Патентная документация ЕАПВ

 
Запрос :  ea201491708a*\id

больше ...
Термины запроса в документе


Полный текст патента

(57) Реферат / Формула:

Изобретение относится к новому способу получения и очистки микробной коллагеназы (микробной коллагеназы ЕС 3.4.24.3), продуцируемой непатогенной аэробной бактерией Vibrio alginolyticus chemovar. Iophagus (номер NCIMB: 11038, синоним LMG 3418, далее называется Vibrio alginolyticus), причем указанный способ обеспечивает высокие уровни продуцирования коллагеназы с помощью стабильного, воспроизводимого, дешевого способа ферментации. Коллагеназа, продуцируемая Vibrio alginolyticus, в соответствии со способом, описанным в изобретении, также демонстрирует удельную активность, превосходную по сравнению с другими микробными коллагеназами, является стабильной в водном растворе и может быть заморожена без значительных повреждений. Другой объект изобретения представляет собой фармацевтические композиции, содержащие коллагеназу, полученную в соответствии с описанным способом получения и очистки, для цели терапевтического лечения расстройств, отличающихся аккумуляцией коллагена, или для лечения повреждений/дефектов кожи, которые могут быть улучшены при уменьшении локальной аккумуляции коллагена.


2420-519098ЕА/026
НОВЫЙ СПОСОБ ПОЛУЧЕНИЯ И ОЧИСТКИ ФЕРМЕНТА КОЛЛАГЕНАЗЫ ИЗ VIBRIO ALGINOLYTICUS
Область техники, к которой относится изобретение
Коллагеназы представляют собой металлоферменты с протеолитической активностью, которые требуют иона цинка в активном сайте для осуществления их специфичной функции разрушения нативного коллагена. В отличие от других протеаз, они могут гидролизовать коллаген при физиологических условиях рН и температуры. Ряд коллагеназ, продуцируемых бактериями, известен из литературы (Vibrio, Clostridium, Streptomyces, Pseudomonas); ферменты, продуцируемые Clostridium (Santyl(r), Noruxol(r)), широко используют в фармацевтических композициях для лечения кожных язв различной природы, пролежней, ожогов различных степеней и гипертрофических рубцов, поскольку они разрушают коллаген, присутствующий в некротической ткани. Это облегчает удаление клеточных остатков, которые часто составляют препятствие для миграции эпителиальных клеток во время заживления ран и процесса реэпителизации (Rao, D.B. et al., 1975) . Коллагеназа из Vibrio также используется в последнее время для сходных целей (ЕР 1901755); этот патент описывает исключительно липофильные композиции (липогели), содержащие каррагенан в качестве стабилизирующего агента. Однако воспалительная роль, как правило, которую играет это вещество, известна специалистам в данной области. В любом случае, независимо от ее происхождения, коллагеназа имеет исключительно низкую стабильность в водном носителе, и по этой причине, ее всегда составляют в полностью липофильных носителях; Santyl(r), Noruxol(r) и Bionect Start(r) представляют собой мази с полностью липофильной основой, в которой фермент никогда не распределяется однородно и подвергается воздействию значительных потерь активности со временем.
Липофильный носитель обеспечивает стабильность фермента и стабильность при хранении фармацевтического продукта, в то же
время, подрывая его терапевтическую активность; коллагеназа высвобождается из липофильного носителя очень медленно, с тем результатом, что его биологическая доступность является сильно ограниченной. Коллагеназу можно также использовать для системного лечения, в частности, посредством инъекции, таких расстройств, как адгезивный капсулит (плечелопаточный периартрит), синдром Дюпюитрена, болезнь Пейрони, целлюлит и послеоперационные спайки. Стабильность в водном носителе является критичной для этих применений. Продукт для лечения синдрома Дюпюитрена с помощью инъекций имеется в настоящее время на рынке (лиофильное вещество, разбавляемое во время использования), он содержит смесь двух коллагеназ при точном массовом отношении, которые экстрагируются и очищаются с помощью ферментации бактерии Clostridium histolyticum.
Как уже сказано, последняя является одним из наиболее распространенных источников коллагеназы; однако это патогенный микроорганизм, который требует анаэробной ферментации (Mandl, I. et al., 1958, Arch Biochem Biophys, 74:465-475).
Коллагенолитическая активность некоторых штаммов
Achromobacter идентифицирована в первый раз в 1972 году
(Thomson, J.A., Woods, D.R. and Welton, R.L. 1972), и первые
исследования осуществлялись впоследствии на штамме
Achromobacter iophagus (впоследствии переквалифицированном как
Vibrio alginolyticus chemovar. Iophagus, Emod, I. et al. 1983),
которые демонстрируют присутствие коллагеназы с высоко
специфичной активностью (Welton and Woods 1973). Относительно
выбора микроорганизма, который должен использоваться для
продуцирования коллагеназы посредством ферментации,
использование Vibrio alginolyticus является более
преимущественным, чем Clostridium histolyticum, поскольку они не патогенны и делают возможным осуществление ферментации в аэробной окружающей среде, со значительными промышленными преимуществами. Патогенность микробного штамма является важным аспектом, поскольку любые примеси (микробные или белковые остатки) в готовом продукте могут вызывать серьезные побочные воздействия. Работа с патогенными штаммами, очевидно, требует
особенной осторожности на стадиях очистки, и как следствие этого, более сложного, дорогостоящего промышленного процесса.
Микробная коллагеназа ЕС 3.4.24.3, продуцируемая Vibrio alginolyticus, представляет собой Zn2+ металлопротеазу, которая также отличается от коллагеназ, продуцируемых Clostridium histolyticum, по ряду причин:
она действует специфично на синтетический пептид Pz-Pro-
Leu-Gly-Ala-D-Arg (где Рг=4-фенилазобензилоксикарбонил),
который представляет собой синтетический субстрат, выбираемый для оценки коллагенолитический активности. Коллагеназа от V. alginolyticus продуцируемая в соответствии с настоящим изобретением, является единственной коллагеназой, которая способна разрушать коллаген на связи Leu-Gly (Keil, В., Gilles А.-М., Lecroisey, A., Hurion, N. and Tong, N.-T. 1975; Keil B. Matrix Suppl. 1992; 1:127-33);
она имеет гораздо большую протеолитическую активность, чем аналог, получаемый из Clostridium histolyticum;
она имеет специфичность относительно сайта расщепления нативного коллагена; она расщепляет спиральную цепь нативного коллагена на 2 сайтах, предпочтительно, на 3/4 от края с N-окончанием на связи Y-Gly последовательности Pro-Y-Gly-Pro, где Y представляет собой нейтральную аминокислоту. Наоборот, коллагеназа от Clostridium histolyticum дает разнообразные сайты расщепления в цепи нативного коллагена (Lecroisey, А. Keil, В. 1979);
Штамм Vibrio alginolyticus chemovar. Iophagus продуцирует только одну коллагеназу, хотя анализ продуктов очистки с помощью SDS-PAGE демонстрирует присутствие нескольких полос с различными молекулярными массами, где поддерживается коллагенолитическая активность. Эти низкомолекулярные частицы приписываются процессу аутопротеолиза фермента, который ингибируется конкретно приготовленными буферами (Keil-Dlouha, V. 1976).
В 1992 году Takeuchi et al. Клонировали полную последовательность, кодирующую коллагеназу из Vibrio alginolyticus. Последовательность аминокислоты, следующая из
последовательности нуклеотидов, показывает, что зрелая
коллагеназа образуется с помощью 739 аминокислот с молекулярной
массой 81875 Да. Нуклеотидные и аминокислотные
последовательности коллагеназы из Vibrio alginolyticus не
демонстрируют никакого значительного сходства с
последовательностями других коллагеназ (Takeuchi, Н., 1992). К настоящему времени, способы получения фермента из рассматриваемого штамма дают скорее самые умеренные выходы и продукты с неудовлетворительным уровнем чистоты, особенно, для использования при инъекциях. Патент ЕР 0115974 описывает способ получения и очистки коллагеназы из V. alginolyticus; конечный продукт представляет собой смесь ферментов (коллагеназу, нейтральные протеазы и эндонуклеазу), которая является стабильной только после добавления фрагментов коллагена бычьей кожи (ASF).
Полученный материал имеет очень низкий уровень чистоты. Кроме того, присутствие ASF может создавать проблемы во время приготовления идентифицированных фармацевтических форм, в частности, поскольку он представляет собой материал животного происхождения, когда выбранные фармацевтические композиции вводятся посредством инъекции.
Кроме того, как уже сказано, фармацевтические композиции, известные в настоящее время, имеют форму мази, в то время как для местных применений и, прежде всего, для системных применений, главное, чтобы фермент коллагеназа находился в исключительно чистой форме и был стабильным в водном носителе (для улучшения распределения фермента в композиции); водный носитель является абсолютно предпочтительным для лечения с помощью инъекции.
Настоящее изобретение позволяет преодолевать эти проблемы
путем раскрытия инновационного способа получения и очистки
фермента коллагеназы из V. alginolyticus, отличающегося
высокими выходами, воспроизводимостью результатов,
стабильностью и высоким уровнем чистоты готового продукта. Готовый продукт также является стабильным в водном растворе и может, следовательно, храниться в течение длительных периодов,
даже при температурах, находящихся в пределах между -2 0 и -80°С, не подвергаясь значительным повреждениям.
Благодаря высокому уровню чистоты и специфичности расщепления на коллагеновой цепи, коллагеназа, предлагаемая в настоящем документе, может также использоваться для диссоциации тканей и изоляции клеточных кластеров или отдельных клеток для всех экспериментальных и терапевтических процедур, требующих изолированных клеток.
Подробное описание изобретения
В настоящем изобретении заявлен новый способ получения и очистки микробной коллагеназы (Microbial Collagenase ЕС 3.4.2 4.3), продуцируемой непатогенной аэробной бактерией Vibrio alginolyticus chemovar. Iophagus (номер NCIMB: 11038, синоним LMG 3418, ниже называется Vibrio alginolyticus); указанный способ обеспечивает высокие уровни продуцирования коллагеназы с помощью стабильного, воспроизводимого, дешевого способа ферментации. Последовательность коллагеназы, продуцируемой Vibrio alginolyticus, в соответствии со способом получения и очистки, описанным в настоящем описании (SEQ ID N0:1), отличается делецией аминокислот 1-75 по сравнению с последовательностью из 814 аминокислот, кодируемой геном коллагеназы V. alginolyticus (в настоящем документе упоминается как SEQ ID N0:2, соответствующая Microbial Collagenase ЕС 3.4.24.3) . С помощью способа по настоящему изобретению, получают зрелый белок, то есть активную сердцевину, состоящую из 739 аа, более конкретно из 76-814 аа: TACDLEALVTESSNQLISEILSQGATCVNQLFSAESRIQESVFSSDH MYNIAKHTTTLAKGYTGGGSDELETLFLYLRAGYYAEFYNDNISFIEWV TPAVKESVDAFVNTASFYENSDRHGKVLSEVIITMDSAGLQHAYLPQVT QWLTRWNDQYAQHWYMRNAVNGVFTILFGGQWNEQFVQIIGNQTDL AKALGD FALRAS SIGAE DE FMAANAGRE LGRL TKYT GNAS S WKS QL S RIFEQYEMYGRGDAVWLAAADTASYYADCSEFGICNFETELKGLVLSQ TYTCSPTIRILSQNMTQEQHAAACSKMGYEEGYFHQSLETGEQPVKDD HNTQLQVNIFDSSTDYGKYAGPIFDISTDNGGMYLEGDPSQPGNIPNFIA YEASYANADHFVWNLEHEYVHYLDGRFDLYGGFSHPTEKIVWWSEGI AEYVAQENDNQAALETILDGSTYTLSEIFETTYDGFDVDRIYRWGYLAV
RFMFENHKDDVNQMLVETRQGNWINYKATITQWANLYQSEFEQWQQT LVSNGAPNAVITANSKGKVGESITFSSENSTDPNGKIVSVLWDFGDGSTS TQTKPTHQYGSEGEYSVSLSVTDSEGLTATATHTWISALGGNDTLPQD CAVQSKVSGGRLTAGEPVCLANQQTIWLSVPAVNESSNLAITTGNGTG NLKLEYSNSGWPDDTNLHGWSDNIGNGECITLSNQSNYWGYVKVSGD FENAAIWDFDAQKCRQ (SEQ ID N0:1)
Кроме того, коллагеназа, продуцируемая Vibrio
alginolyticus, в соответствии со способом по настоящему изобретению также демонстрирует удельную активность, превосходную по сравнению с другими микробными коллагеназами, является более чистой и стабильной в водном растворе и может замораживаться без значительного повреждения.
