Патентная документация ЕАПВ

 
Запрос :  ea201401201a*\id

больше ...
Термины запроса в документе


Полный текст патента

(57) Реферат / Формула:

В данном документе раскрывается применение Akt3 в качестве биомаркера для обнаружения возникновения эпителиально-мезенхимального перехода (ЕМТ) у субъекта и применение ингибиторов Akt3 для лечения рака. Также раскрываются различные способы обнаружения возникновения эпителиально-мезенхимального перехода (ЕМТ) у субъекта с помощью измерения экспрессии и/или активности Akt3.


1411911
СПОСОБ
Область изобретения
Настоящее изобретение относится к области разработки лекарственных средств и лечения рака. В частности, настоящее изобретение относится к области протеинкиназ, а более конкретно - к способам прогнозирования и лечения рака.
Предпосылки изобретения Akt
Akt (протеинкиназа В) является серин-треониновой протеинкиназой, которая, как известно, участвует в разнообразных клеточных процессах, включая пролиферацию, подвижность, рост, гомеостаз глюкозы, выживание и гибель клеток. Akt является одним из трех основных компонентов пути PI3K/Akt (фосфатидилинозитол-3-киназы, ее антагониста PTEN и Akt). Мутации в компонентах данного пути являются одними из наиболее часто наблюдаемых мутаций при видах рака и обнаруживаются при раке молочной железы в пределах до 70%. У человека существуют три представителя семейства Akt, Akt 1, Akt 2 и Akt3, которые транскрибируются с различных генов. Большинство научных публикаций о Akt относится либо к Aktl, либо к Akt без указания конкретного представителя семейства, вследствие широкого использования антител ко всем Akt, которые не делают различий между представителями семейства. Из трех изоформ менее всего известно о Akt3. Действительно, в недавней обзорной статье "Key signalling nodes in mammary gland development and cancer. Signalling downstream of PI3 kinase in mammary epithelium: a play in 3 Akts" (Wickenden JA and Watson CJ, Breast Cancer Research 2010, 12, 202), Akt3 упоминается всего три раза: один раз для установления ее существования, один раз для упоминания того, что она, по-видимому, играет незначительную роль в нормальном развитии молочных желез, и один раз для упоминания того, что она не влияет на фосфорилирование Stat5a в течение беременности и лактации.
Роли Aktl, Akt2 и Akt3 в нормальном развитии изучались на нокаутных мышах, при этом обнаружилось, что Aktl важна для общего роста (нокаутные мыши в целом здоровы, но со сниженным ростом), Akt2 в основном участвует в метаболизме глюкозы (нокаутные мыши растут нормально, но демонстрируют устойчивость к инсулину), и Akt3 важна в развитии мозга (смотри, например, Dummler В, Hemmings ВА. Physiological roles of PKB/Akt isoforms in development and disease. Biochem Soc Trans 2007;35:231-5). Ha более общую роль Aktl и Akt2 указывает их широкая экспрессия во всем организме, в то
время как Akt3 обладает более ограниченной экспрессией в мозге, почках и сердце.
Akt считается выгодной мишенью для терапии рака, и ингибирование Akt отдельно или в комбинации со стандартными химиотерапевтическими средствами для терапии рака, как предполагается, снижает апоптотический порог и предпочтительно уничтожает клетки рака (Lindley CW, Curr Top Med Chem, 10, 458, 2010). Недавний обзор попыток ингибировать представителей Akt точно определяет Akt2 как наиболее часто мутирующего представителя семейства при раке и предполагает, что ингибирование Aktl и Akt2 должно быть оптимальным (Mattmann ME et al "Inliibition of Akt with small molecules and biologies: historical perspective and current status of the patent landscape", Expert Opinion on Therapeutic Patents, 21, 1309, 2011). Многие из соединений, упомянутых в данном обзоре, обладают низкой селективностью в отношении Akt в сравнении с другими киназами и в целом сфокусированы на Aktl. Соединения, представленные в данном обзоре, с селективностью между различными представителями семейства в подавляющем большинстве случаев ингибируют Aktl и/или Akt2, а не Akt3.
Несмотря на преобладающее внимание к Aktl в литературе сверхэкспрессию Akt3 связывают с несколькими видами рака, включая меланому (Cancer Res. 2004 Oct 1;64(19):7002-10) и рак яичников (Cancer Discov. 2012 Jan 1;2(1):56-67).
Несколько патентных публикаций относятся к применению Akt3.
Патент WO2010/091354 (Н Lee Moffat Cancer Institute, Inc.) относится к способам диагностики рака у субъекта, при которых определяют уровни экспрессии АКТ1, фосфорилированной по тирозину 176, а не АКТЗ.
Патент США № 20120040842 (Baker, et al.) перечисляет Akt3 среди широкого спектра генов, которые могут использоваться для определения прогноза рака ободочной и прямой кишки. Однако Akt3 не выбрана в качестве предпочтительного маркера.
Патент США № 20120028264 (Shaq, et al.) перечисляет Akt3 {таблица ЗА} среди широкого спектра генов, уровни экспрессии которых могут определяться при оценке вероятности рецидива рака предстательной железы у субъекта. Значимость Akt3 отдельно не упоминается.
Патент США № 20120021983 (Tsichlis, et al.) относится к способу диагностики или прогнозирования потенциального рака и прогрессирования существующего рака путем оценки профиля изоформ Akt субъекта, особенно соотношения Aktl к Akt2, путем сравнения такого профиля с нормальным профилем изоформ Akt.
Патент США № 20120003209 (Научно-исследовательский институт прикладной геномики) относится к способам и наборам, применяемым при выявлении инвазивной глиобластомы, на основе уровней экспрессии Aktl и Akt2. Обнаружили, что экспрессия
мРНК Akt3 является высокой в образцах головного мозга без новообразований, и снижается в глиальных опухолях [[0130]]. Кроме того обнаружили, что экспрессия Akt3 значительно выше у выживших в течение длительного времени пациентов.
Патент США № 8133684 (Aebersold et al.) раскрывает способы определения андрогенных ответов в клетках предстательной железы, упоминая Akt3 в длинном списке возможных биомаркеров рака предстательной железы.
Эпителиально-мезенхимальный переход (ЕМТ)
Эпителиальные ткани составляют один из четырех основных типов тканей организма, наряду с соединительной тканью, мышечной и нервной тканью. Эпителиальные клетки характеризуются тенденцией к образованию слоев поляризованных клеток, удерживаемых вместе сильными межклеточными соединениями. Вследствие этого эпителиальные клетки не способны свободно двигаться и демонстрируют незначительное перемещение в сравнении с другими типами клеток. Напротив, подобные мезенхимальным клетки (например, фибробласты) не обладают сильными межклеточными соединениями и могут двигаться как отдельные клетки. Они могут являться очень подвижными и способны мигрировать сквозь внеклеточный матрикс.
Эпителиально-мезенхимальный переход (ЕМТ) является естественной клеточной программой, в которой отдельные эпителиальные клетки теряют профили экспрессии генов и характеристики поведения эпителиальных клеток и вместо этого начинают выглядеть, вести себя и экспрессировать гены характерно для мезенхимальньгх клеток. При этом они теряют адгезию и апикально-базальную полярность и получают возможность мигрировать и проникать во внеклеточный матрикс. ЕМТ не является необратимым. Зеркальный процесс, называемый мезенхимально-эпителиальный переход (МЕТ), приводит к потере мезенхимальных характеристик и восстановлению межклеточной адгезии и апикально-базальной полярности.
ЕМТ особенно важен во время эмбрионального развития. Он играет фундаментальную роль в гаструляции, когда эмбрион, состоящий из одного слоя эпителиального клеток, развивается в эмбрион с тремя классическими зародышевыми слоями, эктодермой, мезодермой и энтодермой. Чуть позже в развитии позвоночных ЕМТ приводит к появлению клеток нервного гребня. Данные клетки мигрируют по всему эмбриону и дают начало множеству различных структур, включая ганглии периферической нервной системы, кости и хрящи лица и головы, пигментные клетки и глиальные клетки. Дальнейшие циклы МЕТ и ЕМТ необходимы для формирования
внутренних органов, как из мезодермы, так и энтодермы. ЕМТ и заболевание
В противоположность важности во время эмбрионального развития, программа ЕМТ редко активируется у здоровых взрослых. Однако она индуцируется в ответ на воспаление после травмы или заболевания: ЕМТ играет роль в заживлении ран и восстановлении тканей и возникает во время дегенеративных заболеваний органов (например, почечного фиброза).
Также все чаще полагают, что ЕМТ играет ключевую роль в метастазировании рака. Карциномы являются эпителиальными видами рака, и для возникновения метастазов отдельные клетки должны избежать первичную опухоль и претерпеть серию миграций. Это включает миграцию из первичной опухоли в местный кровоток или лимфатическую систему и экстравазацию из сосудистой сети, и закрепление в месте метастазирования. В настоящее время существует возрастающее число убедительных доказательств того, что взаимодействия между опухолевыми клетками и их микроокружением может приводить к индукции ЕМТ в некоторых опухолевых клетках. Полученное усиление миграции клеток и потенциала проникновения данных клеток затем повышает вероятность формирования метастазов. Рецепторная тирозинкиназа Axl, которая является онкогеном, ассоциированным с хроническим миелогенным лейкозом, как недавно продемонстрировано, является существенно важным ЕМТ-индуцированным эффектором в каскаде проникновения-метастазирования (патент WO2010/103388).
