в течение 4 5 минут следующим образом: (0): нормальная весовая нагрузка инъецированной лапы; (1): инъецированная лапа слегка опирается об пол; (2): поднятие-высокое расположение инъецированной лапы; (3): лизание или кусание инъецированной лапы. Размеры групп составляли 11-12 самцов мышей OF1.
Оценочные баллы были нанесены на график зависимости от времени, и были рассчитаны площади под кривыми (AUC) из среднего значения оценочных баллов (±SEM) как для ранней (0-12 мин), так и для поздней (15-45 мин) фазы. Исчезновение подобного боли поведения выражали как изменения в AUC в %.
Антитело ЕЕ1 ингибировало подобное боли поведение в позднюю фазу формалинового теста у самцов мышей OF1. Антитело ЕЕ1 при внутривенном введении за 4 8 часов до внутриподошвенной инъекции формалина демонстрировало дозозависимое исчезновение подобного боли поведения только в позднюю фазу с Минимальной Эффективной дозой (MED) = 2,5 мг/кг, как показано на Фигуре 9. Действительно, при введении 2,5, 10 и 30 мг/кг ЕЕ1 реверсировало течение поздней фазы на 35±5%, 33±5% и 45±7%,
соответственно, как показано в таблице 29.
Напротив, F151 слабо ингибирует подобное боли поведение в позднюю фазу формалинового теста при его введении за 4 8 часов до внутриподошвенной инъекции формалина. Действительно, при введении 2,5 и 10 мг/кг F151 реверсировало течение поздней фазы на 15±7% и 21±5%, соответственно, как показано в Таблице 29.
Таблица 2 9
Воздействие антител ЕЕ1 и F151 на индуцированное формалином
Хроническое воспаление индуцировали под краткосрочным наркозом (изофлуран, 3%) путем внутриподошвенной инъекции 25
мкл полного адъюванта Фрейнда (CFA), содержащего 1 мкг/мкл убитых нагреванием микобактерий туберкулеза в минеральном масле и моноолеате маннида (Sigma). Размеры групп составили 8 самцов мышей C57BI/6.
Антитело ЕЕ1 вводили внутривенно через 22 часа после внутриподошвенной инъекции CFA в количестве 2,5 и 30 мг/кг, и механическая и тепловая гиперчувствительность были оценены в 1-й день (D1), День 4 (D4) и День 7 (D7) после внутриподошвенного введения CFA.
В1. Механическая Гиперчувствительность
Механическую гиперчувствительность оценивали путем измерения Частоты прекращения ответа (FR, в %) после 10 аппликаций 0,б г нити Von Frey (Bioseb, Франция) на подошвенную поверхность инъецированной лапы.
Для изучения эффективности антитела ЕЕ1 на подобное боли поведение, авторы изобретения вычисляли реверсирование механической гиперчувствительности (в %) следующим образом:
Процент реверсий были вычислен как (Среднее FR-изотипный
КОНТРОЛЬ после введения дозы - FR- 1рз1После введения дозы) / (Среднее FR-ИЗОТИПНЫЙ КОНТрОЛЬпосле введения дозы ~ Среднее FR-СИМуЛЯЦИЯ после введения дозы) ДЛЯ КаЖДОЙ МЫШИ.
На Dl, D4 и D7 после внутриподошвенной инъекции CFA, наблюдали значительное повышение FR при действии нити Von Frey в группе, обработанной изотипным контролем 1В7.11, по сравнению с необработанной группой, демонстрируя развитие механической гиперчувствительности. Антитело ЕЕ1, при внутривенном введении через 22 часа после внутриподошвенной инъекции CFA, значительно снизило этот показатель FR в разные изучаемые временные периоды по сравнению с таковым, полученным в группе, обработанной изотипным контролем 1В7.11. (Фиг. 10).
Реверсия механической гиперчувствительности составила 41±8% и 22±8% в D1, Зб±9% и 32±9% в D4, и 27±10% и 50±9% в D7 для внутривенного введения антитела ЕЕ1 в количестве 2,5 мг/кг и 30 мг/кг, соответственно (Таблица 30).
В случае тепловой гиперчувствительности проводили измерения Задержки Отдергивания Лапы (PWL, в секундах) в ответ на тепловое излучение с использованием подошвенного аппарата (IITC, Woodland Hills, USA).
Для изучения эффективности антитела ЕЕ1 в отношении подобного боли поведения, авторы изобретения рассчитали реверсию тепловой гиперчувствительности (в %) следующим образом:
Процент реверсий был вычислен по формуле (PWLnocjie введения дозы - Среднее значение изотипного контроляпосле введения дозы) / Среднее значение изотипного контролядо введения дозы - Среднее значение
ИЗОТИПНОГО КОНТрОЛЯпосле введения дозы) ДЛЯ КаЖДОЙ МЫШИ.