По этой причине, другим объектом настоящего изобретения
является коллагеназа, полученная в соответствии с описанным
способом получения и очистки, для использования в
терапевтическом лечении патологий, отличающихся аккумуляцией
коллагена, или для лечения повреждений/дефектов кожи, которые
улучшаются благодаря уменьшению локальной аккумуляции
коллагена; так, например, разумно рассмотреть кожные язвы
различной природы, пролежни, ожоги различной степени,
ошпаривания и гипертрофические рубцы, целлюлит,
послеоперационные спайки и, по-прежнему, "плечелопаточный периартрит" или адгезивный капсулит, синдром Дюпюитрена, болезнь Пейрони.
Другим объектом настоящего изобретения являются фармацевтические композиции, содержащие коллагеназу, полученную в соответствии с описываемым способом получения и очистки, для использования в терапевтическом лечении расстройств, отличающихся аккумуляцией коллагена, или для лечения повреждений/дефектов кожи, которые улучшаются при уменьшении локальной аккумуляции коллагена; примеры представляют собой кожные язвы различной природы, пролежни, ожоги различной степени, ошпаривания и гипертрофические рубцы, целлюлит, послеоперационные спайки, адгезивный капсулит (плечелопаточный периартрит), синдром Дюпюитрена и болезнь Пейрони.
Коллагеназа, полученная, как описано в настоящем описании,
является также пригодной для применения при диссоциации тканей и при изоляции клеточных кластеров или отдельных клеток. Это применение используют, например, в процедуре трансплантации островковых клеток Лангерганса для изоляции островковых клеток от окружающей ткани поджелудочной железы и в целом при всех экспериментальных и терапевтических процедурах, требующих диссоциации ткани.
Коллагеназа, полученная с помощью способа, описанного ниже, отличается:
молекулярной массой 82 кДа;
удельной активностью в пределах между 1000 и 1800 нкатал/мг;
чистотой в пределах между 98,0 и 100%;
отсутствием микробных и белковых загрязнений, в частности, отсутствием эндотоксинов и ДНК;
стабильностью при рН в пределах между 5,5 и 11;
стабильностью в водном растворе при Т в пределах между 4° и 40°С, в частности, стабильностью при 37°С;
стабильностью в водном растворе при 4°С в течение 30 дней;
стабильностью в водном растворе при Т в пределах между -20°С и -80°С в течение 24-48 месяцев;
лиофилизируемостью с получением стабильного порошка, полученного сушкой вымораживанием.
Она предпочтительно также отличается
N-конечной последовательностью: H2N-Thr-Ala-Cys-Asp-Leu-Glu-Ala-Leu-Val-Thr-Glu-Ser-Ser-Asn-Gln (SEQ ID N0:3);
ингибированием солями Ад и Си и хелатирующим агентом EDTA;
стабильностью при хранении при температурах в пределах между -20 и -80°С, то есть в замороженной форме, без значительной потери ферментативной активности (5-15%). Способ получения и очистки коллагеназы в соответствии с настоящим изобретением включает следующие стадии:
Стадия А: Инокуляция Vibrio alginolyticus chemovar. Iophagus в колбе Эрленмейера и ферментация культурного бульона не-бычьего животного происхождения;
Стадия В: Осветление ферментированного бульона,
полученного таким образом с помощью ультрафильтрации в тангенциальном потоке (TFF1) с помощью кассет с номинальным отсечением по молекулярной массе (MWCO) 100-500 кДа, предпочтительно, 300 кДа;
Стадия С: Диализ и концентрирование осветленной среды, полученной на Стадии В, с помощью ультрафильтрации в тангенциальном потоке (TFF2) с помощью кассет с MWCO 5-30 кДа, предпочтительно, с MWCO 10 кДа;
Стадия D: Очистка раствора, содержащего коллагеназу, полученного на Стадии С, с помощью анионообменной смолы, несущей слабо основные группы, при рН в пределах между 6,9 и 7,4, предпочтительно, при рН 7,1;
Стадия Е: Диализ и концентрирование собранных фракций, которые имеют коллагенолитическую активность, полученных со стадии D, с помощью ультрафильтрации в тангенциальном потоке (TFF3) с помощью кассет с MWCO 10-50 кДа, предпочтительно, с MWCO 3 0 кДа;
Стадия F: Очистка раствора, полученного таким образом, с помощью анионообменной смолы, несущей сильно основные группы, при рН в пределах между 6,9 и 7,4, предпочтительно, при рН 7,1;
Стадия G: Диафильтрация и концентрирование фракций с коллагенолитической активностью ^95%, полученных со стадии F, с помощью ультрафильтрации в тангенциальном потоке (TFF4) с помощью кассет с MWCO 10-50 кДа, предпочтительно, с MWCO 30 кДа;
Стадия Н: Фильтрование раствора, содержащего коллагеназу, полученную таким образом, через 0,2 мкм абсолютный фильтр и хранение при температуре в пределах между -2 0° и -80°С.
Исследование с помощью материалов и методов, описанных в разделе "Методы исследования", ниже, осуществляют в конце каждой стадии.
Стадия А: представляет собой загрузочный способ ферментации; инокулум приготавливают в колбе Эрленмейера, содержащей культурный бульон, сформированный с помощью пептона не-бычьего животного происхождения, например, свиного происхождения, или смеси пептонов не-бычьего животного и
растительного происхождения, NaCl, СаС1г и TRIS (трис-гидроксиметиламинометан), при рН в пределах между 6,9 и 7,4, предпочтительно, при рН 7,1. Когда оптическая плотность, измеряемая при 600 нм (СШбоопт) г достигает значения в пределах между 1 и 4, инокулум является готовым для переноса в ферментер.
Среда, используемая для ферментации, является такой же, как используют для приготовления инокулума, с добавлением малого количества противовспенивателя для предотвращения образования пены из-за аэрации и перемешивания.
Одна ферментация длится в течение 14-20 часов, обычно 16 часов. В течение ферментации, отбирают образцы с помощью
СТерИЛЬНОЙ Процедуры ДЛЯ Проверки ЧИСТОТЫ, OD600nm,
ферментативной активности и рН.
Когда ферментативная активность составляет > 25000 нкатал/литр, ферментацию прекращают и добавляют СаС1г для стабилизации фермента. Температуру понижают приблизительно до 8°С, и смесь оставляют при перемешивании.
Осуществляют следующие контрольные исследования на растворе, полученном на стадии A: OD60onm; рН; ферментативная активность; концентрация белка; SDS-PAGE.
Ферментативный бульон, получаемый со стадии А, содержит, в дополнение к коллагеназе, представляющей интерес, другие протеазы, продуцируемые бактериями во время ферментации (в основном серинпротеазу), белковые агрегаты с высокой молекулярной массой и остатки среды.
Стадия В: ферментативный бульон, получаемый со стадии А, осветляют с помощью ультрафильтрации в тангенциальном потоке (TFF 1) с помощью кассет с MWCO 100-500 кДа, предпочтительно, 300 кДа; это устраняет микробные клетки и белковые агрегаты с высокой молекулярной массой.
Осуществляют следующие контрольные исследования на растворе, полученном на стадии В: рН; ферментативная активность; концентрация белка; SDS-PAGE; анализ с использованием казеиназы.
Стадия С: осветленную среду, полученную со стадии В,
концентрируют и диализируют посредством ультрафильтрации с помощью кассет с MWCO 5-30 кДа, предпочтительно с MWCO 10 кДа, приблизительно 15-25 раз. Раствор, полученный на стадии С, как правило, демонстрирует ферментативная активность 500-700 нкатал/мл, и является стабильным в течение 12 месяцев при -20°С. Целью фильтрации в тангенциальном потоке с помощью кассет с MWCO 5-30 кДа является значительное уменьшение объема и замена культурной среды на буфер из 25 мМ TRIS-HC1, 10 мМ СаС1г, рН 7,1, который стабилизирует коллагеназу и является пригодным для следующего далее способа очистки.
Осуществляют следующие контрольные исследования на растворе, полученном на стадии С: рН; ферментативная активность; концентрация белка; SDS-PAGE.
Стадия D: раствор, содержащий коллагеназу, полученную со стадии С, подвергается первой хроматографической очистке с помощью анионообменной смолы, несущей диэтиламиноалкильные группы, предпочтительно, диэтиламиноэтильные, такой как DE-52 (диэтиламиноэтил целлюлоза DEAE, Whatman). Эти смолы несут слабо основные группы и по этой причине имеют степень ионизации, зависимую от рН, в узком диапазоне рН между 6,9 и 7,4, предпочтительно при рН 7,1.
Затем раствор, содержащий коллагеназу, полученную со стадии С, загружают в колонку (Pall Chromatography Column Resolute Mod. 400-V-EP7040), набитую смолой DE-52. Осуществление хроматографии отслеживают с помощью детектора УФ-видимого света на 280 нм.
Перед загрузкой колонки, ее уравновешивают с помощью такого же буфера, называемого ниже "уравновешивающий буфер" (25 мМ TRIS-HC1, 10 мМ СаС12, рН 7,1), в котором коллагеназа диализируется в течение стадии С.
После загрузки смолу со связанной коллагеназой элюируют с помощью указанного выше уравновешивающего буфера для удаления белков, не связанных со смолой. Вторую промывку с помощью буфера с более высокой электропроводностью, называемого ниже "промывочный буфер" (300 мМ TRIS-HC1 и 10 мМ СаС12 при рН 7,1), осуществляют для удаления примесей с низкой молекулярной
массой. Коллагеназу, связанную со смолой, элюируют с помощью дальнейшего увеличения электропроводности с помощью третьего буфера, называющегося "элюирующий буфер" (300 мМ TRIS-HC1, 700 мМ NaCl и 10 мМ СаС12 при рН 7,1).
Стадия Е: фракции, собранные во время элюирования, которые демонстрируют коллагенолитическую активность и демонстрируют хорошую чистоту при SDS-PAGE, объединяют и переносят в систему ультрафильтрации с помощью кассет с MWCO 10-50 кДа, предпочтительно, 30 кДа, для концентрирования и диализа в буфере, который стабилизирует коллагеназу и является пригодным для следующего далее способа очистки.
Осуществляют следующие контрольные исследования на растворе, полученном на стадии Е: рН; ферментативная активность; концентрация белка; SDS-PAGE; анализ с использованием казеиназы.
Стадия F: раствор, получаемый со стадии Е, проходит на вторую стадию очистки с помощью анионообменной хроматографии с использованием смолы, несущей сильно основные обменные группы, образованные с помощью четвертичного аммония, такой как Source(tm)15Q (GE Healthcare). Осуществление хроматографии отслеживают с помощью детектора УФ-видимого света на 280 нм.
Перед загрузкой, колонку (Millipore GS 70-550), набитую смолой Source(tm)15Q, уравновешивают с помощью такого же буфера, в котором диализируют коллагеназу в течение стадии Е (уравновешивающий буфер).
Раствор, содержащий коллагеназу, полученную со стадии Е, загружают в колонку, и смолу со связанной коллагеназой элюируют с помощью уравновешивающего буфера для удаления несвязанных белков. Коллагеназу, связанную со смолой, элюируют посредством дальнейшего увеличения электропроводности с помощью второго буфера (элюирующий буфер 2-300 мМ TRIS-HC1 и 10 мМ СаС12 при рН 7,1) .
Стадия G: фракции, собранные во время элюирования, которые демонстрируют коллагенолитическую активность и демонстрируют чистоту > 95% при SDS-PAGE, объединяют и переносят в систему ультрафильтрации с помощью кассет с MWCO 10-50 кДа,
предпочтительно, 30 кДа, для концентрирования и диализа в буфере, который стабилизирует коллагеназу.
Осуществляют следующие контрольные исследования на растворе, полученном на Стадии G: рН; ферментативная активность; концентрация белка; SDS-PAGE.