Помимо данной роли в увеличении метастатического потенциала, программу ЕМТ недавно связали с опухолевыми стволовыми клетками (CSC). Данные клетки, как предполагается, представляют субпопуляцию опухолевых клеток с характеристиками стволовых клеток - т.е. способностью давать начало всем типам клеток, обнаруживаемым в определенном виде рака, и, следовательно, способностью образовывать новую опухоль. Хотя они могут представлять лишь незначительную часть клеток в опухоли, CSC, как полагается, являются особенно устойчивыми к существующим противоопухолевым средствам. Даже притом, что лечение лекарственными средствами может уничтожить подавляющее большинство клеток в опухоли, одна выжившая CSC может, следовательно, привести к рецидиву заболевания. Последние данные свидетельствуют о перекрывании между ЕМТ и CSC фенотипами, указывая на то, что ЕМТ может также играть роль в повторном проявлении рака после химиотерапии и развитии опухолей, устойчивых к лекарственным средствам.
Надежные биомаркеры для фенотипа ЕМТ могли бы быть пригодными в выявлении пациентов с определенным риском развития метастатического или
лекарственно-устойчивого рака, в то время как новые лекарственные средства, которые воздействуют на клетки, подвергшиеся ЕМТ, уменьшат метастазирование и рецидив после традиционной терапии.
Активаторы ЕМТ (например, фактор транскрипции Slug) увеличивают активность/экспрессию Aktl. Также известно, что активация Aktl (например, миристилированньш вариант MyrAktl) индуцирует активаторы ЕМТ (например, транскрипционный репрессор, Snail; Oncogene. 2007 Nov 22;26(53):7445-56. Epub 2007 Jun 1), а также вызывает переключение биомаркеров с эпителиальных на мезенхимальные.
Краткое описание настоящего изобретения
Неожиданно в настоящее время обнаружили, что Akt3 играет центральную роль в индукции ЕМТ и признаков опухолевых стволовых клеток в клетках человека. В частности, обнаружили, что конститутивно активная Akt3 значительно повышает способность клеток к образованию опухолей in vivo и маммосфер, в сравнении с контрольными клетками или клетками, экспрессирующими конститутивно активную Aktl. Дополнительно, ингибирование Akt3 могло обратить ЕМТ и признаки CSC.
Данное являлось неожиданным, принимая во внимание фокус в данной области на Aktl и Akt2.
Также обнаружили, что Akt3 является биомаркером для передачи сигнала рецепторной тирозинкиназой Axl. Более конкретно, Akt3, как показано, является биомаркером для передачи сигнала Axl в эпителиальных клетках. Также обнаружили, что Akt3 принимает участие в цикле обратной связи, что приводит к поддержанию ЕМТ. Дополнительные виды применения Akt3, например, в качестве биомаркера раковых стволовых клеток, метастазирования, станут очевидными из данного раскрытия.
В соответствии с одним аспектом настоящего изобретения предусмотрен способ отбора фармацевтического соединения, пригодного для предупреждения, ингибирования или лечения состояния, связанного с Akt3, причем способ включает создание группы кандидатных фармацевтических соединений для тестирования, тестирование влияния кандидатных фармацевтических соединений на активность Akt3 в тестовой системе и отбор кандидатного фармацевтического соединения на основании ингибирования активности Akt3.
Альтернативно настоящее изобретение предусматривает способ отбора кандидатного фармацевтического соединения, пригодного для лечения метастатического или лекарственно-устойчивого рака, причем способ включает создание группы кандидатных фармацевтических соединений для тестирования, тестирование влияния
кандидатных фармацевтических соединений на активность Akt3 в тестовой системе и отбор кандидатного фармацевтического соединения на основании его ингибирования активности Akt3.
В соответствии с другим аспектом предусмотрен способ отбора кандидатного фармацевтического соединения, пригодного для предупреждения или ингибирования ЕМТ, причем способ включает создание группы кандидатных фармацевтических соединений для тестирования, тестирование влияния кандидатных фармацевтических соединений на активность Akt3 в тестовой системе и отбор кандидатного фармацевтического соединения на основании ингибирования активности АкхЗ.
Большим преимуществом является возможность определения эффективных уровней кандидатного фармацевтического соединения в in vitro тестовой системе для прогнозирования ответов in vivo. Это облегчает определение уровней минимальных эффективных доз фармацевтического соединения, а также валидацию мишеней лекарственного средства дозозависимым образом. Особенно полезный подход к прогнозированию in vivo ответов на фармацевтическое соединение осуществляется посредством условного избирательного подавления гена-мишени путем РНК-интерференции. Эффективное получение нуклеотидов для применения в таких способах описано в патенте WO2009/082488.
В соответствии с другим аспектом настоящего изобретения предусмотрен способ отбора кандидатного фармацевтического соединения, пригодного для предупреждения, ингибирования или лечения состояния, связанного с Akt3, причем способ включает избирательное снижение экспрессии Akt3 в тестируемой клетке, приведение в контакт тестируемой клетки с кандидатным фармацевтическим соединением и определение эффекта кандидатного фармацевтического соединения на ингибирование активности Akt3.
В соответствии с дополнительным аспектом настоящего изобретения предусмотрен способ отбора соединения, пригодного для предупреждения, ингибирования или лечения состояния, связанного с Akt3, причем способ включает избирательное снижение экспрессии Akt3 в in vitro тестовой системе до низкого уровня, приведение в контакт тестовой системы с кандидатным фармацевтическим соединением и отбор кандидатных фармацевтических соединений, которые ингибируют активность Akt3.
В соответствии с дополнительным аспектом настоящего изобретения предусмотрен способ выявления субъекта, имеющего состояние, связанное с Akt3, причем способ включает оценку уровня экспрессии или активности Akt3 у субъекта или в образце, полученном от субъекта. Как правило, уровень экспрессии или активности у субъекта или
в образце, полученном от субъекта, можно определить по отношению к контрольному образцу, описываемому в данном документе.
В соответствии с дополнительным аспектом настоящего изобретения предусмотрен способ выявления субъекта, подверженного определенному риску развития метастатического или лекарственно-устойчивого рака, причем способ включает оценку уровня экспрессии или активности Akt3 у субъекта или в образце, полученном от субъекта, причем повышенный уровень экспрессии или активности Akt3 указывает на повышенный риск развития у субъекта метастатического или лекарственно-устойчивого рака.
В соответствии с дополнительным аспектом настоящего изобретения предусмотрен способ выявления присутствия раковых стволовых клеток у субъекта, причем способ включает определение уровня экспрессии или активности Akt3 у субъекта или в образце, полученном от субъекта, причем повышенная экспрессия или активность АктЗ указывает на наличие раковых стволовых клеток (CSC).
В соответствии с дополнительным аспектом настоящего изобретения предусмотрен способ выявления субъекта, подвергшегося ЕМТ, причем способ включает определение уровня экспрессии или активности Akt3 у субъекта или в образце, полученном от субъекта, причем повышение экспрессии или активности Akt3 указывает на возникновение ЕМТ.
В соответствии с дополнительным аспектом настоящего изобретения предусмотрен способ прогнозирования исхода, связанного с раком, у субъекта, причем способ включает оценку активности или экспрессии Akt3 у субъекта или в образце, полученном от субъекта.
В некоторых вариантах осуществления увеличение активности или экспрессии Akt3 в сравнении с контрольным образцом указывает на восприимчивость к лечению с помощью противоракового терапевтического средства, например, способного ингибировать или обращать ЕМТ. Средство может являться таким, которое описано в данном документе, например ингибитором Akt3 или ингибитором Axl.
В соответствии с дополнительным аспектом настоящего изобретения предусмотрен способ выявления активности Axl, причем способ включает определение уровня экспрессии или активности Akt3 у субъекта или в образце, полученном от субъекта, причем повышение активности или экспрессии Akt3 коррелирует с активностью Axl.
Неожиданно обнаружили, что уровень экспрессии или активности Akt3 обратно коррелирует с уровнем экспрессии или активности Akt2. Способы и виды применения по настоящему изобретению включают оценку уровня экспрессии или активности Akt2 у
субъекта или в образце, полученном от субъекта. Понижение уровня экспрессии или активности Akt2 может указывать на: (i) субъект испытывает состояние, связанное с Akt3; (ii) повышенный риск развития метастатического или лекарственно-устойчивого рака; (ш) наличие раковых стволовых клеток; и/или (iv) возникновение ЕМТ.
В некоторых вариантах осуществления оценивают уровень экспрессии или активности и Akt2, и Akt3. Оценка двух обратно коррелирующих биомаркеров может повысить достоверность анализа.
В некоторых вариантах осуществления уровень экспрессии Akt3 оценивают путем определения числа копий гена, кодирующего Akt3, по отношению к контрольному образцу, где увеличение числа копий указывает на повышенный уровень экспрессии Akt3. Число копий (например, явления дупликации гена) можно определить, применяя стандартные методы, известные в данном уровне техники, например, применяя ДНК-чип, который описан в Jiang et al. (Jiang Q, Ho YY, Hao L, Nichols Berrios C, Chakravarti A. Copy number variants in candidate genes are genetic modifiers of Hirschsprung disease. PLoS One. 2011;6(6)).
В некоторых вариантах осуществления, где уровень экспрессии Akt3 (или Akt2) оценивают путем определения уровня белка Akt3 (или Akt2) или мРНК. Способы определения белка и уровней экспрессии мРНК хорошо известны в данном уровне техники и описаны в данном документе.