Тепловая гиперчувствительность не отличалась между всеми группами в начале исследования до внутриподошвенной инъекции CFA (данные не показаны).
На Dl, D4 и D7 после внутриподошвенной инъекции CFA,
наблюдали значительное уменьшение показателя задержки отдергивания лапы в группе мышей, обработанных изотипным контролем 1В7.11, демонстрируя, что CFA индуцировал тепловую гиперчувствительность (данные не показаны).
Антитело ЕЕ1 вводили внутривенно через 22 часа после внутриподошвенной инъекции CFA (т.е., в 1 день после внутриподошвенной инъекции CFA), и оно не было способно увеличить показатель Задержки Отдергивания Лапы в D1 независимо от испытываемой дозы (Фиг. 11) . Однако, ЕЕ1 значительно увеличивало показатель Задержки Отдергивания Лапы на D4, и этот эффект также присутствовал на D7 (Фиг. 11).
Реверсия тепловой гиперчувствительности составила 41±15% и 58±21% на D4 и 4б±10% и 52±17% на D7 для внутривенного введения ЕЕ1 в количестве 2,5 мг/кг и 30 мг/кг, соответственно (Таблица 31) .
Модель CCI была использована в качестве модели повреждения периферического нерва. Вкратце, мышей подвергали анестезии с помощью изофлурана (3%), и правый седалищный нерв был открыт на уровне середины бедра через небольшой разрез. Три свободные лигатуры из хромированного кетгута б,0 (Ethicon) на расстоянии 1 мм были размещены вокруг седалищного нерва. Хирургическую процедуру завершали, закрывая мышцы и кожу. День хирургической операции CCI считали Днем 0. Размеры групп составляли 6-10 самцов мышей C57BI/6.
Антитело ЕЕ1 вводили внутривенно в количестве 2,5 и 30 мг/кг на 11 день после операции, и оценивали механическую и тепловую гиперчувствительность на 12 день (D12), 14 день (D14) и 18 день 18 (D18) после операции, что соответствовало 1 дню (D1), 3 дню (D3) и 7 дню (D7) после лечения.
С1. Механическая Гиперчувствительность
Механическую гиперчувствительность оценивали путем измерения порогового уровня прекращения функционирования задних лап (на обеих поврежденных [т.е., ipsi] и неповрежденных [т.е., Contra] лапах) в ответ на повышение давления (в г) стимула, используя Dynamic Plantar Aesthesiometer (Ugo-Basile, Italy); стальным стержнем надавливали на задние лапы мышей с нарастанием силы (5 грамм в 10 секунд).
Для исследования воздействия антитела ЕЕ1 на подобное боли поведение, авторы изобретения определяли реверсию механической гиперчувствительности следующим образом: процент реверсий был
ВЫЧИСЛеН ПО формуле (Ipsinocfle введения дозы ~ IpsiHO введения
дозы) / (ContraHO введения дозы - Ipsiflo введения дозы) ДЛЯ КаЖДОЙ МЫШИ .
После хирургической операции у приводимых в движение мышей развивалась надежная сенсибилизации к механическим раздражителем на поврежденной лапе, в то время как на неповрежденную лапу они не оказали никакого воздействия. На 11 день механическая сенсибилизации на поврежденной лапе достигала плато (данные не показаны).
Антитело ЕЕ1, вводимое внутривенно на 11 день, продемонстрировало незначительную тенденцию к реверсии CCI-индуцированной механической гиперчувствительности на D12, D14 и
D18 в виде 15,2±4,9% и 15,2±5,7% на D12, 2б,8±5,7% и 25,7±4,5% на D14 и 30,3±7,1% и 20,8±5,9% на D18 в количестве 2,5 и 30 мг/кг, соответственно (Фиг. 12 и Таблица 32).
Таблица 32
Воздействие антитела ЕЕ1 на CCI-индуцированную механическую гиперчувствительность у самцов мышей C57BI/6
Группа
Доза (мг/кг, в . в . )
12 день после CCI % воздействия ± SEM
14 день после
CCI % воздействия ± SEM
18 день после
CCI % воздействия ± SEM
изотипный контроль 1В7.11
0,2+3,0
1,8+4,3
18,1+6,6
ЕЕ1
2,5
15,2+4,9 15,2+5,7
26,8+5,7 (**) 25,7+4,5 (*)
3 0,3+7,1 20,8+5,9
*, р <0,05 и **,р <0,01 двусторонний ANOVA со временем в качестве повторных измерений с последующим тестом Даннетта для фактор-группы для каждого уровня фактора времени (статистические данные получены Delta ipsi на значениях)
С2. Тепловая Гиперчувствительность
В случае тепловой гиперчувствительности проводили измерения показателя Задержки отдергивания лапы (в секундах) в ответ на тепловое излучение с использованием подошвенного аппарата (IITC, Woodland Hills, USA) на инъецированной задней лапе.