Стадия Н: раствор коллагеназы, получаемый со стадии G, разбавляют в стабилизирующем буфере и фильтруют через 0,2 мкм абсолютный фильтр. Стерильный раствор, полученный таким образом, представляет собой готовый продукт способа очистки, и его анализируют на следующие характеристики:
- концентрация белка
- ферментативная активность
- рН
- анализ с использованием казеиназы
- чистота согласно SDS
- анализ димеров и высокомолекулярных соединений с помощью UPLC (сверхэффективной жидкостной хроматографии) SEC (эксклюзионной хроматографии)
- эндотоксины
- исследования стерильности Методы анализа
Спектрофотометрическое определение ферментативной
активности коллагеназы (Wunsch, Е., & Heidrich, Н. G., модифицированный метод)
Настоящий способ позволяет определить активность
коллагеназы, присутствующей в водных растворах. Активность
выражается в каталах, определяемых как количество фермента,
который катализирует преобразование 1 моль субстрата за 1 сек
при условиях, указанных для метода. Количество фермента,
который катализирует преобразование субстрата за заданное время
при 37°С и рН 7,1, по отношению к количеству анализируемого
раствора, выражается в нкатал/мл. Принцип способа основан на
реакции между коллагеназой и синтетическим субстратом PZ-L-
пролил-Ъ-лейцил-глицил-Ъ-пролил-О-аргинином (где PZ=4-
фенилазобензилоксикарбонил), специфичным по отношению к коллагеназе. После взаимодействия с коллагеназой синтетический
субстрат расщепляется на 2 фрагмента, PZ-L-пролил-Ъ-лейцил и глицил-Ъ-пролил-Б-аргинин. Второй фрагмент является бесцветным, в то время как первый представляет собой хромофор и может определяться спектрофотометрически после экстракции с помощью органического раствора этилацетата, подкисленного лимонной кислотой. Коэффициент поглощения фрагмента на 32 0 нм пропорционален ферментативной активности.
Для осуществления ферментативного анализа необходимо приготовить последовательные разбавления образца, с тем, чтобы получить концентрацию фермента, которая попадает в диапазон линейности метода.
Образец, который должен анализироваться, разбавляют в буфере 25 мМ Tris, 10 мМ СаС1г, рН 7,1; 0,5 мл этого буферного раствора взаимодействуют при 37°С в течение 15 мин с 2 мл 1,23 мМ раствора синтетического субстрата. По окончании ферментативной реакции, 0,5 мл реакционной смеси экстрагируют с помощью органической фазы со смесью, 5:1, этилацетата и 0,5% лимонной кислоты, рН 3,5. Органическую фазу удаляют и дегидратируют посредством добавления 300 мг безводного сульфата натрия. Дегидрированную органическую фазу анализируют спектрофотометрически на 32 0 нм в сравнении с этилацетатом. Результаты ферментативной активности, выраженные в нкатал/мл, вычисляют с помощью следующей формулы:
Активность, нкатал/мл=
[ (Abs32o o6pa34a-Abs32o контроля) хСт . конц. (мкмоль/мл) / (Abs32o CT.-Abs32o контроля) ] х (50 хЮОО/900) xfd
1000=коэффициент преобразования из мкмоль в нмоль 900=секунд в 15 минутах
Fd=кoэффициeнт преобразования для начального разбавления раствора коллагеназы
50=коэффициент преобразования для разбавления образца (0,5 мл и разбавляют до 2,5 мл, 0,5 мл и разбавляют до 5 мл)
Ст.конц. (мкмоль/мл)=0,02 = 0, 4 мл 250-мкМ раствора, разбавленного до 5 мл.
Контроль получают с помощью такой же ферментативной реакции как для коллагеназа, где раствор, содержащий фермент,
заменен эталонным буфером (25 мМ Tris, 10 мМ СаС1г, рН 7,1) .
Стандарт представляет собой 0,2504-мМ раствора реакционного фрагмента PZ-L-пролил-Ь-лейцина в этилацетате;
0. 4 мл этого раствора добавляют в раствор, состоящий из
4.6 мл этилацетата и 1 мл 0,5% лимонной кислоты, рН 3,5.
Органическую фазу удаляют, и дегидратируют посредством
добавления 300 мг безводного сульфата натрия. Дегидрированную
органическую фазу анализируют спектрофотометрически при 32 0 нм
в сравнении с этилацетатом.
Определение концентрации белка с помощью метода Лоури Концентрацию белка для растворов, содержащих коллагеназу,
определяют с помощью метода Лоури в соответствии со следующими
ссылками:
1. European Pharmacopoeia 5,0, Total Protein, Chapter 2 • 5 • 3 3 j
2. Lowry, O.H. et al., 1951, "Protein measurement with the Folin phenol reagent ", J. Biol. Chem., 193, 265-275.
Эксклюзионная хроматография на колонке для UPLC
Анализ с помощью эксклюзионной хроматографии на колонке для UPLC используют для определения димеров и молекул с высокой молекулярной массой (определенных как примеси) и/или продуктов деградации коллагеназы. Используемый инструмент представляет собой Acquity UPLC H-Class с детектором PDA еА, снабженный колонкой Acquity UPLC ВЕН 2 00 SEC. Анализ осуществляют в изократическом режиме с использованием фосфатного буфера, рН 6,4-6,7, приготовленного следующим образом: ЫагРО,}, 8,9 г/л, NaH2P04, 6,9 г/л, и NaCl, 8,76 г/л. Буфер фильтруют через 0,2 мкм абсолютные фильтры перед использованием. 1,5-4 мкг белка инжектируют в объем 5 мкл для каждого исследования.
Электрофорез SDS-PAGE
Электрофоретический анализ на 10% полиакриламидном геле в присутствии додецилсульфата натрия (SDS) осуществляют в соответствии с методом Леммли (Laemmli, U. К., 1970, "Cleavage of structural proteins during the assembly of head of the bacteriophage T4", Nature, 227, 680-685).
Определение казеиназы
Определение казеиназы используют в качестве метода анализа неспецифичных протеаз, присутствующих в качестве примесей в растворе коллагеназы. Метод анализа осуществляют в соответствии с Anson, M.L. (1938) J. Gen. Physiol. 22, 79-89, и Folin, О. и Ciocalteu, V. (1927) J. Biol. Chem. 73, 627-650. Казеиназу определяют с использованием казеина в качестве субстрата. Реакция может схематически иллюстрироваться следующим образом:
Казеин + Н20-ПР0ТЕАЗА > Аминокислоты
Количество тирозина, образующегося в реакции, определяют колориметрически посредством реакции с реагентом Фолина-Чокальтеу, который имеет свойство окисления тирозина в щелочной окружающей среде таким образом, что он проявляет голубой цвет. Вкратце, 1 мл раствора, который должен анализироваться, добавляют к 5 мл 0,65% (масс/объем) раствора казеина и оставляют взаимодействовать в течение 30 минут при 37°С. По окончании инкубирования, добавляют 0,5 мл трихлоруксусной кислоты (ТСА), и образец фильтруют через 0,45-мкм фильтры 2 минуты. Фильтрат собирают; добавляют 5 мл 0,5 М ЫагСОз и 1 мл 0,5 н реагента Фолина-Чокальтеу, и смесь оставляют для взаимодействия в течение 30 минут при 37°С. По окончании реакции образец еще раз фильтруют через 0,45 мкм фильтры, и фильтрат анализируют с помощью спектрофотометра, измеряя коэффициент поглощения на длине волны 6 60 нм. В это же время контроль и калибровочную линию получают с помощью раствора 1,1 мМ L-тирозина в качестве стандарта.
Результаты вычисляют с помощью следующей формулы:
ЕДИНИЦа/мЛ= [ [ ( О . D . образца- О . D . контроля ) ~С] /т] X
10x6,5x8xfd/(1x2)
с = известный член
М = угловой коэффициент
10 = коэффициент преобразования из 30 минут в 5 часов
6,5 = общий объем в мл стоп-раствора
8 = общий объем колориметрического раствора
1 = мл образца коллагеназы
2 = мл образца, используемого для проявления цвета fd = коэффициент разбавления Измерение оптической плотности OD6oonm
Этот метод делает возможным оценку роста клеток в течение различных стадий способа получения, от 5-литровой колбы Эрленмейера до 1000-литрового биореактора. Для измерения СШбоопт отбирают 1 мл суспензии клеток и центрифугируют при относительном центробежном ускорении 12000 g в течение 5 мин, супернатант удаляют, и клетки суспендируют повторно в 1 мл дистиллированной НгО, после чего регистрируют коэффициент поглощения на 60 0 нм.
Анализ эндотоксинов
Анализ эндотоксинов готового раствора коллагеназы осуществляют, как описано в European Pharmacopoeia, Endotoxin Test, Chapter 2.6.14.
Определение ферментативной активности коллагеназы с помощью UPLC
Настоящий метод делает возможным количественное определение активности коллагеназы, посредством анализа с помощью UPLC. Метод основан на количественном определении фрагмента, образующегося при ферментативной реакции (в соответствии с методом Вюнша), по сравнению с внешним стандартом.
Количество фермента, который катализирует преобразование субстрата за заданное время при 37°С и рН 7,1, по отношению к количеству анализируемого раствора, выражают в нкатал/мл. Активность выражается в каталах, определяется как количество фермента, которое катализирует преобразование 1 моль субстрата за 1 сек при условиях, указанных в методе.
Диапазон использования метода в линейных условиях простирается приблизительно до 1,2 нкатал/мл, как максимальная активность коллагеназы в растворе, который может анализироваться в соответствии с описанной методологией, без необходимости в осуществлении "разбавлений".
Водный раствор коллагеназы взаимодействует с синтетическим
субстратом Рг-Ь-пролил-Ь-лейцил-глицил-Ь-пролил-Б-аргинином
(где Рг=4-фенилазобензилоксикарбонил) . Два фрагмента
высвобождаются при контролируемых условиях (рН, температура, время): PZ-L-пролил-Ь-лейцин; глицил-Ь-пролил-Б-аргинин. Второй фрагмент определяют с помощью UPLC.
Рабочие параметры системы UPLC представляют собой:
скорость потока: 0,919 мл/мин
продолжительность анализа: 3 минуты
длина волны: 32 0 нм
инжектируемый объем: 1,4 мкл
температура колонки: 25°С
Время (минуты)
Лимонная кислота 0,5% масс/объем рН 3,5
Ацетонитрил
1, 17
0,34
1, 13
При этих условиях субстрат элюируется приблизительно через 0,2 5 минуты, а фрагмент приблизительно через 0,4 4 минуты
Определение ферментативной активности состоит из следующих стадий:
I. Приготовление буферного раствора из 25 мМ TRIS-HC1, 10
мМ СаС12, рН 7,1 (Реагент А).
II. Приготовление 0,5% раствора лимонной кислоты (Реагент
В) .
III. Приготовление 1,23 мМ раствора субстрата (Реагент С).
IV. Приготовление раствора Рг-Ь-пролил-Ь-лейцина, 200 мкМ в ацетонитриле (реагент Е).
V. Приготовление раствора коллагеназы, который должен анализироваться (раствор D) . Ферментативный раствор разбавляют в мерной колбе буферным раствором (Реагент А) , с получением раствора с активностью меньше чем 1,2 нкатал/мл.
VI. Ферментативная реакция. 2 мл реагента Си 0,5 мл раствора D вводят из пипетки в пробирку для исследований с крышкой на резьбе с использованием стеклянной пипетки. Смесь оставляют взаимодействовать в течение 15 мин при 37 °С на
III.
термостатической бане. По окончании реакции, это называют раствором Y. "Контроль" W приготавливают параллельно следующим образом: 2 мл реагента С и 0,5 мл буферного раствора (реагент А) . Смесь оставляют для взаимодействия в течение 15 мин при 37°С на термостатической бане.
VII. Образцы приготавливают посредством отбора 0,5 мл
раствора Y и введения их в 10 мл колбу, содержащую 2,0 мл 0,5%
лимонной кислоты, и дополняют до объема колбы ацетонитрилом.
VIII. Эталонный раствор приготавливают посредством
введения 0,5 мл контроля W, 2,0 мл лимонной кислоты и 1,5 мл
реагента Е в 10 мл колбу и дополнения до объема колбы
ацетонитрилом.
IX. Инжектируют 1,4 мкл эталонного раствора, а затем 1,4
мкл раствора, который должен анализироваться.
Результаты для ферментативной активности, выраженные как в нкатал/мл, вычисляют с помощью следующей формулы:
Активность, нкатал/мл=[(площадь образцахстандартная конц. (мкмоль/мл) )/стандартная площадь]*(1000х100/ 900) * fd
Вычисление ферментативной активности=наномоли в секунду на мл раствора (нкатал/мл), где:
1000 = коэффициент преобразования из микромоль в нмоль
100 = коэффициент преобразования для разбавления образца (0,5 мл до 2,5 мл, 0,5 мл до 10 мл)
90 0 = секунд в 15 минутах
Стандарт конц. (мкмоль/мл) = 0,03 (1,5 мл 200 мкМ раствора до 10 мл)
fd = коэффициент разбавления раствора коллагеназы, используемый для приготовления раствора D Характеризация белка
Определение N-конечной последовательности
N-конечную последовательность аминокислот коллагеназы, полученной от Vibrio alginolyticus chemovar. Iophagus, определяют с помощью метода деградации Эдмана с использованием жидкофазного автоматического секвенсора белков (ABI-Perkin Elmer mod. 411°) . Полученную последовательность проверяют с помощью биоинформатического анализа, запуская поиск BLAST
(Basic Logical Alignment Search Tool) последовательности no всей базе данных GenBank.