В некоторых вариантах осуществления активность Akt3 оценивают путем определения фосфорилирования Akt3, где фосфорилирование Akt3 указывает на активную Akt3. Можно определить фосфорилирование Akt3 по серину 472, как описано в данном документе. Альтернативно или дополнительно, можно определить фосфорилирование по треонину 305 и/или тирозину 174. Данная нумерация относится к последовательности Akt3; соответствующими остатками Aktl являются S473, Т308 и Y176, соответственно.
Не ограничиваясь теорией, полагают, что фосфорилирование по треонину 305 имеет важное значение в локализации Akt3 по отношению к ядру, приводя к фосфорилированию по тирозину 174 и серину 472 и активированию Akt3. В некоторых вариантах осуществления активность Akt3 оценивают путем определения внутриклеточной локализации белка Akt3, где локализация в ядре указывает на активную Akt3.
В некоторых вариантах осуществления активность Akt3 оценивают путем определения уровня экспрессии последующих мишеней, например генов, связанных с ЕМТ. В дополнительных вариантах осуществления киназную активность Akt3 можно оценить путем определения фосфорилирования субстратных белков (например, SNAIL)
или пептидов, например, как описано в Tuomi et al., 2009 (Sci Signal. 2009 Jun 30 2(77)).
В соответствии с другим аспектом настоящего изобретения предусмотрен способ лечения субъекта, имеющего состояние, связанное с Akt3, причем способ включает приведение субъекта в контакт с ингибитором Akt3 или с фармацевтическим соединением, выбранным в качестве или полученным из кандидатного соединения, полученного с помощью способа в соответствии с первым аспектом настоящего изобретения.
Дополнительные аспекты настоящего изобретения включают способ ингибирования ЕМТ у субъекта, причем способ включает приведение субъекта в контакт с соединением, способным ингибировать активность Akt3.
Дополнительный аспект настоящего изобретения предусматривает способ ингибирования раковых стволовых клеток у субъекта, причем способ включает приведение субъекта в контакт с соединением, способным ингибировать активность Akt3.
Настоящее изобретение также предусматривает способ предупреждения или ингибирования лекарственной устойчивости у субъекта, имеющего рак, причем способ включает приведение субъекта в контакт с соединением, способным ингибировать активность Akt3.
Настоящее изобретение также предусматривает применение ингибитора Akt3 в лечении состояния, связанного с Akt3, такого как рак.
Настоящее изобретение также предусматривает применение ингибитора Akt3 в ингибировании ЕМТ.
Настоящее изобретение также предусматривает ингибитор Akt3 для применения в способе лечения, описанном в данном документе.
В соответствии с дополнительным аспектом настоящего изобретения предусмотрено применение соединения, способного ингибировать активность Akt3, в предупреждении, ингибировании или лечении лекарственной устойчивости у субъекта, имеющего рак, причем способ включает приведение субъекта в контакт с соединением, способным ингибировать активность Akt3.
Ингибиторы Akt3, выявленные с помощью способов в соответствии с настоящим изобретением или применяемые в способах или видах применения в соответствии с настоящим изобретением, могут применяться в качестве монотерапии или в комбинированной терапии с другими способами лечения рака, как указано ниже.
Пригодные химиотерапевтические средства включают:
алкилирующие средства, включая алкилсульфонаты, такие как бусульфан;
азотистые иприты, такие как хлорамбуцил, циклофосфамид, эстрамустин,
ифосфамид, мехлорэтамин, мелфалан и урамустин, производные этиленимина, такие как тиотепа;
нитрозомочевины, такие как кармустин, ломустин и стрептозоцин, триазены, такие как дакарбазин, прокарбазин и темозоламид, и
соединения платины, такие как цисплатин, карбоплатин, оксалиплатин, сатраплатин и пикоплатин, оннаплатин, тетраплатин, сприоплатин, ипроплатин, хлорид хлор(диэтилендиамино)-платины (II), дихлор(этилендиамино)-платина (II), диамино(2-этилмалонато)платина (II), (1,2-диаминоциклогексан)малонатоплатина (II), (4-карбоксифтало)-( 1,2-диаминоциклогексан)платина (П), (1,2-диаминоциклогексан)-(изоцитрато)платина (II) и (1,2-диаминоциклогексан)-цис-(пирувато)платина (И);
антиметаболиты, включая антифолаты, такие как метотрексат, перметрексед, ралтитрексед и триметрексат,
аналоги пиримидина, такие как азацитидин, капецитабин, цитарабин, эдатрексат, флоксуридин, фторурацил, гемцитабин и троксацитабин, и
аналоги пурина, такие как кладрибин, хлордезоксиаденозин, клофарабин, флударабин, меркаптопурин, пентостатин, и тиогуанин;
природные продукты, включая противоопухолевые антибиотики, такие как блеомицин, дактиномицин, митрамицин, митомицин, митоксантрон, порфиромицин, и антрациклины, такие как даунорубицин, доксорубицин, эпирубицин, идарубицин и вальрубицин,
ингибиторы митоза, такие как алкалоиды барвинка, винбластин, винвезир, винкристин, виндезин и винорелбин,
ферменты, такие как L-аспарагиназа и PEG-L-аспарагиназа,
стабилизаторы полимеров микротрубочек, такие как таксаны паклитаксел и доцетаксел,
ингибиторы топоизомеразы I, такие как камптотецины иринотекан и топотекан, и ингибиторы топоизомеразы II, такие как подофиллотоксин, амсакрин, этопозид,
тенипозид, лозоксантрон и актиномицин;
гормоны и антагонисты гормонов, включая андрогены, такие как флуоксиместерон
и тестолактон,
антиандрогены, такие как бикалутамид, ципротерон, флутамид и нилутамид, кортикостероиды, такие как дексаметазон и преднизон,
ингибиторы ароматазы, такие как аминоглютетимид, анастрозол, экземестан, форместан и летрозол,
эстрогены, такие как диэтилстильбэстрол,
антиэстрогены, такие как фулвестрант, ралоксифен, тамоксифен и торемифин,
агонисты и антагонисты рилизинг-фактора лютеинизирующего гормона (LHRH), такие как абареликс, бузерелин, госерелин, лейпролид, гистрелин, дезорелин, нафарелина ацетат и трипторелин,
прогестины, такие как меДроксипрогестерона ацетат и мегестрола ацетат, и
гормоны щитовидной железы, такие как левотироксин и лиотиронин;
ингибиторы пути РКВ, включая перифозин, энзастаурина гидрохлорид и трицирибин,
ингибиторы Р13К, такие как семафор и SF1126, и
ингибиторы MTOR, такие как рапамицин и аналоги;
ингибиторы CDK, включая селициклиб, альвоцидиб и 7-гидроксистауроспорин; ингибиторы СОХ-2, включая целекоксиб;
ингибиторы HDAC, включая трихостатин А, субероиланилид гидроксамовой кислоты и хламидоцин;
ингибиторы ДНК-метилазы, включая темозоломид; и
разнообразные средства, включая алтретамин, триоксид мышьяка, талидомид, леналидомид, галлия нитрат, левамизол, митотан, гидроксимочевину, октреотид, прокарбазин, сур амин, фотодинамические соединения, такие как метоксален и натрия порфимер, и ингибиторы протеосом, такие как бортезомиб.
Средства молекулярной таргетной терапии, в том числе:
функциональные терапевтические средства, включая средства генной терапии, средства антисмысловой терапии,
ингибиторы тирозинкиназы, такие как эрлотиниба гидрохлорид, гефитиниб, иматиниба мезилат и семаксаниб,
ингибиторы Raf, такие как сорафениб, и
модуляторы экспрессии гена, такие как ретиноиды и рексиноиды, например, адапален, бексаротен, транс-ретиноевая кислота, 9-цис-ретиноевая кислота и N-(4-гидроксифенил)ретинамид; и
средства фенотип-направленной терапии, включая моноклональные антитела, такие как алемтузумаб, бевацизумаб, цетуксимаб, ибритумомаб тиуксетан, ритуксимаб и трастузумаб, иммунотоксины, такие как гемтузумаб озогамицин, радиоиммуноконъюгаты, такие как I-тозитумомаб, и
противораковые вакцины.
Средства биологической терапии, в том числе:
интерфероны, такие как интерферон-[альфа]2а и интерферон-[альфа]2Ь, и
интерлейкины, такие как альдеслейкин, денилейкин дифтитокс и опрелвекин. Средства, ингибирующие Axl, включая 1-(6,7-дигидро-5Н-бензо[6,7]циклогепта[1,2-с]пиридазин-3-ил)-КЗ-((7-(8)-пирролидин-1-ил)-6,7,8,9-тетрагидро-5Н-бензо[7]аннулен-2-ил)-1Н-1,2,4-триазол-3,5-диамин (BGB324/R428), СН5451098 (Roche) и ингибиторы Axl, описанные в заявках на патенты PCT/US07/089177, PCT/US2010/021275 и РСТ/ЕР2011/004451, включены в данный документ в качестве ссылки.
В дополнение к данным средствам, предназначенным действовать против раковых клеток, противораковые виды терапии включают применение защитных или дополнительных средств, в том числе:
цитопротекторных средств, таких как амифостин и дексразоксан, фосфонатов, таких как памидронат и золедроновая кислота, и стимулирующих факторов, таких как эпоэтин, дарбэпоэтин, филграстим, PEG-филграстим и сарграмостим.