Для изучения эффективности антитела ЕЕ1 в отношении подобного боли поведения, авторы изобретения рассчитали реверсию тепловой гиперчувствительности (в %) следующим образом:
ПрОЦеНТ реверСИЙ бЫЛ ВЫЧИСЛеН ПО формуле (Ipsinocfle введения
дозы - Среднее Значение ИЗОТИПНОГО КОНТрОЛЯПОсле введения
дозы) / (Среднее Значение В ОТСуТСТВИе ВОЗДеЙСТВИЙ после введения дозы -
Среднее значение изотипного контроляПОсле введения дозы) для каждой мыши.
После хирургической операции у приводимых в движение мышей развивалась надежная сенсибилизация к тепловому раздражителю на поврежденной лапе, в то время как на неповрежденную лапу он не оказал никакого воздействия. На 11 день тепловая сенсибилизация на поврежденной лапе достигала плато (данные не показаны).
Антитело ЕЕ1, вводимое внутривенно на 11 день, значимо не увеличило показатель Задержки отдергивания лапы на D12, даже если наблюдалась тенденция. Однако, начиная с D14, антитело ЕЕ1 значимо увеличило показатель Задержки отдергивания лапы (Фиг. 13). Реверсия тепловой гиперчувствительности составила 41±1б% и 5б±24% на D12 и 51±1б% и 98±48% на D14 и 78±19% и 84±22% на D18 для внутривенного введения антитела ЕЕ1 в количестве 2,5 мг/кг и 30 мг/кг, соответственно (Таблица 33).
Таблица 33
Воздействие антитела ЕЕ1 на CCI-индуцированную тепловую гиперчувствительность
у самцов мышей C57BI/6 Оценка кинетических параметров
Группа
Доза (мг/кг , в.в.)
12 день после CCI PWL (сек) % воздействия
14 день после CCI PWL (сек) % воздействия
18 день после CCI PWL (сек) % воздействия
наивные
п.а.
6,3+0,5 100+19
6,2+0,4
100+14
6,1+0,5
100+17
Изотипный
контроль
1В7.11
3,8+0,2
0+7
3,4+0,2
0+5
3,4+0,2
0+7
ЕЕ1
2,5 30
4,8+0,4 5,2+0,6 41+16 56+24
4,8+0,5 6,1+1,3(**)
51+16 98+48
5,5+0,5 (*) 5,7+0,6 (**)
78+19 84+22
PWL: Задержка отдергивания лапы ± SEM, % воздействия ± SEM, п.а. не доступно *, р <0,05 и **,р <0,01 двусторонний ANOVA со временем в качестве повторных измерений с последующим тестом Даннетта для фактор-группы для каждого уровня фактора времени
ФОРМУЛА ИЗОБРЕТЕНИЯ
1. Выделенное моноклональное антитело, или его антиген-связывающий фрагмент, которое:
a) специфически связывает каллидин или des-Агдю-каллидин, но не связывает брадикинин или des-Arg9-брадикинин;
b) специфически связывает каллидин или des-Агдю-каллидин со значением KD меньше 1x1 СГ10 М;
c) специфически связывает каллидин или des-Агдю-каллидин со значением Koff меньше 1х104 с-1; и/или
d) специфически связывает каллидин или des-Агдю-каллидин и ингибирует связывание с рецептором брадикинина В1.
2. Антитело, или его антиген-связывающий фрагмент, по любому из предшествующих пунктов, которое связывается с остатком лизина на N-конце каллидина или des-Агдю-каллидина.
3. Антитело, или его антиген-связывающий фрагмент, по любому из предшествующих пунктов, которое ингибирует связывание каллидина или des-Агдю-каллидина с рецептором брадикинина-1.
4. Антитело, или его антиген-связывающий фрагмент, по любому из предшествующих пунктов, которое специфически связывает каллидиноподобный пептид мыши (KLP).
5. Антитело, или его антиген-связывающий фрагмент, по любому из предшествующих пунктов, содержащее вариабельный домен тяжелой цепи, содержащий аминокислотную последовательность HCDR3, выбранную из группы, состоящей из:
a) SEQ ID N0:7 [XiY Х2 X3D Х4НАМ X5Y] , где Xi представляет собой Y, F или Н,
Х2 представляет собой R, D, А, V, L, I, М, F, Y или W, Х3 представляет собой Y, F, W или Н, Х4 представляет собой D, Е или Y, и, Х5 представляет собой D или Е;
b) SEQ ID N0:63 [X1EYDGX2YX3X4LDX5] , где Xi представляет собой W или F,
Х2 представляет собой N или аминокислоты нет; Х3 представляет собой Y или S, Х4 представляет собой D или Р, и
Х5 представляет собой F или Y;
c) SEQ ID N0:13;
d) SEQ ID N0:32;
e) SEQ ID N0:40;
f) SEQ ID N0:47; и
g) SEQ ID NO:55.