Анализ пептидного картирования
Для анализа карты пептидов, коллагеназу сначала восстанавливают с помощью DTT, алкилируют йодацетамидом, а затем обессоливают с использованием колонки PD10, элюируя 1% уксусной кислотой. Элюат подвергают воздействию триптического гидролиза, и фрагменты анализируют с помощью MALDI-MS. Глобальный спектр показан на (Фиг.1: анализ триптического переваривания); это позволяет авторам установить, что более 90% аминокислотной последовательности идентичны последовательности, помещенной в базу данных, соответствующей коллагеназе, продуцируемой Vibrio alginolyticus chemovar Iophagus.
Круговой дихроизм
Спектры кругового дихроизма в дальней УФ области (FUV-CD) регистрируют на спектрополяриметре Jasco, модель J-810, соединенном с баней, термостатируемой при 25°С. Спектры регистрируют с использованием 0,1-см кюветы при скорости 20 нм/мин, с откликом каждые 8 сек, для среднего из двух наборов данных. Каждый образец исследуют дважды.
Сигнал CD выражают как эллиптичность на средний остаток, вычисленную по формуле [0] =0obsxMRW/ (1 Ох 1 хс) , где 0obs представляет собой наблюдаемую эллиптичность в миллиградусах, "MRW" представляет собой среднюю молекулярную массу на остаток, "I" представляет собой оптический путь в см, и "с" представляет собой концентрацию в мг/мл. Образцы анализируют при концентрации 0,2 мг/мл.
Пример 1: Получение и очистка коллагеназы из Vibrio alginolyticus chemovar. Iophagus при 800-л ферментации.
(Фиг.2: Блок-схема способа получения и очистки)
Ферментация
Ферментация разделяется на 2 стадии: Стадия 1: Приготовление инокулума Стадия 2: Ферментация
Стадия 1: культурная среда представляет собой жидкость и состоит из раствора 1,21 г/л TRIS, 23,4 г/л NaCl, 0,29 г/л
СаС1г и 15 г/л пептона не-бычьего животного происхождения (свиного, или смеси с пептонами свиного и растительного происхождения), растворенного в дистиллированной воде (Millipore milliQ). рН среды доводят до 7,1 с помощью НС1, и стерилизуют ее в автоклаве при температуре > 122°С в течение 30 мин. 1,5-мл ампулу Vibrio alginolyticus chemovar. Iophagus (WCB-Working Cell Bank) инокулируют в 5-л колбе Эрленмейера, содержащей 2 л культурной среды, и инкубируют при 30 °С при перемешивании приблизительно при 150 об/мин, в течение времени, находящегося в пределах между 8 и 16 часов. Когда OD6oonm достигает значения в пределах между 1 и 4, инокулум становится готовым для переноса в ферментер.
Стадия 2: культурная среда является такой же, как
используют на Стадии 1, с добавлением 0,25 г/л
противовспенивателя Sigma 204, стерилизованной при > 122°С в
течение 3 0 мин в ферментере. 2 л инокулума переносят с помощью
стерильной процедуры в ферментер, содержащий 800 л
ферментационного бульона, и параметры ферментации
устанавливаются следующим образом:
- температура 30°С±1°С,
- перемешивание 50-150 об/мин,
- воздух 10-80 м3/час, н.у.
- растворенный кислород > 50%,
- рН 7,1±0,1,
- давление 0-0,4 бар.
Типичная ферментация длится в течение 14-20 часов, как правило, 16 часов, что соответствует наивысшему уровню ферментативной активности коллагеназы в течение всего процесса ферментации. Во время ферментации, образцы отбирают с помощью стерильной процедуры для проверки чистоты культуры, ОБбоопт и ферментативной активности. Активность коллагеназы определяют спектрофотометрически с помощью модифицированного метода Wunsch-Heidrich (Wunsch, Е. & Heidrich, H.G. 1963).
Когда ферментативная активность составляет > 25000 нкатал/литр, ферментацию прекращают, и добавляют СаС1г до конечной концентрации 1,47 г/л, для стабилизации фермента.
Температуру понижают приблизительно до 8°С, и смесь оставляют
при перемешивании в течение приблизительно 10-3 0 минут. Как
правило, ферментированный бульон имеет следующие
характеристики:
1) Ферментативная активность в пределах между 25000 и 50000 нкатал/литр
2) OD6oonm в пределах между 5 и 8
3) Отсутствие микробных загрязнений
Осветление: ультрафильтрация TFF1 с помощью кассет с MWCO 300 кДа (номинальное отсечение по молекулярной массе)
Ферментационный бульон, приблизительно 8 00 литров,
переносят в систему ультрафильтрации, содержащую Holder
Sartocon II (Sartorius), внутри которого находятся пять кассет
с MWCO 300 кДа (Code 3021467907E-SG), каждая - с площадью
фильтрации 0,5 м2. Фильтрационная мембрана изготовлена из
модифицированного полиэфирсульфона (PES), главная
характеристика которого представляет собой низкое сродство к белкам, делая возможным > 8 0% извлечения и осветления среды при малой потере коллагеназы.
Целью ультрафильтрации с помощью кассет для 300 кДа является удаление микробной массы из ферментационного бульона и удаление белковых агрегатов приблизительно до 32 0 кДа.
Диализ и концентрирование: ультрафильтрация TFF2 с помощью кассет с MWCO 10 кДа
После осветления среду концентрируют и диализируют в системе ультрафильтрации PALL Mod UF-A-P0971, внутри которой находятся шесть кассет с MWCO 10 кДа (Code 34293012R), каждая -с площадью фильтрации 0,5 м2. Фильтрационная мембрана изготовлена из модифицированного полиэфирсульфона (PES), главная характеристика которого представляет собой низкое сродство к белкам, что делает возможным > 8 0% извлечение. Ультрафильтрация с помощью кассет 10 кДа делает возможным уменьшение объема в 15-2 5 раз, удаление низкомолекулярных загрязнений и замену культурной среды буфером из 2 5 мМ TRIS, 10 мМ СаС1г, рН 7,1, который является пригодным для следующего далее процесса очистки. После ультрафильтрации, осуществляют
следующие анализы:
1) Ферментативная активность
2) Анализ белков
3) SDS-PAGE (Фиг.З: SDS-PAGE на стадиях ультрафильтрации с 300 кДа и 10 кДа)
Пояснение к Фиг.З
Полоса 1 широкодиапазонный SigmaMarker(tm)
Полоса 2 10-мкл ферментационный бульон
Полоса 3 2 0-мкл ферментационный бульон
Полоса 4 фильтрат, 10 мкл, TFF, 300 кДа
Полоса 5 фильтрат, 20 мкл, TFF, 300 кДа
Полоса б 2-мкл ретентат TFF 10 кДа
Полоса 7 5-мкл ретентат TFF 10 кДа
Полоса 8 1б-мкл ретентат TFF 10 кДа
Полоса 9 2 мкг коллагеназа FIDIA
Слабая анионная хроматография (Whatman DE-52)
Раствор, содержащий коллагеназу, полученный от процесса ультрафильтрации, представляет собой исходные материалы для первой очистки с помощью слабой анионообменной хроматографии с использованием смолы DE-52 (Whatman DEAE: диэтиламиноэтил целлюлоза).
Хроматографические анализы отслеживают с помощью детектора УФ-видимого света на 280 нм. Как правило, 10-25 литров раствора, содержащего коллагеназу при концентрации белка 0,81,2 г/л, загружают в колонку (Pall Chromatography Column Resolute Mod. 400-V-EP7040), набитую 10 кг смолы DE-52. Количество белков в целом, загружаемых в колонку, составляет 0,8-3 г/кг смолы. Смолу уравновешивают 10 объемами колонки (BV) 25 мМ TRIS-HC1 и 10 мМ СаС1г при рН 7,1, это называется ниже "уравновешивающим буфером".
После загрузки, смолу со связанной коллагеназой элюируют 2-4 BV, как правило, 2 BV уравновешивающего буфера для удаления белков, не связанных со смолой, и восстановления значений электропроводности до значений до загрузки образца.
Для удаления низкомолекулярных примесей, осуществляют дополнительное элюирование с помощью 3-5 BV, как правило, 4 BV
буфера, приготовленного следующим образом: 300 мМ TRIS-HC1 и 10 мМ СаС1г при рН 7,1 (промывочный буфер). Коллагеназу, связанную со смолой, элюируют посредством увеличения электропроводности с помощью 3-5 BV, как правило, 4 BV, третьего буфера со следующей композицией: 300 мМ TRIS-HC1, 700 мМ NC1 и 10 мМ СаС12 при рН 7,1 (элюирующий буфер).
Фракцию, собранную во время элюирования с помощью элюирующего буфера, подвергают анализу ферментативной активности и анализируют с помощью SDS-PAGE.
Типичный хроматографический профиль представляет три различных пика, как показано на Фиг.4 (типичная хроматограмма DE-52):
- первый (I) (пик, элюируемый с помощью уравновешивающего буфера) соответствует несвязанным белкам, он не демонстрирует ферментативной активности.
второй пик (II) соответствует элюированию с помощью промывочного буфера, он представляет коллагенолитическую активность, но не используется, поскольку присутствуют также многочисленные примеси.
третий пик (III) соответствует элюированию с помощью элюирующего буфера, и представляет собой пик с самой высокой активностью фермента и с самой высокой чистотой.
Как правило, пик, содержащий коллагеназу, имеет объем 1822 литра и анализируется относительно следующих характеристик:
1) Ферментативная активность
2) Анализ белков
3) SDS-PAGE (Фиг.5) Пояснение к Фиг.5
Полоса 1 5 мкл образца после TFF2 Полоса 2 2 0 мкл несвязанного белка Полоса 3 10 мкл фракции 1 пика I Полоса 4 10 мкл фракции 2 пика I Полоса 5 10 мкл фракции 1 пика II Полоса б 10 мкл фракции 2 пика II Полоса 7 10 мкл пика III
Диализ и концентрирование: ультрафильтрация TFF3 с помощью
кассет с MWCO 30 кДа
Фракцию, соответствующую третьему хроматографическому пику, концентрируют и диализируют в системе ультрафильтрации Cogent(tm) (Millipore), внутри которой находятся две кассеты с MWCO 30 k (Code 31158044R), каждая - с площадью фильтрации 0,1 м2. Фильтрационная мембрана изготовлена из полиэфирсульфона (PES), главной характеристикой которого является низкое сродство к белкам, делающее возможным извлечение > 95%. Ультрафильтрация с помощью кассет 3 0 кДа делает возможным уменьшение объема в З-б раз и замену элюирующего буфера DE-52 на буфер из 25 мМ TRIS, 10 мМ СаС1г, рН 7,1, который является пригодным для следующего далее процесса очистки. На ультрафильтрате осуществляют следующие виды контроля:
1) Ферментативная активность
2) Анализ белков
Сильно анионная хроматография (Source(tm) 15Q GE Healthcare)
Раствор коллагеназы, получаемый от TFF3, представляет собой исходные материалы для второй очистки с помощью сильной анионообменной хроматографии с использованием смолы Source(tm) 15Q
(GE Healthcare). Хроматографические анализы отслеживают с помощью детектора УФ-видимого света на 280 нм. Как правило, З-б литра раствора, содержащего коллагеназу при концентрации белка 0,8-1,2 мг/мл, загружают в колонку (Millipore GBP 70-550), набитую 100-200 мл смолы Source(tm)15Q; количество белков в целом, загруженное в колонку, соответствует количеству 24-36 мг/мл смолы. Перед загрузкой, смолу уравновешивают 2 объемами колонки
(BV) 10 мМ TRIS-HC1 и 10 мМ СаС12 при рН 7,1, это называется "уравновешивающий буфер".
После загрузки, смолу со связанной коллагеназой элюируют с помощью 5-7 BV уравновешивающего буфера для удаления несвязанных белков и восстановления электропроводности до начальных значений. Коллагеназа, связанная со смолой, элюируется с помощью 5-10 BV 300 мМ Tris-HCl и 10 мМ СаС1г при рН 7,1 (элюирующий буфер). Фракцию, содержащую коллагеназу, элюируют в виде одного пика, как правило, 1-2 литра, что можно увидеть на хроматограмме, показанной на Фиг.б (типичная
хроматограмма для Source(tm)15Q).