В данном уровне техники известны многие комбинации химиотерапевтических схем, такие как комбинации карбоплатин/паклитаксел, капецитабин/доцетаксел, фторурацил/левамизол, фторурацил/лейковорин, метотрексат/лейковорин и трастузумаб/паклитаксел, отдельно или в дополнительной комбинации с карбоплатином и т.п.
В соответствии с дополнительным аспектом настоящего изобретения предусмотрен способ отбора пациентов, предпочтительно пациентов-людей, для лечения состояния, связанного с Akt3, причем способ включает выявление пациентов с повышенной активностью или экспрессией Akt3 и отбор выявленных таким образом пациентов для лечения. Пациентов можно выявлять в соответствии со способами по настоящему изобретению, как описано в данном документе.
Предпочтительно состояние, связанное с Akt3, представляет собой рак. Рак может представлять собой один или несколько из следующих видов рака: лейкозы, такие как, но без ограничений, острый лейкоз, острый лимфоцитарный лейкоз, острые миелоцитарные лейкозы, такие как миелобластный, промиелоцитарный, миеломоноцитарный, моноцитарный лейкозы, эритролейкоз и миелодиспластический синдром, хронические лейкозы, такие как, но без ограничений, хронический миелоцитарный (гранулоцитарный) лейкоз, хронический лимфоцитарный лейкоз, волосатоклеточный лейкоз; истинная полицитемия; лимфомы такие как, но без ограничений, болезнь Ходжкина, неходжкинская лимфома; множественные миеломы, такие как, но без ограничений, вялотекущая множественная миелома, несекреторная миелома, остеосклеротическая миелома, плазмоклеточный лейкоз, изолированная плазмацитома и экстрамедуллярная
плазмацитома; макроглобулинемия Вальденстрема; моноклональная гаммапатия неясного генеза; доброкачественная моноклональная гаммапатия; болезнь тяжелых цепей; саркомы костной и соединительной ткани, такие как, но без ограничений, саркома кости, остеосаркома, хондросаркома, саркома Юинга, гигантоклеточная саркома, фибросаркома кости, хордома, периостальная саркома, саркомы мягких тканей, ангиосаркома (гемангиосаркома), фибросаркома, саркома Калоши, лейомиосаркома, липосаркома, лимфангиосаркома, метастатические виды рака, неврилеммома, рабдомиосаркома, синовиальная саркома; опухоли головного мозга, такие как, но без ограничений, глиома, астроцитома, глиома ствола головного мозга, эпендимома, олигодендроглиома, неглиальная опухоль, неврилеммома слухового нерва, краниофарингиома, медуллобластома, менингиома, пинеоцитома, пинеобластома, первичная лимфома головного мозга; рак молочной железы, в том числе, но без ограничений, аденокарцинома, очаговая (мелкоклеточная) карцинома, внутрипротоковая карцинома, медуллярный рак молочной железы, муцинозный рак молочной железы, тубулярный рак молочной железы, папиллярный рак молочной железы, первичные виды рака, болезнь Педжета и воспалительный рак молочной железы; рак надпочечников, такой как, но без ограничений, феохромоцитома и карцинома коры надпочечников; рак щитовидной железы, такой как, но без ограничений, папиллярный или фолликулярный рак щитовидной железы, медуллярный рак щитовидной железы и анапластический рак щитовидной железы; рак поджелудочной железы, такой как, но без ограничений, инсулинома, гастринома, глюкагонома, ВИПома, соматостатин-секретирующая опухоль и карциноид или опухоль островковых клеток; рак гипофиза, такой как, но без ограничений, болезнь Кушинга, пролактин-секретирующая опухоль, акромегалия и несахарный диабет; виды рака глаза, такие как, но без ограничений, меланомы глаза, такие как меланома радужной оболочки, меланома сосудистой оболочки глаза и меланома цилиарного тела, и ретинобластома; рак влагалища, такой как плоскоклеточная карцинома, аденокарцинома и меланома; рак вульвы, такой как плоскоклеточная карцинома, меланома, аденокарцинома, базальноклеточная карцинома, саркома и болезнь Педжета; виды рака шейки матки, такие как, но без ограничений, плоскоклеточная карцинома и аденокарцинома; виды рака матки, такие как, но без ограничений, эндометриальная карцинома и саркома матки; виды рака яичников, такие как, но без ограничений, эпителиальная карцинома яичников, пограничная опухоль, опухоль половых клеток и стромальная опухоль; виды рака пищевода, такие как, но без ограничений, плоскоклеточный рак, аденокарцинома, железисто-кистозная карцинома, мукоэпидермоидная карцинома, железисто-плоскоклеточная карцинома, саркома, меланома, плазмацитома, бородавчатая карцинома
и овсяно-клеточная (мелкоклеточная) карцинома; виды рака желудка, такие как, но без ограничений, аденокарцинома, грибовидно разрастающиеся (полипоидные), изъязвляющиеся, поверхностно распространяющиеся, диффузно распространяющиеся, злокачественная лимфома, липосаркома, фибросаркома и карциносаркома; виды рака толстой кишки; виды рака прямой кишки; виды рака печени, такие как, но без ограничений, гепатоцеллюлярная карцинома и гепатобластома, виды рака желчного пузыря, такие как аденокарцинома; холангиокарциномы, такие как, но без ограничений, папиллярная, нодулярная и диффузная; виды рака легких, такие как немелкоклеточный рак легкого, плоскоклеточная карцинома (эпидермоидная карцинома), аденокарцинома, крупноклеточная карцинома и мелкоклеточный рак легкого; виды рака яичка, такие как, но без ограничений, эмбрионально-клеточная опухоль, семинома, анапластическая семинома, классическая (типичная) семинома, сперматоцитная семинома, несеминома, эмбриональная карцинома, тератоидная опухоль, хориокарцинома (опухоль желточного мешка), виды рака предстательной железы, такие как, но без ограничений, аденокарцинома, лейомиосаркома и рабдомиосаркома; виды рака половых органов, такие как рак полового члена; виды рака ротовой полости, такие как, но без ограничений, плоскоклеточная карцинома; базально-клеточные виды рака; виды рака слюнных желез, такие как, но без ограничений, аденокарцинома, мукоэпидермоидная карцинома и железисто-кистозная карцинома; виды рака глотки, такие как, но без ограничений, плоскоклеточный рак и бородавчатый; виды рака кожи, такие как, но без ограничений, базально-клеточная карцинома, плоскоклеточная карцинома и меланома, поверхностно распространяющаяся меланома, нодулярная меланома, меланома типа злокачественного лентиго, акральная лентигинозная меланома; виды рака почек, такие как, но без ограничений, почечно-клеточный рак, аденокарцинома, гипернефрома, фибросаркома, переходно-клеточный рак (почечной лоханки и/или мочеточника); опухоль Вильмса; виды рака мочевого пузыря, такие как, но без ограничений, переходно-клеточная карцинома, плоскоклеточный рак, аденокарцинома, карциносаркома. В дополнение, виды рака включают миксосаркому, остеогенную саркому, эндотелиосаркому, лимфангиоэндотелиосаркому, мезотелиому, синовиому, гемангиобластому, эпителиальную карциному, цистаденокарциному, бронхогенную карциному, карциному потовых желез, карциному сальных желез, папиллярную карциному и папиллярные аденокарциномы. Предпочтительно рак выбирают из рака молочной железы, меланомы, рака предстательной железы, рака яичников, рака толстой и прямой кишки, рака легких или глиомы. Более предпочтительно рак является метастатическим раком молочной железы.
Лечение метастатического рака зависит от того, где располагается первичная опухоль. Когда рак молочной железы распространяется в легкие, например, он остается раком молочной железы, и лечение определяется происхождением метастатического рака из молочной железы, а не тем фактом, что в настоящее время он присутствует в легких. Примерно в 5 процентах случаев обнаруживают метастатический рак, но первичную опухоль невозможно выявить. Лечение таких видов метастатического рака диктуется их расположением, а не их происхождением. Виды метастатического рака называют в соответствии с тканью первичной опухоли (если известна). Например, рак молочной железы, который распространился в головной мозг, называют метастазами рака молочной железы в головной мозг.
Пациентов, выявленных или отобранных в соответствии со способами по настоящему изобретению, можно лечить, или отбирать для лечения. Например, если экспрессия Akt3, как показано, повышена в первичной опухоли, это можно использовать для заключения о повышенной вероятности метастазирования. Данную информацию можно использовать в качестве руководства к способам лечения, т.е. более агрессивному противораковому хирургическому, химиотерапевтическому или радиотерапевтическому лечению, такому как радикальная мастэктомия. В некоторых вариантах осуществления лечение включает введение ингибитора Akt3 и/или Axl, необязательно в комбинации с дополнительным терапевтическим средством, описанным в данном документе или известным в данном уровне техники. Предпочтительно, ингибитор Axl является BGB324/R428.
Настоящее изобретение также предусматривает клеточные линии, которые чувствительны к ингибиторам к ЕМТ, причем клеточная линия обладает уровнем экспрессии Akt3, который недостаточен для предупреждения ЕМТ. Предпочтительно, клеточные линии являются клеточными линиями человека.
Настоящее изобретение также предусматривает способ выявления соединения, которое ингибирует активность Akt3, причем способ включает приведение клетки из клеточной линии в соответствии с настоящим изобретением в контакт с тестируемым соединением и определение ингибирования активности Akt3 в клетке.
Один аспект настоящего изобретения относится к применению Akt3 в качестве биомаркера для обнаружения возникновения эпителиально-мезенхимального перехода (ЕМТ) у субъекта. В некоторых вариантах осуществления увеличение экспрессии и/или активация Akt3 свидетельствует о возникновении эпителиально-мезенхимального перехода (ЕМТ).