6. Антитело, или его антиген-связывающий фрагмент, по любому из предшествующих пунктов, дополнительно содержащее аминокислотную последовательность HCDR2, выбранную из группы, состоящей из:
a) SEQ ID N0:8 [YFXiPX2NGNTGYNQKFRG] , где
Xi представляет собой D, R, А, V, L, I, М, F, Y или W, и Х2 представляет собой Y, D, Е, N, или Q;
b) SEQ ID N0:64 [WXiDPENGDX2X3YAPKFQG] , где Xi представляет собой I, или V,
Х2 представляет собой Т, или S, и Хз представляет собой G, или D;
c) SEQ ID N0:14
d) SEQ ID N0:33;
e) SEQ ID N0:41;
f) SEQ ID N0:48; и
g) SEQ ID N0:56.
7. Антитело, или его антиген-связывающий фрагмент, по любому из предшествующих пунктов, дополнительно содержащее аминокислотную последовательность HCDR1, выбранную из группы, состоящей из:
7.
любому из предшествующих пунктов, дополнительно содержащее вариабельный домен легкой цепи, содержащий аминокислотную последовательность LCDR3, выбранную из группы, состоящей из:
a) SEQ ID N0:10 [QQ Xi X2S Х3Р Х4Т], где Xi представляет собой Y, F или Н,
Х2 представляет собой Y, F, Н или W, Х3 представляет собой Y, F, Т или Н, и, Х4 представляет собой W, Y, F, Н или L:
b) SEQ ID N0:66 [QXiX2X3SX4PX5T] , где Xi представляет собой Q или N,
Х2 представляет собой Y, F, D или Н, Х3 представляет собой Y, F, Н или W, Х4 представляет собой Y, F, Т или Н, и Х5 представляет собой W, Y, F, Н или L;
c) SEQ ID N0:69 [XiQGTHFPYT] , где Xi представляет собой L или М;
d) SEQ ID N0:16;
e) SEQ ID N0:35;
f) SEQ ID N0:43;
g) SEQ ID N0:50; и
h) SEQ ID N0:58.
9. Антитело, или его антиген-связывающий фрагмент, по любому из предшествующих пунктов, дополнительно содержащее аминокислотную последовательность LCDR2, выбранную из группы, состоящей из:
a) SEQ ID N0:11 [WASTRXi] , где Xi представляет собой Е, D,
Q или N;
b) SEQ ID N0:67 [X2ASTRX2], где Xi представляет собой W или G, и
Х2 представляет собой Е, D, Q или N;
c) SEQ ID N0:17;
d) SEQ ID N0:36;
e) SEQ ID N0:51; и
f) SEQ ID N0:59.
10. Антитело, или его антиген-связывающий фрагмент, по любому из предшествующих пунктов, дополнительно содержащее
10.
аминокислотную последовательность LCDR1, выбранную из группы, состоящей из:
SEQ
: 12
[KSSQSLL XiSSNQKN X2LA]
, где
представляет
собой W, H, Y или F, и
представляет
собой H или Y;
SEQ
: 68
[KSSQSLLXiX2SX3QX4NX5LA]
, где
представляет
собой W, H, Y или F,
представляет
собой S или G,
представляет
собой N или D,
представляет
собой К или R,
представляет
собой Н или Y;
SEQ
NO:
70 [KSSQSLLYSNGXiTYLN] ,
где Xi
собой К
или
SEQ
: 18
SEQ
: 37
SEQ
: 44
SEQ
: 52
; и
SEQ
: 60
11. Антитело, или его антиген-связывающий фрагмент, по любому из пп.1-4, содержащее вариабельный домен легкой цепи, содержащий аминокислотную последовательность LCDR3, выбранную из группы, состоящей из:
a) SEQ ID N0:10 [QQ Xi X2S Х3Р Х4Т], где Xi представляет собой Y, F или Н,
Х2 представляет собой Y, F, Н или W, Хз представляет собой Y, F, Т или Н, и, Х4 представляет собой W, Y, F, Н или L:
b) SEQ ID N0:66 [QXiX2X3SX4PX5T] , где Xi представляет собой Q или N,
Х2 представляет собой Y, F, D или Н, Х3 представляет собой Y, F, Н или W, Х4 представляет собой Y, F, Т или Н, и Х5 представляет собой W, Y, F, Н или L;
c) SEQ ID N0:69 [XiQGTHFPYT] , где Xi представляет собой L или М;
d) SEQ ID N0:16;
e) SEQ ID N0:35;
f) SEQ ID N0:43;
g) SEQ ID N0:50; и
h) SEQ ID N0:58.