Фракцию, содержащую коллагеназу, собранную во время элюирования, подвергают следующим видам контроля:
1) Ферментативная активность
2) Анализ белков
3) SDS-PAGE (Фиг.7: SDS-PAGE фракций от Source(tm) 15Q) Пояснение к Фиг.7:
Полоса 1 концентрация несвязанного белка 2 0 мкл, 2ОХ Полоса 2 Фракция 1 10 мкл Полоса 3 Фракция 2 10 мкл Полоса 4 LMW
Диализ и концентрирование: ультрафильтрация TFF4 с помощью кассет с MWCO 30 кДа
Фракцию, содержащую коллагеназу, переносят в систему ультрафильтрации Cogent(tm) (Millipore), внутри которой находятся две кассеты с MWCO 3 0 кДа с мембраной из полиэфирсульфона (PES), каждая - с площадью фильтрации 0,1 м2. Эта стадия ультрафильтрации дает возможность для диализа и концентрирования образца по отношению к буферу из 25 мМ TRIS-НС1 и 10 мМ СаС12, рН 7,1.
Фильтрование и хранение
Раствор, полученный после TFF4, фильтруют через 0,2-мкм абсолютные фильтры из полиэфирсульфона (PES) для конечной стерилизации продукта. Конечный продукт хранят в специальных контейнерах при -20°С.
Полученный таким образом раствор коллагеназы анализируют
на следующие характеристики: концентрация белков;
ферментативная активность; рН; анализ неспецифичных протеаз; чистота согласно SDS-PAGE (Фиг.8: SDS-PAGE готового продукта); чистота согласно UPLC SEC (анализ димеров и высокомолекулярных частиц); исследование LAL для определения эндотоксинов (в соответствии с European Pharmacopoeia, продукт должен содержать не более 5 МЕ/кг/час).
Пояснение к Фиг.8:
Полоса 1 HMW
Полоса 2 Коллагеназа fidia 0,5 мкг/полоса
Полоса 3 Коллагеназа fidia 1 мкг/полоса Полоса 4 Коллагеназа fidia 2 мкг/полоса Конкретные характеристики приведены в Таблице, ниже.
Коллагеназа, полученная и очищенная в соответствии с настоящим изобретением, исследуется автором для проверки следующих характеристик, с результатами, приведенными ниже:
чистота: имеет чистоту в пределах между 98 и 100%;
не содержит микробных и белковых загрязнений (эндотоксинов, ДНК);
стабильна при рН в пределах между 5,5 и 11 (установлено с помощью ферментативного исследования)
стабильна в водном растворе, например, в содержащем 25 мМ TRIS-HC1, 10 мМ СаС12, рН 7,1, при Т в пределах между 4° и 40°С, в частности, стабильна при 37°С
стабильна в водном растворе при 4°С в течение 30 дней;
стабильна в водном растворе при Т в пределах между -20°С и -80°С в течение 24-48 месяцев
может быть высушена вымораживанием вместе с соответствующими наполнителями (описанными ниже) с получением стабильного лиофильного порошка.
Лиофилизат коллагеназы, который представляет собой другой предмет настоящего изобретения, приготавливают вместе с наполнителями, особенно пригодными для поддержания его стабильности, и предпочтительно может содержать:
- мальтозу: 95-96%, предпочтительно, 95,75%;
соли (такие как TRIS-HCl + CaCl2) : 1,0-1,5%, предпочтительно, 1,3%;
коллагеназу: 2,5-3,5%, предпочтительно, 2,95%, с получением порошка, полученного сушкой вымораживанием, с активностью фермента в пределах между 7-2 0 нкатал/мг порошка.
Количества, указанные выше, для лиофилизата коллагеназы представляют собой проценты массовые по отношению к общей массе лиофилизата.
Коллагеназа, полученная в соответствии со способом получения и очистки, является, следовательно, пригодной для получения фармацевтических композиций различных типов, и разработана, как сказано, для использования при лечении расстройств, отличающихся аккумуляцией коллагена или для лечебно-косметического лечения повреждений/дефектов кожи, которые улучшаются при уменьшении локальной аккумуляции коллагенов. Наиболее частые применения относятся к наружному и/или местному лечению ожогов различной степени, ошпаривания, пролежней, сосудистых язв и диабетических язв; в этих случаях, коллагеназа эффективно устраняет ожоговый струп, делая, таким образом, возможным активирование лежащих под ними клеток для целей процессов восстановления. Другие терапевтические применения относятся к целлюлиту, послеоперационным спайкам, гипертрофическим рубцам и келоидам; в этих ситуациях, аномальное продуцирование коллагена отрицательно влияет на обычный процесс восстановления, и они могут улучшаться при лизировании нерегулярно аккумулируемого коллагена.
Другие расстройства, которые могут лечиться с помощью коллагеназы, представляют собой адгезивный капсулит
(плечелопаточный периартрит), синдром Дюпюитрена и болезнь Пейрони.
Может потребоваться местное или системное применение, в частности, применение с помощью инъекций, в зависимости от расстройства.
Относительно местных применений, неожиданная стабильность в водном растворе фермента, описываемого в настоящем документе, делает возможным его приготовление в гидрофильных носителях; в частности, обнаружено, что коллагеназа может быть приготовлена вместе с конкретными полимерами, которые гидратируются при контакте с эксудатом из повреждения, на которое их помещают, с возникновением геля. В этой ситуации, фермент высвобождается постепенно и в более высоких количествах, чем получается с помощью обычных липофильных носителей, используемых в настоящее время, с получением лучшего терапевтического воздействия; количество ежедневных нанесений также может быть уменьшено, улучшая, таким образом, податливость пациента. Фармацевтическая форма для местного применения, предпочтительная в рамках настоящего изобретения, представляет собой пылевидный порошок, промышленное приготовление которого не требует никаких специальных процессов и который может легко измеряться в форме фармацевтического препарата, правильно осаждаться в пределах повреждения и храниться в течение длительных периодов времени. Используемый гидрофильный полимер должен быть способным поглощать текучую среду, внезапно выделяемую из раны, с образованием прилипающего материала геля. Указанный гель, очевидно, должен иметь характеристики вязкости, которые делают возможным его пребывание на поверхности раны; избыточно твердый гель имеет тенденцию к витрификации, в то время как избыточно жидкий гель соскальзывает с поверхности раны, унося при этом активный ингредиент. Кроме того, поскольку препарат должен быть стерильным, главное для выбранного полимера - поддерживать его реологические свойства после гидратирования, даже когда он предварительно стерилизуется с помощью обычных средств (обычно, гамма излучения). Для идентификации наиболее пригодного для использования полимера, автор осуществил ряд исследований
многочисленных полимеров (крахмала и его производных, альгинатов, производных целлюлозы, поливиниловых спиртов и их производных, смол и пектинов), как кратко описано в настоящем документе. В стеклянной чашке Петри диаметром 5 см, создают сплошную пленку солевого раствора толщиной 2,5 мм, на которую порошкообразный полимер, который должен исследоваться (приблизительно 1 г), распыляют из стального сита с отверстиями фиксированного размера. Дополнительную жидкость добавляют постольку, поскольку полимер, преобразованный в гель, способен ее поглощать, поддерживая такую вязкость, что он не стекает с чашки, когда ее удерживают вертикально. После оценки доли поглощения жидкости и прозрачности и консистентности полученного геля, принимается решение, что полимер, наиболее пригодный для целей настоящего изобретения, представляет собой гликолят кукурузного крахмала.
Гликолят кукурузного крахмала представляет собой мелкодисперсный белый, сыпучий, очень гигроскопичный порошок, используемый при производстве таблеток и капсул, благодаря его разрыхляющим свойствам, но никогда не используемый путем непосредственного нанесения. Гликолят кукурузного крахмала имеет рН в пределах между 5,5 и 7,5, то есть сходный с рН ткани, на которую его наносят, и набухает в воде с увеличением его объема вплоть до 300-кратного.
В дополнение к ферменту коллагеназе, пылевидный порошок может также содержать другой активный ингредиент, который стимулирует миграцию клеток, чтобы сделать возможной более быструю реэпителизацию поверхности раны, и по этой причине, более быстрое затягивание раны. Из разнообразных возможных агентов, гиалуроновая кислота является особенно пригодной для этих целей; она представляет собой гетерополисахарид, состоящий из чередующихся остатков D-глюкуроновой кислоты и N-ацетил-Б-глюкозамина. Она представляет собой прямоцепной полимер с молекулярной массой, находящейся в пределах между 50000 и 13х106 Да, в зависимости от источника, из которого ее получают, и от используемых методов приготовления. НА, используемая в настоящем изобретении, может быть получена из любого источника,
такого как экстракт из морских петушков (ЕР 138572 В1), ферментация (из Streptococcus) или биосинтез (из Bacillus), и имеет среднюю молекулярную массу в пределах между 400 и 3x106 Да, в частности, в пределах между 1x105 Да и 1хЮ6 Да, и еще более конкретно, в пределах между 200000 и 750000 Да. Предпочтительно, НА, используемая в настоящем документе для местного нанесения, имеет среднюю молекулярную массу (MW) в пределах между 130 и 230 кДа, предпочтительно, между 145 и 210 кДа, и еще более предпочтительно, между 160 и 200 кДа; последняя будет ниже называться НА со средним MW 2 00 кДа. НА со средней молекулярной массой в пределах между 200 и 1800 кДа, предпочтительно, в пределах между 500 и 1300 кДа, а еще более предпочтительно, в пределах между 750 и 1200 кДа, используется для применений для инъекций. Упоминания средней молекулярной массы относятся к средневзвешенной MW, вычисленной с помощью метода собственной вязкости (Terbojevich et al., Carbohydr Res, 1986, 363-377).
НА встречается в природе в перицеллюлярных гелях, в базовом веществе соединительной ткани позвоночных животных (у которых она является одним из главных компонентов) , в синовиальной жидкости суставов, в жидкой части стекловидного тела и пупочном канатике.
Продемонстрировано, что НА играет критическую роль в
процессе восстановления тканей, как с точки зрения структур
(при организации внеклеточного матрикса и регулировки его
гидратирования), так и в качестве вещества, которое стимулирует
широкий диапазон процессов, в которых она непосредственно и
опосредованно вовлечена (образование сгустков крови,
фагоцитарная активность, пролиферация фибробластов,
неоваскуляризация, реэпителизация, и тому подобное). (Weigel Р. et al., J Theoretical Biol, 1986:219-234; Abatangelo G. et al., J Surg Res, 1983, 35:410-416; Goa K. et al. , Drugs, 1994, 47:536-566). Роль НА в препаратах, описанных в настоящем документе, заключается не только в ускорении заживления ран, но прежде всего, в предотвращении повреждения коллагеназой, которая собирается на краях раны, живых здоровых клеток,
которые находятся там, предотвращая их миграцию в направлении областей, которым необходима регенерация. Кроме того, присутствие НА, которое также представляет собой полимер-поглотитель, способствует образованию геля на поверхности раны и улучшает высвобождение, а, следовательно, ферментативную активность коллагеназы, как уже продемонстрирована и как будет иллюстрироваться ниже.
Описанные препараты могут также включать агент, который облегчает проскальзывание порошков на стадии смешивания; вещества, которые используют чаще всего, включают коллоидный диоксид кремния, который необязательно может включаться в количествах, находящихся в пределах между 0,1 и 3%, предпочтительно, в пределах между 0,2 и 1%, как известно специалистам в данной области.
В рамках настоящего изобретения автор последовательно намерен предложить фармацевтические композиции для местного применения в форме пылевидного порошка, содержащие:
коллагеназу, полученную с помощью способа, описанного выше, в количестве эквивалентном активности в пределах между 2 и 8 нкатал/г готового продукта, предпочтительно, 5 нкатал/г готового продукта;
необязательно, НА со средневзвешенной молекулярной массой, находящейся в пределах между 130 и 230 кДа, предпочтительно, в пределах между 145 и 210 кДа, а еще более предпочтительно, в пределах между 160 и 200 кДа, в количестве, находящемся в пределах между 0,1 и 5%, предпочтительно, между 0,2 и 2%;
необязательно, коллоидный диоксид кремния в количестве в пределах между 0,1 и 3%, предпочтительно, между 0,2 и 1%;
гликолят кукурузного крахмала, в количестве, необходимом для завершения процентной композиции.
Количества, показанные выше для пылевидного порошка, представляют собой проценты массовые по отношению к общей массе композиции.
Некоторые примеры приготовления фармацевтических композиций, описанных выше, будут теперь описываться в качестве примера, но не ограничения.
Пример 2: приготовление пылевидного порошка, содержащего коллагеназу, гиалуроновую кислоту (НА) и гликолят кукурузного крахмала (Препарат 1).
Коллагеназу, в лиофильной форме, отмеривают таким образом,
что она соответствует активности 5 нкатал/г готового продукта.