Метастазы в отдаленные участки являются наиболее распространенной причиной смерти от солидных опухолей (Gupta 2006, Sporn 1996). Для достижения данной цели опухолевые клетки избавляются от эпителиальных ограничений, изменяют комплексы межклеточных контактов и приобретают инвазивную подвижность для прохождения через границу базальной мембраны. Данные метастатические клетки затем проникают в лимфоток или кровоток, распространяясь в отдаленные участки в организме. Некоторым из данных метастатических клеток удается проникнуть сквозь стенки капилляров и в редких случаях колонизировать строму чужеродной ткани (Weinberg et аГ). Данный злокачественный процесс облегчается с помощью эпителиально-мезенхимального перехода (ЕМТ), программы развития, при которой эпителиальные клетки временно приобретают фенотип мезенхимальных во время гаструляции и органогенеза, обеспечивая инвазивное движение отдельной клетки в сторону от эпителиального слоя (Hall, 1985; Thierry, 2002). Программа ЕМТ инициируется зависящей от условий активацией морфогенных сигнальных путей, которые индуцируют экспрессию транскрипционных регуляторов, в том числе Twist, Snail, Slug и Zeb2, которые изменяют экспрессию белков комплексов межклеточных контактов (Thiery and SLeeman 2006). Профиль экспрессии генов ЕМТ отражает фенотипический сдвиг, репрессию Е-кадгерина и цитокератинов с индукцией виментина и N-кадгерина (Weinberg et al 2007).
Термин "маркер" или "биомаркер" применяется в данном документе для обозначения гена или белка, экспрессия которого в образце, полученном из клетки или млекопитающего, изменена или модулирована, например, повышена или понижена, когда происходит эпителиально-мезенхимальный переход (ЕМТ). Если биомаркер является белком, модуляция или изменение экспрессии включает в себя модуляцию посредством различных посттрансляционных модификаций.
Посттрансляционные модификации представляют собой явления ковалентного процессинга, которые изменяют свойства белка путем протеолитического расщепления или путем добавления модифицирующей группы к одной или нескольким аминокислотам. Распространенные посттрансляционные модификации включают фосфорилирование, ацетилирование, метилирование, ацилирование, гликозилирование, присоединение гликозилфосфатидилинозитола, убиквитинилирование и так далее. Обзор таких модификаций и способов обнаружения можно найти в Mann et al. Nature Biotechnology March 2003, Vol. 21, pages 255-261.
В данном документе также предусмотрено применение Akt3 в качестве биомаркера для обнаружения экспрессии и/или активации Axl, где повышение экспрессии и/или активация Akt3 свидетельствует об увеличении экспрессии и/или активации Axl.
Термин "экспрессия" относится к транскрипции ДНК-матрицы гена с получением соответствующей мРНК и трансляции данной мРНК с получением соответствующего генного продукта (т.е. пептида, полипептида или белка), а также "экспрессии" белка в одной или нескольких формах, который может быть модифицированным после трансляции.
Определение уровня экспрессии, включая экспрессию гена, можно выполнять с помощью любого из способов, известных в данном уровне техники, в частности, с помощью микроматричного анализа, вестерн-блоттинга или с помощью методов ПНР, таких как QPCR. Измененную экспрессию также можно обнаружить с помощью анализа содержания белка в образцах с применением способов, таких как ELISA, PET или SELDI-TOF MS, которые описаны в данном документе, и с применением дополнительных аналитических методов, таких как 2D гель-электрофорез. Такие методы, как данный, могут являться особенно применимыми для обнаружения измененной экспрессии в виде альтернативных посттрансляционно модифицированных форм белка.
Походящие образцы включают, но без ограничений, образцы тканей, такие как биоптат, кровь, моча, соскобы щеки и т.д., образцы сыворотки, плазмы или супернатанта тканевой культуры. В одном варианте осуществления экспрессию гена предпочтительно обнаруживают в опухолевых клетках, особенно клетках, полученных из опухоли, например, при видах рака молочной железы, легких, желудка, головы и шеи, толстой и прямой кишки, почек, поджелудочной железы, матки, печени, мочевого пузыря, эндометрия и предстательной железы и при лейкозах, или из клеток крови, таких как лимфоциты и, предпочтительно, лимфоциты периферической крови, такие как РВМС.
При обнаружении белков в сыворотке и, в частности, в образцах плазмы пациентов образцы удаляют и подвергают методам анализа белка, таким как проточная цитометрия, ELISA, PET и SELDI-TOF MS, которые описаны в данном документе.
В одном предпочтительном варианте осуществления способ включает извлечение РНК из указанных образцов и обнаружение экспрессии гена с помощью QPCR.
В одном варианте осуществления экспрессию гена обнаруживают с помощью обнаружения белковых продуктов, например, с помощью вестерн-блоттинга.
Дополнительный аспект настоящего изобретения предусматривает способ обнаружения возникновения эпителиально-мезенхимального перехода (ЕМТ) в образце, причем указанный способ включает определение уровня экспрессии или активации Akt3 в образце, выделенном из клетки, группы клеток, животной модели или от человека, в сравнении с контрольным образцом, где увеличение уровня экспрессии или активация Akt3 в сравнении с контрольным образцом указывает на возникновение эпителиально
мезенхимального перехода (ЕМТ).
Дополнительный аспект настоящего изобретения относится к способу выявления средства, способного ингибировать или обращать эпителиально-мезенхимальный переход (ЕМТ), причем указанный способ включает введение указанного средства в клетку, группу клеток или животную модель и отслеживание активации и/или экспрессии Akt3.
В одном варианте осуществления способ включает:
(!) введение средства в клетку, группу клеток или животную модель, не являющуюся человеком; и
(ii) измерение экспрессии Akt3 и/или активации Akt3 в образцах, полученных из обработанных и необработанных клеток или животной модели; и
(iii) обнаружение увеличения экспрессии и/или активации Akt3 в обработанном образце в сравнении с необработанным образцом в качестве указания на способность ингибировать или обращать эпителиально-мезенхимальный переход (ЕМТ).
В некоторых вариантах осуществления животная модель не является человеком.
В некоторых вариантах осуществления уровень экспрессии Akt3 оценивают путем определения числа копий гена, кодирующего Akt3, в сравнении с контрольным образцом, где увеличение числа копий указывает на повышенный уровень экспрессии Akt3.
В некоторых вариантах осуществления уровень экспрессии АктЗ оценивают путем определения уровня белка Akt3 или мРНК.
В некоторых вариантах осуществления активность Akt3 оценивают путем определения фосфорилирования Akt3, где фосфорилирование Akt3 указывает на активность Akt3. Можно определить фосфорилирование Akt3 по серину 472, как описано в данном документе. Альтернативно или дополнительно, можно определить фосфорилирование по треонину 305 и/или тирозину 174.
В некоторых вариантах осуществления активность АктЗ оценивают путем определения внутриклеточной локализации белка Akt3, где локализация в ядре указывает на активную Akt3.
В некоторых вариантах осуществления активность АктЗ оценивают путем определения уровней экспрессии последующих мишеней, например генов, связанных с ЕМТ. В дополнительных вариантах осуществления киназную активность АктЗ можно оценить путем определения фосфорилирования субстратных белков (например, SNAIL) или пептидов, например, как описано в Tuomi et al., 2009.
АктЗ
АктЗ (также известная как РКВ гамма) у человека присутствует в двух изоформах, изоформа 1 и изоформа 2. Последовательность изоформы 1 (Q9Y23, вариант 1), которая
является "канонической" последовательностью, выглядит следующим образом: SEQ ID NO: 1
MSDVTIVKEGWQKIIGEYIKNWRPRYFLLKTDGSFIGYKEKPQDVDLPYPLNNF SVAKCQLMKTERPKPNTFIIRCLQWTTVIERTFHVDTPEEREEWTEAIQAVADRLQRQEE ERMNCSPTSQroNIGEEEMDASTTHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGK YYAMOLKKEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGG ELFFHLSRERVFSEDRTRFYGAEIVSALDYLHSGKrVYRDLKLENLMLDKDGHIKITDFG LCKEGITDAATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFY NQDHEKLFELILMEDIKPPRTLSSDAKSLLSGLLIKDPNKRLGGGPDDAXEIMRHSFFSGV NWQDVYDKKLVPPFKPQVTSETDTRYFDEEFTAQTITITPPEKYDEDGMDCMDNERRPH FPQFSYSASGRE
Изоформа 2 имеет последовательность:
SEQ ID NO: 2
MSDVT1YKEGWQKIIGEYIKNWRPRYFLLKTDGSFIGYKEKPQDVDLPYPLNNF SVAKCQLMKTERPKPNTFIIRCLQWTTVIERTFHVDTPEEREEWTEAIQAVADRLQRQEE ERMNCSPTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGK YYAMOLKKEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKJJRLCFVMEYVNGG ELFFHLSRERVFSEDRTRFYGAEIVSALDYLHSGKIVYRDLKLENLMLDKDGHIKITDFG LCKEGITDAATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFY NQDHEKLFELILMEDIKFPRTLSSDAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFSGV NWQDVYDKKLVPPFKPQVTSETDTRYFDEEFTAQTITITPPEKCQQSDCGMLGNWKK
Измерение измененной экспрессии генных/белковых маркеров
Уровни экспрессии гена и белка можно определить с использованием ряда различных методов.