12. Антитело, или его антиген-связывающий фрагмент, по
п.11, дополнительно содержащее аминокислотную
последовательность LCDR2, выбранную из группы, состоящей из:
a) SEQ ID N0:11 [WASTRXi] , где Xi представляет собой Е, D,
Q или N;
b) SEQ ID N0:67 [XiASTRX2], где Xi представляет собой W или G, и
Х2 представляет собой Е, D, Q или N;
c) SEQ ID N0:17;
d) SEQ ID N0:36;
e) SEQ ID NO:51; и
f) SEQ ID N0:59.
13. Антитело, или его антиген-связывающий фрагмент, по
п.12, дополнительно содержащее аминокислотную
последовательность LCDR1, выбранную из группы, состоящей из:
a) SEQ ID N0:12 [KSSQSLL XiSSNQKN X2LA] , где Xi представляет собой W, Н, Y или F, и
Х2 представляет собой Н или Y;
b) SEQ ID N0:68 [KSSQSLLXiX2SX3QX4NX5LA] , где Xi представляет собой W, Н, Y или F,
Х2 представляет собой S или G, Хз представляет собой N или D, Х4 представляет собой К или R, Х5 представляет собой Н или Y;
c) SEQ ID N0:70 [KSSQSLLYSNGXiTYLN] , где Xi представляет
собой К или Е;
b) SEQ ID N0:18;
c) SEQ ID N0:37;
d) SEQ ID N0:44;
e) SEQ ID N0:52; и
f) SEQ ID N0:60.
14. Антитело, или его антиген-связывающий фрагмент, по
14.
любому из пп.1-4, содержащее вариабельный домен тяжелой цепи, содержащий аминокислотные последовательности домена HCDR3, HCDR2 и HCDR1 SEQ ID N0:13, 14, и 15, соответственно, и одну или более аминокислотных замен в положениях, выбранных из группы, состоящей из HI, Н5, Н9, НИ, Н12, Н16, Н38, Н40, Н41, Н43, Н44, Нбб, Н75, Н79, Н81, Н82А, Н83, Н87 и Н108 по Кабату.
15. Антитело, или его антиген-связывающий фрагмент, по п.14, дополнительно содержащее вариабельный домен легкой цепи, содержащий аминокислотные последовательности домена LCDR3, LCDR2 и LCDR1 SEQ ID N0:16, 17, и 18, соответственно, и одну или несколько аминокислотных замен в положениях, выбранных из группы, состоящей из L5, L9, L15, L18, L19, L21, L22, L43, L63, L78, L79, L83, L85, L100 и L104 по Кабату.
16. Антитело, или его антиген-связывающий фрагмент, по любому из пп.1-4, содержащее вариабельный домен легкой цепи, содержащий аминокислотные последовательности домена LCDR3, LCDR2 и LCDR1 SEQ ID N0:16, 17, и 18, соответственно, и одну или несколько аминокислотных замен в положениях, выбранных из группы, состоящей из L5, L9, L15, L18, L19, L21, L22, L43, L63, L78, L79, L83, L85, L100 и L104 по Кабату.
17. Антитело, или его антиген-связывающий фрагмент, по любому из пп.1-4, содержащее аминокислотную последовательность вариабельного домена тяжелой цепи, которая по меньшей мере на 90% идентична аминокислотной последовательности, выбранной из группы, состоящей из SEQ ID N0:19, 20, 21, 22, 24, 25, 38, 45, 53 и 61 .
18. Антитело, или его антиген-связывающий фрагмент, по
п.17, дополнительно содержащее аминокислотную
последовательность вариабельного домена легкой цепи, которая по
меньшей мере на 90% идентична аминокислотной
последовательности, выбранной из группы, состоящей из SEQ ID
N0:26, 27, 28, 29, 29, 30, 31, 39, 46, 54 и 62.
19. Антитело, или его антиген-связывающий фрагмент, по любому из пп.1-4, содержащее аминокислотную последовательность вариабельного домена легкой цепи, которая по меньшей мере на 90% идентична аминокислотной последовательности, выбранной из
15.
группы, состоящей из SEQ ID N0:26, 27, 28, 29, 29, 30, 31, 39, 46, 54 и 62.
20. Антитело, или его антиген-связывающий фрагмент, по любому из пп.1-4, содержащее аминокислотную последовательность вариабельного домена тяжелой цепи, которая по меньшей мере на 90% идентична аминокислотной последовательности, выбранной из группы, состоящей из: SEQ ID N0:19, 20, 21, 22, 24, 25, 38, 45, 53 и 61 .