Коллагеназа эквивалент 5 нкатал/г
НА со средним MW 2 00 кДа 0,2 г
гликолят кукурузного крахмала по потребности до 100 г
Примерно половину от количества гелеобразующего полимера взвешивают и вводят в контейнер; коллагеназу и НА, предварительно микронизированные и просеянные на 50 мкм сите, взвешивают и вводят в контейнер. Наконец, оставшееся количество гелеобразующего полимера взвешивают и вводят в контейнер. Приготовление осуществляют с помощью непосредственного смешивания порошков в полиэтиленовом флаконе в форме параллелепипеда, закрытом полиэтиленовой промежуточной крышкой и полипропиленовым колпачком на резьбе, с емкостью, достаточной для того, чтобы оставалось, по меньшей мере, 40-50% пустого пространства над смесью. Флакон, закрепленный на консоли V-образного смесителя в наклонном положении (под углом 45 градусов), вращается с наклоном вокруг своей малой оси при скорости 50 об/мин. Перемешивание осуществляют до тех пор, пока смесь не станет гомогенной.
Пример 3: приготовление пылевидного порошка, содержащего коллагеназу, гиалуроновую кислоту (НА), гликолят кукурузного крахмала и глидант (Препарат 2).
Коллагеназу, в лиофильной форме, отмеривают таким образом, что она соответствует активности 5 нкатал/г готового продукта.
Коллагеназа эквивалент 5 нкатал/г
НА со средним MW 2 00 кДа 0,2 г
Коллоидный диоксид кремния 0,2 г
Гликолят кукурузного крахмала по потребности до 100 г
Примерно половину от количества гелеобразующего полимера взвешивают и вводят в контейнер; коллагеназу и НА, предварительно микронизированные и просеянные на 50 мкм сите, взвешивают и вводят в контейнер. Наконец, оставшееся количество
гелеобразующего полимера и глидант взвешивают и вводят в
контейнер. Приготовление осуществляют с помощью
непосредственного смешивания порошков в полиэтиленовом флаконе в форме параллелепипеда, закрытого полиэтиленовой промежуточной крышкой и полипропиленовым колпачком на резьбе, с емкостью, достаточной для того, чтобы оставалось, по меньшей мере, 40-50% пустого пространства над смесью. Флакон, закрепленный на консоли V-образного смесителя в наклонном положении (под углом 4 5 градусов) , вращается с наклоном вокруг его малой оси при скорости 50 об/мин. Перемешивание осуществляют до тех пор, пока смесь не станет гомогенной.
Пример 4: приготовление пылевидного порошка содержащего коллагеназу, гиалуроновую кислоту (НА), гликолят кукурузного крахмала и глидант (Препарат 3).
Коллагеназу, в лиофильной форме, отмеривают таким образом, что она соответствует активности 5 нкатал/г готового продукта.
Коллагеназа эквивалент 5 нкатал/г
НА со средним MW 2 00 кДа 0,2 г
Коллоидный диоксид кремния 1 г
гликолят кукурузного крахмала по потребности до 100 г Относительно приготовления, см. Пример 2.
Пример 5: приготовление пылевидного порошка, содержащего коллагеназу и гликолят кукурузного крахмала (Препарат 4).
Коллагеназу, в лиофильной форме, отмеривают таким образом,
что она соответствует активности 5 нкатал/г готового продукта.
Коллагеназа эквивалент 5 нкатал/г
Гликолят кукурузного крахмала по потребности до 100 г
Приблизительно половину от количества гелеобразующего полимера взвешивают и вводят в контейнер; коллагеназу взвешивают и вводят в контейнер. Наконец, оставшееся количество гелеобразующего полимера взвешивают и вводят в контейнер. Приготовление осуществляют с помощью непосредственного смешивания порошков в полиэтиленовом флаконе в форме параллелепипеда, закрытом полиэтиленовой промежуточной крышкой и полипропиленовым колпачком на резьбе, с емкостью, достаточной для того, чтобы оставалось, по меньшей мере, 40-50% пустого
пространства над смесью. Флакон, закрепленный на консоли V-образного смесителя в наклонном положении (под углом 45 градусов), вращается наклонно вокруг его малой оси при скорости 50 об/мин. Перемешивание осуществляют до тех пор, пока смесь не станет гомогенной.
Пример 6: приготовление пылевидного порошка, содержащего коллагеназу, гликолят кукурузного крахмала и глидант (Препарат
5) .
Коллагеназу, в лиофильной форме, отмеривают таким образом,
что она соответствует активности 5 нкатал/г готового продукта.
Коллагеназа эквивалент 5 нкатал/г
Коллоидный диоксид кремния 0,2 г
гликолят кукурузного крахмала по потребности до 100 г
Примерно половину от количества гелеобразующего полимера
взвешивают и вводят в контейнер; коллагеназу взвешивают и
вводят в контейнер. Наконец, оставшееся количество
гелеобразующего полимера и глидант взвешивают и вводят в
контейнер. Приготовление осуществляют с помощью
непосредственного смешивания порошков в полиэтиленовом флаконе в форме параллелепипеда, закрытом полиэтиленовой промежуточной крышкой и полипропиленовым колпачком на резьбе, с емкостью, достаточной для того, чтобы оставалось, по меньшей мере, 40-50% пустого пространства над смесью. Флакон, закрепленный на консоли V-образного смесителя в наклонном положении (под углом 4 5 градусов), вращается наклонно вокруг его малой оси при скорости 50 об/мин. Перемешивание осуществляют до тех пор, пока смесь не станет гомогенной.
Пример 7: приготовление пылевидного порошка, содержащего коллагеназу, гликолят кукурузного крахмала и глидант (Препарат
6) .
Коллагеназу, в лиофильной форме, отмеривают таким образом,
что она соответствует активности 5 нкатал/г готового продукта.
Коллагеназа эквивалент 5 нкатал/г
Коллоидный диоксид кремния 1 г
Гликолят кукурузного крахмала по потребности до 100 г
Относительно приготовления, см. Пример 5.
Как сказано, реология указанных пылевидных порошков до и после стерилизации, и их рабочие характеристики с точки зрения высвобождения коллагеназы, оценивают после гидратирования. Последнее исследование осуществляют посредством сравнения со стандартным продуктом (Bionect Start(r)), содержащим коллагеназу в липофильном носителе.
Реологическая оценка до и после стерилизации
Образцы для исследований приготавливают в соответствии с Примерами 1 и 3, которые представляют собой наиболее сложные препараты из тех, которые описаны.
1 г каждого из нестерильных Препарата 1 и Препарата 3 гидратируют с помощью 7 мл солевого раствора; такую же процедуру осуществляют на 1 г этих же препаратов, предварительно стерилизованных с помощью гамма излучения (доза 25 кГрэй). Гели, полученные таким образом, анализируют для оценки вязких модулей G' и G" с помощью вискозиметра Н7ААКЕ модели Mars II, снабженного приспособлением для измерения с конусом и пластинкой с диаметром 60 мм, под углом 1°; измерение осуществляют при 20±0,5°С при контроле вращения с постепенным увеличением скорости от 0 до 5 сек-1 за 8 минут; интерполяцию осуществляют при 1,0 сек-1. Результаты показаны на графике 1 (реологическая оценка до и после стерилизации): каждый препарат четко сохраняет практически неизменными свои реологические свойства, даже после стерилизации. Препарат 1, без глиданта, имеет несколько более высокие модули G' и G", но не до статистически значимой степени. Это означает, что глидант не оказывает воздействия на реологию, и используется ли он или нет, зависит, следовательно, от рабочих условий. Однако необходимо подчеркнуть, что выбранный полимер сохраняет характеристики прилипания и вязкости, идентифицированные в предыдущих исследованиях, которые необходимы для оптимального высвобождения фермента, содержащегося в препарате.
Оценка коллагенолитической активности
Эти исследования исследуют поведение препаратов с гиалуроновой кислотой и без нее, по сравнению с коммерческим
эталонным продуктом (Bionect Start(r)), содержащим коллагеназу в липофильном носителе (мази) и гиалуроновую кислоту.
Поскольку глидант не оказывает воздействия на
ферментативную активность коллагеназы, решено исследовать
Препараты 1 (с НА) и 4 (без НА) . Деградирующая ферментативная
активность определяется с помощью количественного анализа на
стандартном коммерческом субстрате (Collagenase Chromophor
substrate kit - Fluka 27669) . Способ модифицируют
соответствующим образом, чтобы сделать возможным исследование
порошкообразных препаратов исследуемых образцов и моделирование
условий, для которых указанные препараты будут экспонироваться
после нанесения in vivo. Анализ основан на гидролизе
конкретного субстрата коллагеназы: 4-
фенилазобензилоксикарбонил-Pro-Leu-Gly-Pro-D-Arg-OH (компонент А) . Указанный субстрат деградирует до Pz-Pro-Leu-OH (желто-оранжевый фрагмент) и H-Gly-Pro-D-Arg-OH в присутствии фермента коллагеназы. Пептид Pz-Pro-Leu-OH растворим в органических растворителях, и экстрагируется с помощью этилацетата из смеси, подкисленной лимонной кислотой. Избыток недеградированного субстрата остается в подкисленной водной фазе. Pz-Pro-Leu-OH в этилацетате определяется количественно спектрофотометрически с помощью регистрации на 32 0 нм.
Материалы и методы
Collagenase Chromophor substrate kit - Fluka 27669
Препарат 1
Препарат 4
Bionect Start(r)
Солевой раствор
TRIS Буфер
2 5 мМ лимонной кислоты
Этилацетат
Безводный ЫагЭ04.
Осуществляют 3 исследования для каждого препарата.
Стадия 1. 1,1 мл раствора субстрата при концентрация 2,6 мМ помещают в 1,5-мл пробирку Corning Costar SpinX (Sigma, Фиг.9A), как описано в коммерческом методе анализа Fluka. 100
мг каждого порошкообразного препарата коллагеназы (Препараты 1 и 4), которые гидратируют с помощью солевого раствора с массой равной 4 массам порошка, вставляют в контейнер, несущий мембрану с пористостью 0,22 мкм (Фиг.9В). Контейнер герметично закрывают с помощью соответствующей крышки, чтобы предотвратить набухание порошка из-за дальнейшего поглощения жидкости во время эксперимента. Контейнер помещают в пробирку с раствором субстрата (Фиг.9С). Пробирку герметично закрывают и переворачивают, чтобы сделать возможным контакт между раствором субстрата и мембраной контейнера. Коллагеназа и субстрат могут проходить через мембрану свободно, в то время как порошки остаются в контейнере. Препарат в целом инкубируют при 32°С. Контейнеры заменяют, как указано в протоколе, для моделирования ежедневного нанесения, нанесения каждые два дня и однократного нанесения.
Для Bionect Start(r), который представляет собой мазь, Стадию 1 модифицируют, как описано ниже:
0,6 мл раствора субстрата при концентрации 1,3 мМ помещают в 1,5-мл пробирки Эппендорф (Фиг.10: пробирка Эппендорф для модифицированной стадии 1), как описано в коммерческом методе анализа Fluka. Колпачки пробирок Эппендорф заполняют приблизительно 250 мг Bionect Start(r), который приводят в контакт с раствором субстрата и инкубируют при 32°С. Колпачки заменяют, как указано в протоколе, чтобы моделировать ежедневное нанесение, нанесение каждые два дня и однократное нанесение.
Стадия 2: Когда заканчивается заданный период контакта, 125 мкл смеси субстрата, обработанной, как описано на Стадии 1, отбирают в каждый фиксированный момент времени и помещают в 1,5-мл пробирку Эппендорф. К этому раствору добавляют 250 мкл лимонной кислоты (25 мМ) и 1,25 мл этилацетата. Раствор перемешивают в течение 15 секунд и центрифугируют. Этилацетат, который содержит гидролизованный субстрат, переносят в пробирку Эппендорф, содержащую безводный ЫагЭО,}. После перемешивания и центрифугирования пробирки Эппендорф, органическую фазу переносят в новую пробирку Эппендорф. Гидролизованный субстрат,
содержащийся в органической фазе, определяют
спектрофотометрически на 32 0 нм.
Данные анализа приводятся на графиках 2, 3 и 4.
Сразу видно, что порошкообразные препараты действуют гораздо лучше, чем эталонный продукт при каждой из исследуемых частот нанесения и для каждого рассмотренного момента времени.
В частности, значения для Препаратов 1 и 4 всегда являются в высшей степени значимыми по сравнению с эталонным продуктом, демонстрируя их лучшую эффективность, что означает меньше нанесений для пациента. В любом случае, очевидно, что порошкообразные препараты действуют гораздо лучше, чем препараты, содержащие коллагеназу в липофильном носителе. Это означает не только, что коллагеназа, присутствующая в порошкообразных препаратах, действует в водной окружающей среде, образующейся, когда эксудат поглощается гликолятом кукурузного крахмала, демонстрируя ранее упомянутую стабильность в водном растворе, но также и то, что неожиданно, она действует лучше, чем ожидалось.