(а) на уровне РНК
Экспрессию гена можно обнаружить на уровне РНК. РНК можно экстрагировать из клеток, с использованием методов экстракции РНК, включающих, например, применение кислотной экстракции с фенол/гуанидинизотиоцианатом (RNAzol В; Biogenesis), наборы для получения РНК RNeasy (Qiagen) или PAXgene (PreAnalytix, Швейцария). Типичные виды анализов, использующие гибридизацию рибонуклеиновой кислоты, включают ядерные кинетические анализы, ПЦР с обратной транскрипцией, метод защиты от РНКазы (Melton et al., Nuc. Acids Res. 12:7035), нозерн-блоттинг и гибридизацию in situ. Экспрессию гена также можно обнаружить с помощью микроматричного анализа, который описан ниже.
Для нозерн-блоттинга образцы РНК сначала разделяют по размеру посредством
электрофореза в агарозном геле в денатурирующих условиях. Затем РЖ переносят на мембрану, сшивают и гибридизируют с меченым зондом. Можно применять неизотопные или радиоактивно меченые зонды с высокой удельной активностью, включая меченые со случайными праймерами, ник-транслированные или полученные с помощью ПЦР ДНК-зонды, in vitro транскрибированные РНК-зонды и олигонуклеотиды. В дополнение, в качестве зондов можно применять последовательности с только частичной гомологией (например, кДНК от другого вида или геномные фрагменты ДНК, которые могут содержать экзон).
Анализы защиты от нуклеаз (включая как анализ защиты от рибонуклеазы, так и анализы с S1 нуклеазой) предусматривают чрезвычайно чувствительный способ обнаружения и количественного определения специфических мРНК. Основой NPA является метод гибридизации в растворе антисмыслового зонда (с радиоактивной меткой или неизотопного) с образцом РНК. После гибридизации одноцепочечный негибридизованный зонд и РНК расщепляют нуклеазами. Оставшиеся защищенные фрагменты отделяют на акриламидном геле. NPA позволяют одновременно обнаруживать несколько видов РНК.
Гибридизация in situ (ISH) является мощным и универсальным инструментом для определения местонахождения специфических мРНК в клетках или тканях. Гибридизация зонда происходит в клетке или ткани. Поскольку клеточная структура поддерживается на протяжении всей процедуры, ISH обеспечивает информацию о местоположении мРНК в образце ткани.
Процедура начинается с фиксации образцов в буферном растворе нейтрального формалина и заключения ткани в парафин. Образцы затем нарезают на тонкие срезы и помещают на предметные стекла микроскопа. Альтернативно, можно делать срезы замороженной ткани и после этого фиксировать в параформальдегиде. После серии промываний с целью депарафинизации и регидратации срезов выполняют расщепление протеиназой К для увеличения возможности доступа зонда, и затем меченый зонд гибридизируется со срезами образцов. Радиоактивно меченые зонды визуализируют с помощью жидкой пленки, высушенной на предметных стеклах, в то время как неизотопно меченые зонды обычно обнаруживают с помощью колориметрических или флуоресцентных реагентов. Данный последний способ обнаружения является основой для флуоресцентной гибридизации in situ (FISH).
Способы обнаружения, которые могут применяться, включают радиоактивные метки, ферментные метки, хемилюминесцентные метки, флуоресцентные метки и другие пригодные метки.
Как правило, RT-PCR применяют для амплификации РНК-мишеней. В данном способе применяется фермент обратная транскриптаза для преобразования РНК в комплементарную ДНК (кДНК), которую затем можно амплифицировать для облегчения обнаружения. Относительная количественная RT-PCR включает амплификацию внутреннего контроля одновременно с представляющим интерес геном. Внутренний контроль применяют для нормализации образцов. После нормализации можно выполнить прямые сравнения относительного содержания определенной мРНК в образцах. Обычно применяемые внутренние контроли включают, например, GAPDH, HPRT, актин и циклофилин.
Известно много способов амплификации ДНК, большинство из которых основывается на ферментативной цепной реакции (такой как полимеразная цепная реакция, лигазная цепная реакция или самоподдерживающаяся репликация последовательностей) или на репликации всего или части вектора, в который ее клонировали.
Много способов целевой и сигнальной амплификации (TAS) описано в литературе, например, обзорные анализы данных способов в Landegren, U. et al, Science 242:229-237 (1988) и Lewis, R., Genetic Engineering News 10:1, 54-55 (1990).
ПЦР является способом амплификации нуклеиновых кислот, описанным, в частности, в патентах США № 4683195 и 4683202. ПЦР можно применять для амплификации любой известной нуклеиновой кислоты в диагностическом контексте (Мок et al, 1994, Gynaecologic Oncology 52:247-252). Самоподдерживающаяся репликация последовательностей (3SR) является вариантом TAS, который включает в себя изотермическую амплификацию матрицы нуклеиновой кислоты посредством последовательных циклов активности обратной транскриптазы (RT), полимеразы и нуклеазы, которые опосредованы смесью ферментов и соответствующими олигонуклеотидными праймерами (Guatelli et al, 1990, Proc. Natl. Acad. Sci. USA 87:1874). Опосредованная лигированием реакция амплификации или опосредованная лигированием система амплификации использует ДНК-лигазу и четыре олигонуклеотида, два на цепь-мишень. Данный метод описан в Wu, D. Y. and Wallace, R. В., 1989, Genomics 4:560. В методе Qp-репликазы РНК-репликаза бактериофага Qp\ которая реплицирует одноцепочечную РНК, используется для амплификации ДНК-мишени, как описано в Lizardi et al, 1988, Bio/Technology 6:1197.
Количественная ПЦР (Q-PCR) является методом, который позволяет определить относительные количества транскриптов в образце. Пригодный способ для выполнения QPCR описан в данном документе.
В настоящем изобретении может применяться альтернативный метод амплификации. Например, амплификация по типу катящегося кольца (Lizardi et al, 1998, Nat Genet 19:225) является коммерчески доступным методом амплификации (RCAT(tm)), который обусловлен ДНК-полимеразой и может реплицировать кольцевые олигонуклеотидные зонды с линейной или геометрической кинетикой при изотермических условиях. Дополнительный метод, амплификация с замещением цепей (SDA; Walker et al, 1992, Proc. Natl Acad. Sci. USA 80:392), начинается с конкретно определенной последовательности, уникальной для конкретной мишени.
Пригодные зонды для обнаружения экспрессии АктЗ или Akt2, указанные в данном документе, можно для удобства упаковывать в виде тестового набора в пригодный контейнер. В таких наборах зонд может являться связанным с твердой подложкой, когда формат анализа, для которого набор предназначен, требует такого связывания. Набор может также содержать пригодные реагенты для обработки образца, подлежащего исследованию, гибридизирующие зонд с нуклеиновой кислотой в образце, контрольные реагенты, инструкции и тому подобное. Пригодные наборы могут содержать, например, праймеры для реакции QPCR или меченые зонды для выполнения FISH.
(b) на уровне полипептида
Измененную экспрессию гена или белка также можно обнаружить путем измерения полипептидов, кодируемых геном Akt3 или Akt2. Этого можно достигнуть путем использования молекул, которые связываются с полипептидами, кодируемыми геном АктЗ или Акт2. Пригодные молекулы/средства, которые связываются прямо или опосредованно с полипептидами с целью обнаружения присутствия белка, включают природные молекулы, такие как пептиды и белки, например антитела, или они могут являться синтетическими молекулами.
Антитела к генам или белкам Akt3 или Akt2 можно получить из коммерческих источников или с помощью методов, которые известны специалистам в данной области. В одном варианте осуществления и где измененная экспрессия проявляется посредством экспрессии изменения посттрансляционно модифицированных форм белкового биомаркера, можно применять антитела, специфичные к данным отличным формам.
Способы получения антител известны специалистам в данной области. Если требуются поликлональные антитела, выбранное млекопитающее (например, мышь, кролика, козу, лошадь и т.д.) иммунизируют иммуногенным полипептидом, несущим эпитоп(ы) из полипептида. Сыворотку иммунизированного животного собирают и обрабатывают в соответствии с известными методами. Если сыворотка, содержащая поликлональные антитела к эпитопу полипептида, содержит антитела к другим антигенам,
поликлональные антитела можно очистить путем иммуноаффинной хроматографии. Способы получения и обработки поликлональных антисывороток известны в данном уровне техники. С целью получения большего иммуногенного ответа полипептиды или их фрагменты можно гаптенизировать с другим полипептидом для использования в качестве иммуногенов у животных или человека.
Моноклональные антитела, направленные против эпитопов в полипептидах, также могут быть легко получены специалистом в данной области. Общая методика получения моноклональных антител с помощью гибридом хорошо известна. Бессмертные клеточные линии, продуцирующие антитела, можно создать путем слияния клеток, а также другими методами, такими как прямая трансформация В лимфоцитов с использованием онкогенной ДНК или трансфекция вирусом Эпштейна-Барра. Панели моноклональных антител, полученных против эпитопов в полипептидах по настоящему изобретению, можно скринировать на различные свойства; т. е. на изотип и аффинность к эпитопу.
Альтернативный метод включает скрининг библиотек фагового дисплея, где, например, фаги экспрессируют фрагменты scFv на поверхности своей оболочки с большим разнообразием определяющих комплементарность областей (CDR). Такой метод хорошо известен в данном уровне техники.