21. Антитело, или его антиген-связывающий фрагмент, по
п.20, дополнительно содержащее аминокислотную
последовательность вариабельного домена легкой цепи, выбранную
из группы, состоящей из: SEQ ID N0:2 6, 27, 28, 29, 29, 30, 31,
39, 46, 54 и 62.
22. Антитело, или его антиген-связывающий фрагмент, по любому из пп.1-4, содержащее аминокислотную последовательность, выбранную из группы, состоящей из: SEQ ID N0:2 6, 27, 28, 2 9, 29, 30, 31, 39, 46, 54 и 62.
23. Антитело, или его антиген-связывающий фрагмент, по любому из пп.1-4, содержащее аминокислотные последовательности вариабельного домена тяжелой цепи и легкой цепи SEQ ID N0:19 и 26, SEQ ID N0:20 и 27, SEQ ID N0:21 и 28; SEQ ID N0:22 и 28; SEQ ID N0:23 и 29; SEQ ID N0:24 и 30; SEQ ID N0:25 и 31; SEQ ID N0:38 и 39, SEQ ID N0:45 и 46, SEQ ID N0:53 и 54, или SEQ ID N0:61 и 62, соответственно.
24. Антитело, или его антиген-связывающий фрагмент, которое специфически связывает каллидин и des-Агдю-каллидин, где антитело, или его антиген-связывающий фрагмент, конкурирует за связывание каллидина и des-Агдю-каллидина с антителом, содержащим аминокислотные последовательности вариабельного домена тяжелой цепи и легкой цепи SEQ ID N0:19 и 26, SEQ ID N0:38 и 39, SEQ ID N0:45 и 46, SEQ ID N0:53 и 54 или SEQ ID N0:61 и 62, соответственно.
25. Выделенное моноклональное антитело, или его антиген-связывающий фрагмент, которое конкурирует за связывание каллидина и des-Агдю-каллидина с антителом по любому из предшествующих пунктов и не связывает брадикинин или desArgg
20.
брадикинин.
26. Выделенное моноклональное антитело, или его антиген-связывающий фрагмент, которое специфически связывается с конформационным эпитопом каллидина (KD) или des-Агдю-каллидина (DAKD), который принимает кинк-конформацию в Pro 4, включающую крутой поворот типа II в пролине 4 KD или DAKD.
27. Антитело или антиген-связывающий фрагмент по п.2 6, где кинк-конформация в Pro 4 KD или DAKD дополнительно содержит аминокислотные повторы сигмовидной формы, которые выравнивают гидрофобные боковые цепи аминокислот в пространственную многоуровневую структуру.
28. Антитело или его антиген-связывающий фрагмент по п. 2 6 или 27, которое
(а) специфически связывает каллидин или des-Агдю-каллидин, но не связывает брадикинин или des-Argg-брадикинин;
b) специфически связывает каллидин или des-Агдю-каллидин со значением KD меньше 1x1 СГ10 М;
c) специфически связывает каллидин или des-Агдю-каллидин со значением Koff меньше 1х104 с-1; и/или
d) специфически связывает каллидин или des-Агдю-каллидин и ингибирует связывание с рецептором брадикинина В1.
29. Антитело по любому из предшествующих пунктов,
конъюгированное с диагностическим или терапевтическим
средством.
30. Выделенная нуклеиновая кислота, кодирующая аминокислотную последовательность антитела или его антиген-связывающий фрагмент по любому из предыдущих пунктов.
31. Рекомбинантный вектор экспрессии, содержащий нуклеиновую кислоту по п.30.
32. Клетка-хозяин, содержащая рекомбинантный вектор экспрессии по п.31.
33. Способ получения антитела, которое специфически связывает каллидин и des-Argl0-каллидин, включающий культивирование клетки-хозяина по п. 32 в таких условиях, чтобы антитело, которое специфически связывалось каллидином и des-
30.
ArglО-каллидином, продуцировалось клеткой-хозяином.
34. Фармацевтическая композиция, содержащая антитело или его антиген-связывающий фрагмент по любому из пп.1-28 и один или несколько фармацевтически приемлемых носителей.
35. Способ лечения заболевания или нарушения, связанного с каллидином или des-ArglО-каллидином, где способ включает введение индивидууму фармацевтической композиции по п.34.
36. Способ по п.35, где заболеванием или нарушением является хроническая боль.
37. Способ получения антитела, которое специфически связывает des-Argg-брадикинин и des-Агдю-каллидин-подобный пептид, включающий: иммунизацию животного иммуногеном, содержащим пептид, где пептид состоит из аминокислотной последовательности SEQ ID N0:11, и где аргинин на амино конце пептида связан с молекулой носителя не напрямую, а с помощью линкерной молекулы так, что антитело, которое специфически связывает des-Arg9-6paflMKMHMH, des-Argl0-каллидин и des-Argl0-каллидино-подобный пептид, продуцируется иммунной системой животного.