Относительно препаратов для инъекций, как ранее сказано, они существенно используют чистоту фермента, полученного с помощью способа, описанного выше, и его неожиданную стабильность в водном носителе, и то и другое, при Т окружающей среды, и при температурах, находящихся в пределах между -20 и -8 0°С. Композиции для инъекций предпочтительно состоят из коллагеназы в форме, полученной сушкой вымораживанием, разбавленной в водном растворе, предпочтительно, во время использования, и содержат, на единичную дозу:
коллагеназу, полученную в соответствии с описанным способом, в количестве эквивалентном активности, находящейся в пределах между 12 0 и 4 50 нкатал;
стерильный солевой раствор (0,9% NaCl);
необязательно, НА со средневзвешенной молекулярной массой в пределах между 750 и 1200 кДа, при концентрации, находящейся в пределах между 1 и 30 мг/мл солевого раствора, предпочтительно, в пределах между 8 и 20 мг/мл, а еще более предпочтительно, в пределах между 10 и 15 мг/мл.
Некоторые примеры приготовления растворов коллагеназы для инъекций будут теперь описываться в качестве примера, но не ограничения.
Пример 8: приготовление раствора коллагеназы для инъекций
в стерильном солевом растворе (0,9% NaCl).
Коллагеназа эквивалент 196 нкатал
Стерильный солевой раствор 1 мл
Фермент в лиофильной форме, содержащийся в соответствующей стерильной ампуле, разбавляют с помощью 0,35 мл стерильного солевого раствора, отбирают с помощью градуированного шприца. После осторожного перемешивания получают стабильный раствор.
Пример 9: приготовление раствора коллагеназы для инъекций
в стерильном солевом растворе (NaCl 0,9%).
Коллагеназа эквивалент 392 нкатал
Стерильный солевой раствор 1 мл
Фермент в лиофильной форме, содержащийся в соответствующей стерильной ампуле, разбавляют с помощью 0,7 мл стерильного солевого раствора, отмеривают с помощью градуированного шприца. После острожного перемешивания получают стабильный раствор.
Пример 10: приготовление раствора коллагеназы для
инъекций, приготовленного в НА с MW 750 кДа.
Коллагеназа эквивалент 196 нкатал
Раствор НА 1 мл
Раствор НА предварительно разбавляют посредством растворения 10 мг предварительно микронизированной НА, содержащейся в соответствующей стерильной ампуле в 1 мл стерильного солевого раствора. Фермент в лиофильной форме разбавляют с помощью 0,35 мл раствора НА, отмеривают с помощью градуированного шприца. После острожного перемешивания до растворения порошка коллагеназы, получают стабильный раствор.
Пример 11: приготовление раствора коллагеназы для
инъекций, приготовленного с НА с MW 1200 кДа кДа.
Коллагеназа эквивалент 392 нкатал
Раствор НА 1 мл
Раствор НА предварительно разбавляют посредством растворения 15 мг предварительно микронизированной НА,
содержащейся в соответствующей стерильной ампуле в 1 мл стерильного солевого раствора. Фермент в лиофильной форме разбавляют с помощью 0,7 мл раствора НА, отмеривают с помощью градуированного шприца. После острожного перемешивания до растворения порошка коллагеназы, получают стабильный раствор.
Растворы, полученные таким образом, могут храниться при 4°С, хотя предпочтительно вводить их в виде инъекции непосредственно после приготовления или в пределах 8 часов после него. В дополнение к типичным терапевтическим применениям, описанным выше, коллагеназа в соответствии с настоящим изобретением может также использоваться при диссоциации тканей и при изоляции клеточных кластеров или отдельных клеток, как для терапевтических целей, так и для целей экспериментальных исследований. Это применение используют, например, в процедуре трансплантации островковых клеток Лангерханса для изоляции островковых клеток от окружающей ткани поджелудочной железы. Коллагеназа также может успешно использоваться для изоляции кардиомиоцитов, гепатоцитов и опухолевых клеток для цели разработки соответствующей вакцины, и в целом для всех клеток, которые можно использовать в области генной инженерии тканей (костей, хрящей, щитовидной железы, и тому подобное).
СПИСОК ПОСЛЕДОВАТЕЛЬНОСТЕЙ
<110> Fidia Farmaceutici S.p.A
<120> НОВЫЙ СПОСОБ ПОЛУЧЕНИЯ И ОЧИСТКИ ФЕРМЕНТА КОЛЛАГЕНАЗЫ ИЗ VIBRIO ALGINOLYTICUS
<130> 1484РСТ
<150> PD2012A000118 <151> 2012-04-18
<160> 3
<170> Patentin version 3.5
<210> 1
<211> 739
<212> PRT
<213> vibrio alginolyticus
<220>
<221> mat_peptide
<222> (1)..(739)
<223> новый способ получения и очистки фермента коллагеназы от vibrio
al gi nolyti cus
<400> 1
Thr Ala Cys Asp Leu Glu Ala Leu val Thr Glu Ser Ser Asn Gin Leu
15 10 15
lie Ser Glu lie Leu Ser Gin Gly Ala Thr Cys val Asn Gin Leu Phe
20 25 30
Ser Ala Glu Ser Arg lie Gin Glu Ser val Phe Ser Ser Asp His Met
35 40 45
Tyr Asn lie Ala Lys His Thr Thr Thr Leu Ala Lys Gly Tyr Thr Gly
50 55 60
Gly Gly Ser Asp Glu Leu Glu Thr Leu Phe Leu Tyr Leu Arg Ala Gly
65 70 75 80
Tyr Tyr Ala Glu Phe Tyr Asn Asp Asn lie Ser Phe lie Glu Trp val
85 90 95
Thr Pro Ala val Lys Glu Ser val Asp Ala Phe val Asn Thr Ala Ser
100 105 110
Phe Tyr Glu Asn Ser Asp Arg His Gly Lys val Leu Ser Glu val lie
115 120 125
lie Thr Met Asp Ser Ala Gly Leu Gin His Ala Tyr Leu Pro Gin val
130 135 140
Thr Gin Trp Leu Thr Arg Trp Asn Asp Gin Tyr Ala Gin His Trp Tyr
145 150 155 160
Страница 1
Met Arg Asn Ala val Asn Gly val Phe Thr lie Leu Phe Gly Gly Gin
165 170 175
Trp Asn Glu Gin Phe val Gin lie lie Gly Asn Gin Thr Asp Leu Ala
180 185 190
Lys Ala Leu Gly Asp Phe Ala Leu Arg Ala Ser Ser lie Gly Ala Glu
195 200 205
Asp Glu Phe Met Ala Ala Asn Ala Gly Arg Glu Leu Gly Arg Leu Thr
210 215 220
Lys Tyr Thr Gly Asn Ala Ser Ser val val Lys Ser Gin Leu Ser Arg
225 230 235 240
lie Phe Glu Gin Tyr Glu Met Tyr Gly Arg Gly Asp Ala val Trp Leu
245 250 255
Ala Ala Ala Asp Thr Ala Ser туг туг Ala Asp Cys Ser Glu Phe Gly
260 265 270
lie Cys Asn Phe Glu Thr Glu Leu Lys Gly Leu val Leu Ser Gin Thr
275 280 285
Tyr Thr Cys Ser Pro Thr lie Arg lie Leu Ser Gin Asn Met Thr Gin
290 295 300
Glu Gin His Ala Ala Ala Cys Ser Lys Met Gly Tyr Glu Glu Gly Tyr
305 310 315 320
Phe His Gin Ser Leu Glu Thr Gly Glu Gin Pro val Lys Asp Asp His
325 330 335
Asn Thr Gin Leu Gin val Asn lie Phe Asp Ser Ser Thr Asp Tyr Gly
340 345 350
Lys Tyr Ala Gly Pro lie Phe Asp lie Ser Thr Asp Asn Gly Gly Met
355 360 365
Tyr Leu Glu Gly Asp Pro Ser Gin Pro Gly Asn lie Pro Asn Phe lie
370 375 380
Ala Tyr Glu Ala Ser Tyr Ala Asn Ala Asp His Phe val Trp Asn Leu
385 390 395 400
Glu His Glu Tyr val His Tyr Leu Asp Gly Arg Phe Asp Leu Tyr Gly
405 410 415
Gly Phe Ser His Pro Thr Glu Lys lie val Trp Trp Ser Glu Gly lie
420 425 430
Страница 2
Ala Glu Tyr val Ala Gin Glu Asn Asp Asn Gin Ala Ala Leu Glu Thr
435 440 445
lie Leu Asp Gly Ser Thr Tyr Thr Leu Ser Glu lie Phe Glu Thr Thr
450 455 460
Tyr Asp Gly Phe Asp val Asp Arg lie Tyr Arg Trp Gly Tyr Leu Ala
465 470 475 480
val Arg Phe Met Phe Glu Asn His Lys Asp Asp val Asn Gin Met Leu
485 490 495
val Glu Thr Arg Gin Gly Asn Trp lie Asn Tyr Lys Ala Thr lie Thr
500 505 510
Gin Trp Ala Asn Leu Tyr Gin Ser Glu Phe Glu Gin Trp Gin Gin Thr
515 520 525
Leu val Ser Asn Gly Ala Pro Asn Ala val lie Thr Ala Asn Ser Lys
530 535 540
Gly Lys val Gly Glu Ser lie Thr Phe Ser Ser Glu Asn Ser Thr Asp
545 550 555 560
Pro Asn Gly Lys lie val Ser val Leu Trp Asp Phe Gly Asp Gly Ser
565 570 575
Thr Ser Thr Gin Thr Lys Pro Thr His Gin Tyr Gly Ser Glu Gly Glu
580 585 590
Tyr Ser val Ser Leu Ser val Thr Asp Ser Glu Gly Leu Thr Ala Thr
595 600 605
Ala Thr His Thr val val lie Ser Ala Leu Gly Gly Asn Asp Thr Leu
610 615 620
Pro Gin Asp Cys Ala val Gin Ser Lys val Ser Gly Gly Arg Leu Thr
625 630 635 640
Ala Gly Glu Pro val Cys Leu Ala Asn Gin Gin Thr lie Trp Leu Ser
645 650 655
val Pro Ala val Asn Glu Ser Ser Asn Leu Ala lie Thr Thr Gly Asn
660 665 670
Gly Thr Gly Asn Leu Lys Leu Glu Tyr Ser Asn Ser Gly Trp Pro Asp
675 680 685
Asp Thr Asn Leu His Gly Trp Ser Asp Asn lie Gly Asn Gly Glu Cys
690 695 700
Страница 3
lie Thr Leu Ser Asn Gin Ser Asn Tyr Trp Gly Tyr val Lys val Ser
705 710 715 720
Gly Asp Phe Glu Asn Ala Ala lie val val Asp Phe Asp Ala Gin Lys
725 730 735
Cys Arg Gin
<210> 2 <211> 814 <212> PRT
<213> vibrio alginolyticus <220>
<221> PEPTIDE <222> (1)..(814)
<223> Активная сердцевина коллагеназы от vibrio Alginolyticus <400> 2
Met Glu Leu Lys lie Leu Ser val Ala lie Ala Thr Thr Leu Thr Ser
15 10 15
Thr Gly val Phe Ala Leu Ser Glu Pro val Ser Gin val Thr Glu Gin
20 25 30
His Ala His Ser Ala His Thr His Gly val Glu Phe Asn Arg val Glu
35 40 45
Tyr Gin Pro Thr Ala Thr Leu Pro lie Gin Pro Ser Lys Ala Thr Arg
50 55 60
val Gin Ser Leu Glu Ser Leu Asp Glu Ser Ser Thr Ala Cys Asp Leu
65 70 75 80
Glu Ala Leu val Thr Glu Ser Ser Asn Gin Leu lie Ser Glu lie Leu
85 90 95
Ser Gin Gly Ala Thr Cys val Asn Gin Leu Phe Ser Ala Glu Ser Arg
100 105 110
lie Gin Glu Ser val Phe Ser Ser Asp His Met Tyr Asn lie Ala Lys
115 120 125
His Thr Thr Thr Leu Ala Lys Gly Tyr Thr Gly Gly Gly Ser Asp Glu
130 135 140
Leu Glu Thr Leu Phe Leu Tyr Leu Arg Ala Gly Tyr Tyr Ala Glu Phe
145 150 155 160
Tyr Asn Asp Asn lie Ser Phe lie Glu Trp val Thr Pro Ala val Lys
Страница 4
seql.txt
165 170 175
Glu Ser val Asp Ala Phe val Asn Thr Ala Ser Phe Tyr Glu Asn Ser
180 185 190
Asp Arg His Gly Lys val Leu Ser Glu val lie lie Thr Met Asp Ser
195 200 205
Ala Gly Leu Gin His Ala Tyr Leu Pro Gin val Thr Gin Trp Leu Thr
210 215 220