Для целей настоящего изобретения термин "антитело", если не указано иное, включает целые антитела или фрагменты целых антител, которые сохраняют свою активность связывания с антигеном-мишенью. Такие фрагменты включают Fv, F(ab') и F(ab')2 фрагменты, а также одноцепочечные антитела (scFv). Кроме того, антитела и их фрагменты могут являться гуманизированными антителами, например, как описано в патенте ЕР239400А. Например: моноклональные и поликлональные антитела, рекомбинантные антитела, протеолитические и рекомбинантные фрагменты антител (Fab, Fv, scFv, диатела), однодоменные антитела (VHH, sdAb, нанотела, IgNAR, VNAR), и белки, не относящиеся к антителам, которые сконструировали с целью получения специфического связывания наподобие связывания антител, такие как следующие:
Название На основании:
Аффитело Белок A, Z домен 6 кДа
Affitin Sac7d (из Sulfolobus acidocaldarius) 7 кДа
Антикалины Липокалины 20 кДа
Дарпин Мотив анкиринового повтора 14 кДа
Fynomer Fyn, SH3 домен 7 кДа
Пептиды домена Куница Различные ингибиторы протеаз 6 кДа Монотела Фибронектин
Стандартные лабораторные методы, такие как иммуноблоттинг, который описан выше, могут применяться для обнаружения измененных уровней активности АктЗ или Akt2 в сравнении с необработанными клетками в той же клеточной популяции.
Экспрессию гена также можно определять путем обнаружения изменений в посттрансляционном процессинге полипептидов или посттранскрипционной модификации нуклеиновых кислот. Например, можно измерять дифференциальное фосфорилирование полипептидов, расщепление полипептидов или альтернативный сплайсинг РНК и тому подобное. Уровни экспрессии генных продуктов, таких как полипептиды, а также их посттрансляционные модификации, можно обнаружить, применяя запатентованные анализы белка или методы, такие как 2D электрофорез в полиакрил амидном геле.
Антитела можно применять для обнаружения экспрессии АктЗ или Akt2 с помощью способа, который включает: (а) получение антитела; (Ь) инкубирование биологического образца с указанным антителом в условиях, которые позволяют образование комплекса антитело-антиген; и (с) определение, сформировался ли комплекс антитело-антиген, содержащий указанное антитело.
Пригодные образцы включают экстракты из тканей, таких как ткани мозга, молочной железы, яичников, легких, толстой кишки, поджелудочной железы, семенников, печени, мышц и костей, или из опухолевых новообразований, происходящих из таких тканей. Другие пригодные примеры включают образцы крови или мочи.
Антитела, которые специфически связываются с белками АктЗ или Акт2, можно применять в диагностических или прогностических способах и наборах, которые хорошо известны специалистам с обычной квалификацией в данной области, для обнаружения или количественного определения экспрессии белка АктЗ или Акт2 в жидкости или ткани организма. Результаты данных тестов можно использовать для диагностики или прогнозирования возникновения или рецидива рака и других заболеваний, опосредованных подвижностью клеток или выживанием клеток, или для оценки эффективности дозирования лекарственного средства и лечения.
Антитела можно анализировать на иммуноспецифическое связывание любым способом, известным в данном уровне техники. Иммуноанализы, которые могут применяться, включают, но без ограничений, конкурентные и неконкурентные аналитические системы, использующие методы, такие как вестерн-блоттинг, иммуногистохимия, радиоиммуноанализ, ELISA, иммунологический сэндвич-анализ, анализы иммунопреципитации, реакции преципитации, реакции диффузной преципитации в геле, иммунодиффузионные анализы, реакции агглютинации, реакции связывания
комплемента, иммунорадиометрические анализы, флуоресцентные иммуноанализы и иммуноанализы с белком А. Такие анализы являются рутинными в данном уровне техники (смотри, например, Ausubel et al, eds, 1994, Current Protocols in Molecular Biology, Vol. 1, John Wiley & Sons, Inc., New York, которая включена в качестве ссылки в данном документе во всей своей полноте).
Антитела для применения в настоящем изобретении предпочтительно связаны с твердой подложкой и/или упакованы в наборы в пригодном контейнере вместе с пригодными реагентами, контролями, инструкциями и т.п.
Другие способы включают, но без ограничений, 2D-PAGE, хотя он менее подходит для крупномасштабного скрининга. Более новые методы включают времяпролётную масс-спектрометрию с лазерной ионизацией и десорбцией из жидкой матрицы (MALDI-TOF MS). В анализе MALDI-TOF белки в сложной смеси закрепляют на твердой металлической матрице, десорбируют с помощью луча импульсного лазерного с генерацией ионов в газовой фазе, которые пролетают сквозь свободную от поля пролётную трубку, а затем разделяются в соответствии с их зависящими от массы скоростями. Отдельные белки и пептиды можно выявить посредством использования средств информатики для поиска баз данных белковых и пептидных последовательностей. Времяпролётная масс-спектрометрия с усиленной поверхностью лазерной десорбцией/ионизацией (SELDI-TOF MS) является способом MS на основе аффинности, в котором белки селективно адсорбируются на химически модифицированной твердой поверхности, примеси удаляют промывкой, применяют энергопоглощающую матрицу, и белки выявляют с помощью масс-спектрометрического анализа с лазерной десорбцией.
SELDI-TOF-MS может применяться для обнаружения появления/исчезновения либо интактных белков, либо фрагментов специфических белков. В дополнение SELDI-TOF-MS также может применяться для обнаружения посттрансляционных модификаций белков за счет разницы в массе, обусловленной добавлением/удалением химических групп. Таким образом, фосфорилирование одного остатка вызовет массовый сдвиг 80 Да за счет фосфатной группы. База данных молекулярных весов, которые можно объяснить посттрансляционными модификациями, находится в свободном доступе в интернете (http://www.abrf. org/mdex.cfm/dm.home?avgmass=alI). Более того специфические полипептиды можно улавливать с помощью подходов на основе аффинности, применяя SELDI-TOF-MS с использованием антител, которые специфически распознают посттрансляционно модифицированную форму белка, или которые могут одинаково хорошо распознавать все формы белка.
Матрицы
Матричная технология и различные методы, и области применения, связанные с ней, в целом описаны в многочисленных руководствах и документах. К их числу относятся Lemieux et al, 1998, Molecular Breeding 4:277-289; Schena and Davis. Parallel Analysis with Biological Chips, in PCR Methods Manual (eds. M. Innis, D. Gelfand, J. Sninsky); Schena and Davis, 1999, Genes, Genomes and Chips. In DNA Microarrays: A Practical Approach (ed. M. Schena), Oxford University Press, Oxford, UK, 1999); The Chipping Forecast (Nature Genetics special issue; January 1999 Supplement); Mark Schena (Ed.), Microarray Biochip Technology, (Eaton Publishing Company); Cortes, 2000, The Scientist 14(17):25; Gwynne and Page, Microarray analysis: the next revolution in molecular biology, Science, 1999, August 6; Eakins and Chu, 1999, Trends in Biotechnology, 17:217-218, а также на различных сайтах сети интернет.
Матричная технология устраняет недостатки традиционных способов в молекулярной биологии, которые обычно работают, учитывая "один ген в одном эксперименте", что приводит к низкой производительности и невозможности оценить "полную картину" функции гена. В настоящее время основные виды применения матричной технологии включают выявление последовательности (гена / генной мутации) и определение уровня экспрессии (содержания) генов. В анализе экспрессии генов может применяться матричная технология, необязательно в комбинации с методами протеомики (Celis et al, 2000, FEBS Lett, 480(1):2-16; Lockhart and Winzeler, 2000, Nature 405(6788):827-836; Khan et al, 1999, 20(2):223-9). Другие области применения матричной технологии также известны в данном уровне техники; например, поиск новых генов, исследования рака (Marx, 2000, Science 289: 1670-1672; Scherf et alet al, 2000, Nat Genet 24(3):236-44; Ross et al, 2000, Nat Genet 2000, 24(3):227-35), SNP анализ (Wang et al, 1998, Science 280(5366): 1077-82), поиск новых лекарственных средств, фармакогеномика, диагностика заболеваний (например, использование устройств микрогидродинамики: Chemical & Engineering News, February 22, 1999, 77(8):27-36), токсикология (Rockett and Dix (2000), Xenobiotica 30(2): 155-77; Afshari et al, 1999, Cancer Res 59(19):4759-60) и токсикогеномика (гибрид функциональной геномики и молекулярной токсикологии). Целью токсикогеномики является поиск корреляции между токсическими реакциями на токсиканты и изменениями в генетических профилях объектов, подвергающихся воздействию таких токсикантов (Nuwaysir et al, 1999, Molecular Carcinogenesis 24:153159).
В контексте настоящего изобретения матричная технология может применяться, например, при анализе экспрессии бежа Akt3 или Akt2 или мРНК. В одном варианте осуществления матричная технология может применяться для анализа влияния
кандидатного соединения на активность АктЗ.
В целом, любую библиотеку или группу образцов можно упорядочение поместить в матрицу путем пространственного разделения членов библиотеки или группы. Примеры пригодных библиотек для создания матриц включают библиотеки нуклеиновых кислот (включая библиотеки ДНК, кДНК, олигонуклеотидов и т.д.), библиотеки пептидов, полипептидов и белков, а также библиотеки, содержащие любые молекулы, такие как библиотеки лигандов, в числе прочих. Соответственно, когда в данном документе делается ссылка на "библиотеки", если в контексте не указано иное, такую ссылку следует принимать как относящуюся к ссылке на библиотеку в виде матрицы.