38. Способ по п.37, дополнительно включающий выделение из организма животного антитела, нуклеиновой кислоты, кодирующей антитело, или иммунной клетки, экспрессирующей антитело.
39. Способ по п.37, где молекула носителя является белком.
40. Способ по п.39, где белок представляет собой гемоцианин лимфы улитки (KLH).
41. Способ по п.40, где молекула линкера содержит [Gly-Gly-Gly]n, где п равен по меньшей мере 1.
По доверенности
518567
-Q < в
о ю о о о ю о о о ю о о
90* СЮ
S Я
" о
<
<
<
ьч"
р-1
Р-1
<
<
<
ьч"
ьч"
ьч"
<
<
<
<
<
<
<
<
<
<
<
<
<
Рч1
<
<
<
<
<
<
ьч"
<
<
<
<
<
р-1
<
<
<
ьч"
Рч"
Р-1
<
<
<
<
Рч1
• •
• •
• •

• >
о о о m о m
со со со г- со го о о о
Ю (М М Н н
СМ СМ
о о с\| Ы
СМ О
I I I I I
о; аз
й й Й H Й H
00аоa о
со-со-со 1 o~i со со со к CO К о
? ? ? ё Б3 ё ^
О Р-1
СМ СО
о a
> ы
° у
О | < СМ > н
О FE СП К
со со
о со
00 > н Бн
со Q
о г-
ы a
ю н п н м ^
Н Ю м м ю
О о о о
дг; ь о сп н н
Ю Н П Н OJ
Н Ю Ш OJ CxJ ю
?ч о о о о
Л h U И н н
Л О
о; оз с; о
со н
^ ^ а а а о ы ы ы ы
о < со со Оч* сс сс
ю 1 сп 1 см ^
н ю м см ю
[xj о о о о
? h О CP ЬЧ ЬЧ
I I
I I I
о к СП к см К
о см см
о О
О нч
см со
о со CTi со
LO 5-I СП 1 СМ ^Г1
Н Ю "3 см см ю
h Н О ООО
дс; о m ьч ьч
(euuAdj а д-/=|\|) |/\l3S+8MH8hBHe ээнУэсЬ 1Э9Ю иияээьнэУэаои
со"
T*~
1- HI
О CM CO
> ^ > ^
CL CL
¦ 1
1 1 1
' ' '
ююю
CL CL CL
ЮЮЮ
CQ CQ CQ _ О О О С CL CL CL
> ^ s s s CL =Г =r =r CD CD CD ^ ^ ?
со с
N. Q
i < < <
ООО
IDD
O О
О 00 о
(О о
о см
(о/0) 819910 BlOlOBh
I4* G си ¦5с
<
|_|_ О
о со
со" си
г--m
т- CQ CQ
2 m со
CD i- i_
5: ю о
о с\Г °°
О СО
к и; S
со СО ?
i i 5 со со 2
lOlO 42
со со "3 °- Q- .500 о
IDD
си со
о о
о. I-
си с; о о
CD О.
(пУнЛнээ) iquBLf винвашс^хо вжс1эУв^
о со
г--
? q ш
^ 00 со
^ ^" о
о см со
S с? cf
15 с с=
х > ^
г а Р-
о ш ш
§ ш ш
ск ?