Arg Trp Asn Asp Gin Tyr Ala Gin His тгр Tyr Met Arg Asn Ala val
225 230 235 240
Asn Gly val Phe Thr lie Leu Phe Gly Gly Gin Trp Asn Glu Gin Phe
245 250 255
val Gin lie lie Gly Asn Gin Thr Asp Leu Ala Lys Ala Leu Gly Asp
260 265 270
Phe Ala Leu Arg Ala Ser Ser lie Gly Ala Glu Asp Glu Phe Met Ala
275 280 285
Ala Asn Ala Gly Arg Glu Leu Gly Arg Leu Thr Lys Tyr Thr Gly Asn
290 295 300
Ala Ser Ser val val Lys Ser Gin Leu Ser Arg lie Phe Glu Gin Tyr
305 310 315 320
Glu Met Tyr Gly Arg Gly Asp Ala val Trp Leu Ala Ala Ala Asp Thr
325 330 335
Ala Ser Tyr Tyr Ala Asp Cys Ser Glu Phe Gly lie Cys Asn Phe Glu
340 345 350
Thr Glu Leu Lys Gly Leu val Leu Ser Gin Thr Tyr Thr Cys Ser Pro
355 360 365
Thr lie Arg lie Leu Ser Gin Asn Met Thr Gin Glu Gin His Ala Ala
370 375 380
Ala Cys Ser Lys Met Gly Tyr Glu Glu Gly Tyr Phe His Gin Ser Leu
385 390 395 400
Glu Thr Gly Glu Gin Pro val Lys Asp Asp His Asn Thr Gin Leu Gin
405 410 415
val Asn lie Phe Asp Ser Ser Thr Asp Tyr Gly Lys Tyr Ala Gly Pro
420 425 430
lie Phe Asp lie Ser Thr Asp Asn Gly Gly Met Tyr Leu Glu Gly Asp
Страница 5
seql.txt
435 440 445
Pro Ser Gin Pro Gly Asn lie Pro Asn Phe lie Ala Tyr Glu Ala Ser
450 455 460
Tyr Ala Asn Ala Asp His Phe val Trp Asn Leu Glu His Glu Tyr val
465 470 475 480
His Tyr Leu Asp Gly Arg Phe Asp Leu Tyr Gly Gly Phe Ser His Pro
485 490 495
Thr Glu Lys lie val тгр Trp Ser Glu Gly lie Ala Glu Tyr val Ala
500 505 510
Gin Glu Asn Asp Asn Gin Ala Ala Leu Glu Thr lie Leu Asp Gly Ser
515 520 525
Thr Tyr Thr Leu Ser Glu lie Phe Glu Thr Thr Tyr Asp Gly Phe Asp
530 535 540
val Asp Arg lie Tyr Arg тгр Gly Tyr Leu Ala val Arg Phe Met Phe
545 550 555 560
Glu Asn His Lys Asp Asp val Asn Gin Met Leu val Glu Thr Arg Gin
565 570 575
Gly Asn Trp lie Asn Tyr Lys Ala Thr lie Thr Gin тгр Ala Asn Leu
580 585 590
Tyr Gin Ser Glu Phe Glu Gin тгр Gin Gin Thr Leu val Ser Asn Gly
595 600 605
Ala Pro Asn Ala val lie Thr Ala Asn Ser Lys Gly Lys val Gly Glu
610 615 620
Ser lie Thr Phe Ser Ser Glu Asn Ser Thr Asp Pro Asn Gly Lys lie
625 630 635 640
val Ser val Leu тгр Asp Phe Gly Asp Gly Ser Thr Ser Thr Gin Thr
645 650 655
Lys Pro Thr His Gin Tyr Gly Ser Glu Gly Glu Tyr Ser val Ser Leu
660 665 670
Ser val Thr Asp Ser Glu Gly Leu Thr Ala Thr Ala Thr His Thr val
675 680 685
val lie Ser Ala Leu Gly Gly Asn Asp Thr Leu Pro Gin Asp Cys Ala
690 695 700
val Gin Ser Lys val Ser Gly Gly Arg Leu Thr Ala Gly Glu Pro val
Страница 6
705
710
seql.txt 715
720
Cys Leu Ala Asn Gin Gin Thr lie тгр Leu Ser val Pro Ala val Asn
725 730 735
Glu Ser Ser Asn Leu Ala lie Thr Thr Gly Asn Gly Thr Gly Asn Leu
740 745 750
Lys Leu Glu Tyr Ser Asn Ser Gly тгр Pro Asp Asp Thr Asn Leu His
755 760 765
Gly Trp Ser Asp Asn lie Gly Asn Gly Glu Cys lie Thr Leu Ser Asn
770 775 780
Gin Ser Asn туг тгр Gly Tyr val Lys val Ser Gly Asp Phe Glu Asn
785 790 795 800
Ala Ala lie val val Asp Phe Asp Ala Gin Lys Cys Arg Gin 805 810
<210> 3
<211> 15
<212> PRT
<213> vibrio Alginolyticus
<220>
<221> MISC_FEATURE
<222> (1)..(15)
<223> N-окончание зрелой цепи
<400> 3
Thr Ala Cys Asp Leu Glu Ala Leu val Thr Glu Ser Ser Asn Gin
15 10 15
Страница 7
ФОРМУЛА ИЗОБРЕТЕНИЯ
1. Способ получения и очистки коллагеназы из Vibrio alginolyticus chemovar. Iophagus, включающий следующие стадии:
Стадия А: Инокуляция Vibrio alginolyticus chemovar. Iophagus в колбе Эрленмейера и ферментация культурного бульона не-бычьего животного происхождения;
Стадия В: Осветление ферментированного бульона полученного таким образом с помощью ультрафильтрации в тангенциальном потоке с помощью кассеты с номинальным отсечением по молекулярной массе (MWCO) 100-500 кДа, предпочтительно, 300 кДа;
Стадия С: Диализ и концентрирование осветленной среды, полученной на Стадии В, с помощью ультрафильтрации в тангенциальном потоке с помощью кассет с MWCO 5-30 кДа, предпочтительно, с MWCO 10 кДа;
Стадия D: Очистка раствора, содержащего коллагеназу, полученного на Стадии С, с помощью анионообменной смолы, несущей слабо основные группы, при рН в пределах между 6,9 и 7,4, предпочтительно, при рН 7,1;
Стадия Е: Диализ и концентрирование собранных фракций, которые имеют коллагенолитическую активность, полученных со стадии D, с помощью ультрафильтрации в тангенциальном потоке с помощью кассет с MWCO 10-50 кДа, предпочтительно, с MWCO 30 кДа;
Стадия F: Очистка раствора полученного таким образом, с помощью анионообменной смолы, несущей сильно основные группы, при рН в пределах между 6,9 и 7,4, предпочтительно, при рН 7,1;
Стадия G: Диафильтрация и концентрирование фракций с коллагенолитической активностью ^ 95%, полученных со стадии F, с помощью ультрафильтрации в тангенциальном потоке с помощью кассет с MWCO 10-50 кДа, предпочтительно, с MWCO 30 кДа;
Стадия Н: Фильтрование раствора, содержащего коллагеназу, полученную таким образом, через 0,2-мкм абсолютный фильтр и хранение при температуре в пределах между -2 0° и -80°С.
2. Способ по п.1, в котором культурный бульон имеет свиное животное происхождение или представляет собой смесь свиного и
2.
растительного происхождения.
3. Способ по п.1 или 2, в котором анионообменная смола, несущая слабо основные группы, несет диэтиламиноалкильные группы, предпочтительно, диэтиламиноэтил, и анионообменная смола, несущая сильно основные группы, несет группы четвертичного аммония.
4. Коллагеназа из Vibrio alginolyticus chemovar. Iophagus, полученная и очищенная по любому из пп.1-3, отличающаяся:
молекулярной массой 82 кДа;
удельной активностью в пределах между 1000 и 1800 нкатал/мг;
чистотой в пределах между 98,0 и 100%;
отсутствием микробных и белковых загрязнений, в частности, отсутствием эндотоксинов и ДНК;
стабильностью при рН в пределах между 5,5 и 11;
стабильностью в водном растворе при Т в пределах между 4° и 40°С, в частности, стабильностью при 37°С;
стабильностью в водном растворе при 4°С в течение 30 дней;
стабильностью в водном растворе при Т в пределах между -20°С и -80°С в течение 24-48 месяцев;
лиофилизируемостью с получением стабильного лиофильного порошка.
5. Коллагеназа по п. 4, которая стабильна в водном растворе, содержащем 25 мМ TRIS-HC1 и 10 мМ СаС1г, при рН 7,1.
6. Коллагеназа по п. 4 или п. 5 в форме стабильного лиофильного порошка, имеющая ферментативную активность в пределах от 7 до 2 0 нкатал/мг порошка, содержащая:
- мальтозу: 95-96%, предпочтительно, 95,75%
- соли: 1,0-1,5%, предпочтительно, 1,3%
- коллагеназу: 2,5-3,5%, предпочтительно, 2,95%.
7. Коллагеназа по любому из п.п.4-6, для применения в лечении ожогов различной степени, пролежней, ошпаривания, кожных язв различной природы, сосудистых и диабетических язв, целлюлита, послеоперационных спаек, гипертрофических рубцов и келоидов.
8. Коллагеназа по любому из п.п.4-6, для применения в
лечении адгезивного капсулита, синдрома Дюпюитрена и болезни Пейрони.
9. Фармацевтическая композиция для топического применения,
в форме пылевидного порошка, содержащая:
коллагеназу по п. 4 или б, в количестве, эквивалентном активности, находящейся в пределах между 2 и 8 нкатал/г готового продукта, предпочтительно, 5 нкатал/г готового продукта;
гликолят кукурузного крахмала в количестве, необходимом для завершения процентной композиции;
необязательно, гиалуроновую кислоту со средневзвешенной молекулярной массой, находящейся в пределах между 130 и 230 кДа, предпочтительно, в пределах между 145 и 210 кДа и еще более предпочтительно, в пределах между 160 и 200 кДа, в количестве, находящемся в пределах между 0,1 и 5%, предпочтительно, между 0,2 и 2%;
необязательно, коллоидный диоксид кремния в количестве, находящемся в пределах между 0,1 и 3%, предпочтительно, в пределах между 0,2 и 1%.
10. Фармацевтическая композиция для инъекций, содержащая на разовую дозу:
коллагеназу по п. 4 или б в форме, полученной сушкой вымораживанием, в количестве, эквивалентном активности, находящейся в пределах между 120 и 450 нкатал;
стерильный солевой раствор;
необязательно, гиалуроновую кислоту со средневзвешенной молекулярной массой, находящейся в пределах между 750 и 1200 кДа, при концентрации, находящейся в пределах между 1 и 30 мг/мл солевого раствора, предпочтительно, в пределах между 8 и 20 мг/мл, и еще более предпочтительно, в пределах между 10 и 15 мг/мл.
11. Фармацевтическая композиция по п.9 для применения в топическом и/или местном лечении ожогов различной степени, ошпаривания, пролежней, сосудистых и диабетических язв, целлюлита, послеоперационных спаек, гипертрофических рубцов и келоидов.
11.
12. Фармацевтическая компо лечении адгезивного капсулита, Пейрони.
зиция по п. 10 для применения в синдрома Дюпюитрена и болезни
По доверенности
И100Н9И0НЭ1НИ %
кто м/s
9/СО'в09> 808J61SP
?906 ЧИ"
эеэвсх/с
Фиг.2
инокулум
ферментация
осветление
диализ и концентрирование
хроматография на DE-52
диализ и концентрирование
хроматография на DE-15Q
диализ и концентрирование
фильтрование 0,2 мкм
200 кДа
97 кДа ?ф
66 кДа 1_ * *'"¦*
55 кДа
45кДа v. ЗбкДа
Фиг.З
5/12 Фиг.5
12 3 4
Фиг.7
97кДа
66 кДа 45 кДа
200 кДа
ИбкДа 97кДа
66 кДа
55 кДа 45 кДа
36 кДа
Фиг.8
9/12 Фиг.9
03 Q. 03 с ф а.
График 3 нанесение каждые два дня
03 ф
с; о
О 03
О ш
? о
m о.
Ф ч:
с; о 40
20 -
• препарат 1
• препарат 4 •Bionect Start(r)
120
seql.txt
seql.txt
seql.txt
seql.txt
1/12
1/12
2/12
2/12
3/12
3/12
4/12
4/12
6/12
7/12
7/12
8/12
8/12
10/12
11/12
11/12
11/12
11/12