со 2 со
со со
о о о
со S Я о. о. ,g-
ООО
IDD
(%) и1Э0нчиэ1иа1эаАьс1эиш иояээьинехэи BModeaed
CQ СО
о со
о; со
(пУнЛнээ) iquBLf винвашс1эУ10 eMdetfeg
нй1
• > н
Ен •
• Ен
Е-н
• со
• Й
> •
• >
СО •
• СО
Ен •
• Ен
< •
• ^
• о
Ен •
• Ен
<
о •
• о
о •
• о
> н •
• со
а •
• а
н •
• н
о •
• о
нй1 •
• нй1
PJ •
• PJ
13 •
• 13
• Й
> н •
• > н
к •
• к
¦ ы
• н
Q •
• Q
р-1 •
• PJ
• >
• 13
g >
> g
> ^
к •
о •
• о
> pЈ
• 1^
Ен •
• Ен
• S
• > н
о •
• О
о •
• о
13 •
• 13
Pj •
• PJ
ы •
• ы
fcj
к •
• К
о •
• о
нй1 •
• ^
а •
• а
fcj •
• fcj
• о
Q •
• Q
а •
• а
Ен •
• Ен
• а
> н •
• > н
> н •
• > н
о •
• о
15 •
• 15
PJ •
• PJ
> н •
• > н
<
• <
• нй1
со •
• со
а •
• 15
• > н
> н •
• > н
• СО
> •
¦ >
¦ <
• СО
а •
¦ а
13 •
¦ 13
о •
• о
а •
• а
СГ)
• к
> н •
• > н
о •
• о
• S
> н •
• > н
> •
• >
> н •
• > н
> н •
• > н
< •
• <
• со
• Ен
< •
• <
Ен •
• Ен
Q •
• Q
• н
СГ)
[ч •
• fcj
СГ)
• ы
СТ)
СО •
• СО
Q •
• Q
• Ен
со •
• со
а •
• а
ы •
• ы
> н •
• > н
СО •
• СО
о •
• о
^ •
¦ ^
• а
со •
• со
со •
• со
¦ с2
• нй1
со •
• со
о •
¦ о
со •
• со
^ •
• Ен
СО •
• СО
о •
• о
• ы
• н
н •
• н
со •
• со
S •
• S
Е-н •
• Ен
Ен •
• Ен
> •
• >
¦ :
> •
• >
СЧ1
а ¦
• нй1
CN]
< •
• <
г-\
Ен •
• Ен
> •
• >
Ен •
• Ен
• Q
fcj •
• fcj
со •
• со
со •
• со
о •
• О
Q •
• Q
• <
со •
• со
> •
• >
Ен •
• Ен
о •
• о
со •
• со
со •
• со
о •
• о
PJ •
• PJ
к •
• к
¦ <
со •
• со
• к
Q •
• Q
<
• со
о •
¦ о
а ¦
¦ ^
со •
• со
• >
Ен •
¦ Ен
со •
• со
о •
¦ о
ы •
• ы
• S
СО •
• со
• со
<
Ен •
• Ен
PJ •
• PJ
fcj •
¦ fcj
о •
• о
f3\
• >
СО •
• СО
л ¦
• л
со •
• со
• л
а •
• а
• со
а •
• а
о •
¦ о
^--
• Ен
PJ •
• PJ
• а
2 .
• S
> •
• >
^ •
• ^
fcj •
• fcj
о •
• о
а •
к •
• к
о со •
¦ со
н •
• н
со •
• со
• >
а •
• а
см со •
• со
Q •
• Q
¦ а
<
> •
• >
нй1
О нй1 о
fcj
fcj
о I
I-I
LO I-I сл ы ее;
Е-н
<
нЧ"
См|
о о
нЧ"
S3 S3
сл сл
> СЛ
о сл сл
о S3I
ы о
ьн|
нЧ" сл
См сл о
I-I I
со [>
X I
I-I I
LO \-I
CD CD
О S3
О Ы сл
i-i Ы нЧ" ^ Eh О О О
fn Ен
> н CO > н > н OI
О > н > н
<
нЧ"
Q Ы
> сл сл н
Ен нЧ" Ен
Q Ен О
сл О сл О
ее; Q
> о
о S3
о ы сл
ы > |
<, О
НнЧ
СЛ СЛ
Ен 1-^ Ен [ч Q Ен О СЛ О СЛ
О сл|
[ч PS
> о о
н 12
Ы i-q сл
О К СО
о >
Ен Ри СО
о сл
> >
Ен О Сч
о сл о о НЧ1 о н ы
о к I
I-I
I-I [ч о
01 ol о
Сч I
<
S сл н
Ен > н
о сл
о сл
> у, >
<|
> | ы
<|
НЧ1
I-I
о |>
X I
а I
I-I
о [>
I-I I
I-I сп
С\]
I-I
о S3
> н > н
сл а а сл
Ен нЧ" СЛ СЛ
НЧ1
Ен СЛ СЛ СЛ
а >
Ен Ен
> н См Q Ри
О S3
О Ы сл
Таблица 3
Таблица 5
Таблица 9
Таблица 12
Таблица 12
Таблица 14
Таблица 15
Таблица 15
Таблица 16
Таблица 16
Таблица 17
Таблица 17
106
Таблица 21
105
108
108
Таблица 24
Таблица 24
Ill
Таблица 2 5
Ill
Таблица 2 5
112
112
112
112
118
119
Таблица 2 8
121
121
1/17
1/17
1/17
1/17
1/17
3/17
4/17
4/17
7/17
7/17
7/17
7/17
7/17
7/17
7/17
7/17
8/17
10/17
10/17
10/17
10/17
11/17
11/17
11/17
11/17
11/17
11/17
12/17
12/17
12/17
12/17
12/17
12/17
12/17
12/17
12/17
12/17
12/17
12/17
13/17
13/17
13/17
13/17
13/17
13/17
14/17
14/17
15/17
15/17
15/17
15/17
17/17
17/17