Образцы (например, члены библиотеки), как правило, фиксированы или иммобилизованы на твердой фазе, предпочтительно твердом субстрате, для ограничения диффузии и смешивания образцов. В предпочтительном варианте осуществления можно получить библиотеки ДНК-связывающих лигандов. В частности, библиотеки можно иммобилизовать на существенно плоской твердой фазе, включая мембраны и непористые подложки, такие как пластик и стекло. Кроме того, образцы предпочтительно расположены таким образом, что облегчается индексирование (т.е. ссылка или доступ к конкретному образцу). Как правило, образцы наносятся в виде точек в сетчатую структуру. Для данной цели можно адаптировать обычные системы анализа. Например, матрицу можно иммобилизовать на поверхности микропланшета, либо с несколькими образцами в лунке, либо с одним образцом в каждой лунке. Кроме того, твердая подложка может являться мембраной, такой как нитроцеллюлозная или найлоновая мембрана (например, мембраны, применяемые в методах блоттинга). Альтернативные подложки включают подложки на основе стекла или оксида кремния. Таким образом, образцы иммобилизуют любым пригодным способом, известным в данном уровне техники, например, путем взаимодействия зарядов или путем химического соединения со стенками или дном лунки или поверхностью мембраны. Можно применять другие средства размещения и фиксации, например, отмеривание пипеткой, нанесение каплями, пьезоэлектрические средства, струйная и пузырьково-струйная технологии, электростатическое нанесение и т.д. В случае чипов на кремниевой основе можно использовать фотолитографию для размещения и фиксации образцов на чипе.
Образцы можно размещать путем "точечного нанесения" на твердую подложку; это можно выполнять вручную или путем использования робототехники для нанесения образца. В целом, матрицы можно описать как макроматрицы или микроматрицы, причем разницу составляет размер капель образцов. Макроматрицы обычно включают размер капель образцов около 300 микрон или больше, и их изображение можно легко получить с
помощью существующих гель- и блот-сканеров. Размеры капель образцов в микроматрицах, как правило, составляют менее 200 микрон в диаметре, и данные матрицы обычно содержат тысячи капель. Таким образом, для микроматриц может требоваться специализированная робототехника и оборудование для получения изображений, которые, возможно, должны быть выполнены по заказу. Применение технических средств в целом описано в обзоре Cortese, 2000, The Scientist 14(11):26.
В данном уровне техники описаны методы получения иммобилизованных библиотек молекул ДНК. В целом, большинство способов известного уровня техники описывали, как синтезировать библиотеки одноцепочечных молекул нуклеиновых кислот, применяя, например, методы маскирования для создания различных пермутаций последовательностей в различных дискретных положениях на твердой подложке. Патент США № 5837832, содержание которого включено в данный документ в качестве ссылки, описывает усовершенствованный способ получения матриц ДНК, иммобилизованных на кремниевых подложках, на основании технологии интеграции очень большого масштаба. В частности, патент США № 5837832 описывает стратегию под названием "мозаичное размещение" для синтеза специфических наборов зондов в пространственно-определенных местах на подложке, которые могут применяться для получения иммобилизованных библиотек ДНК по настоящему изобретению. Патент США № 5837832 также предусматривает ссылки на более ранние методы, которые также могут применяться.
Матрицы пептидов (или пептидомиметиков) также можно синтезировать на поверхности таким образом, чтобы поместить каждого отдельного члена библиотеки (например, уникальную пептидную последовательность) в дискретном, заранее определенном местоположении в матрице. Выявленная информация каждого члена библиотеки определяется его пространственным расположением в матрице. Определяют местоположения в матрице, где происходят связывающие взаимодействия между заранее определенной молекулой (например, мишень или зонд) и реактивными членами библиотеки, тем самым выявляя последовательности реактивных членов библиотеки на основании пространственного расположения. Данные способы описаны в патентах США № 5143854; WO 90/15070 и WO 92/10092; Fodor et al, 1991, Science 251:767; Dower and Fodor, \99\, Ann. Rep. Med. Chem. 26:271.
Для облегчения обнаружения мишени и зонды можно метить любым легко обнаруживаемым репортером, например, флуоресцентным, биолюминесцентным, фосфоресцентным, радиоактивным и т.д. репортером. Такие репортеры, их обнаружение, связывание с мишенями/зондами и т.д. рассматриваются в другом месте в данном
документе. Маркировка зондов и мишеней также раскрыта в Shalon et al, 1996, Genome Res 6(7):639-45.
Конкретные примеры матриц ДНК включают следующие:
Формат I: зонд кДНК (~500 - ~5000 оснований в длину) иммобилизуют на твердой поверхности, такой как стекло, применяя точечное нанесение с помощью робота, и подвергают воздействию набора мишеней либо отдельно, либо в смеси. Данный способ широко признан, так как был разработан в Стэнфордском университете (Ekins and Chu, 1999, Trends in Biotechnology, 17:217-218).
Формат II: матрица зондов олигонуклеотидов (-20 -25-мерные олигомеры) или пептидных нуклеиновых кислот (PNA) синтезируется либо in situ (на чипе), либо путем обычного синтеза с последующей иммобилизацией на чипе. Матрица подвергается воздействию меченой контрольной ДНК, гибридизируется, и определяется выявленная информация/содержание комплементарных последовательностей. Такой ДНК-чип продается у Affymetrix, Inc., под товарным знаком GeneChip(r).
Примеры некоторых коммерчески доступных форматов микроматриц приведены, например, в Marshall and Hodgson, 1998, Nature Biotechnology 16(1):27-31.
Анализ данных также является важной частью эксперимента с участием матриц. Необработанные данные эксперимента с микроматрицами, как правило, являются изображениями, которые необходимо преобразовать в матрицы экспрессии генов -таблицы, где строки представляют, например, гены, столбцы представляют, например, различные образцы, такие как ткани, или экспериментальные условия, и цифры в каждой ячейке, например, характеризуют уровень экспрессии конкретного гена в конкретном образце. Данные матрицы следует анализировать дополнительно, если необходимо извлечь какие-либо сведения о лежащих в основе биологических процессах. Способы анализа данных (включая контролируемые и неконтролируемые анализы данных, а также подходы биоинформатики) раскрыты в Brazma and Vilo J, 2000, FEBSLett 480(l):17-24.
Как раскрыто выше, белки, полипептиды и т.д. также можно иммобилизовать в матрицах. Например, антитела применялись в микроматричном анализе протеома с использованием белковых чипов (Borrebaeck СА, 2000, Immunol Today 21(8):379-82). Полипептидные матрицы рассматриваются, например, в MacBeath and Schreiber, 2000, Science, 289(5485): 1760-1763.
Фармацевтическая композиция
Дополнительный аспект относится к фармацевтической композиции, содержащей ингибитор Akt3 или другое средство, выявленное в соответствии с любым из вышеописанных способов, в смеси с фармацевтически приемлемым разбавителем,
вспомогательным веществом или носителем.
Для применения в соответствии с настоящим изобретением средство может быть представлено виде фармацевтического состава, содержащего соединения или их физиологически приемлемую соль, сложный эфир или другое физиологически функциональное производное, вместе с одним или несколькими фармацевтически приемлемыми носителями и, необязательно, другими терапевтическими и/или профилактическими ингредиентами. Носитель (носители) должен являться приемлемым с точки зрения совместимости с другими ингредиентами состава и не оказывать вредного воздействия на его реципиента. Фармацевтические композиции могут применяться для человека или животного в медицине и ветеринарной медицине.
Примеры таких пригодных вспомогательных веществ для многообразных различных форм фармацевтических композиций, описанных в данном документе, можно найти в "Handbook of Pharmaceutical Вспомогательные вещества", 2nd Edition, (1994), Edited by A Wade and PJ Weller.
Приемлемые носители или разбавители для терапевтического применения хорошо известны в фармацевтической области и описаны, например, в Remington's Pharmaceutical Sciences, Mack Publishing Co. (A. R. Gennaro edit. 1985).
Примеры пригодных носителей включают лактозу, крахмал, глюкозу, метилцеллюлозу, стеарат магния, маннит, сорбит и тому подобное. Примеры пригодных разбавителей включают этанол, глицерин и воду.
Отбор фармацевтического носителя, вспомогательного вещества или разбавителя может осуществляться с учетом предполагаемого пути введения и стандартной фармацевтической практики. Фармацевтические композиции могут содержать в качестве или в дополнение к носителю, вспомогательному веществу или разбавителю любое пригодное связывающее(связьшающие) вещество(вещества), скользящее(скользящие) вещество(вещества), суспендирующее средство(средства), покрывающее средство(средства), солюбилизирующее средство(средства), буфер(ы), ароматизирующее средство(средства), поверхностно-активное средство (средства), загуститель(загустители), консервант(ы) (включая антиоксиданты) и тому подобное, и вещества, включаемые с целью довести состав до изотонического состояния с кровью предполагаемого реципиента.
Примеры пригодных связывающих веществ включают крахмал, желатин, природные сахара, такие как глюкоза, безводная лактоза, легко сыпучая лактоза, бета-лактоза, сахаристое вещество из кукурузы, природные и синтетические камеди, такие как аравийская камедь, трагакантовая камедь или альгинат натрия, карбоксиметилцеллюлозу
и полиэтиленгликоль.
Примеры пригодных скользящих веществ включают олеат натрия, стеарат натрия, стеарат магния, бензоат натрия, ацетат натрия, хлорид натрия и тому подобное.
Консерванты, стабилизаторы, красители и даже ароматизирующие средства могут предусматриваться в фармацевтической композиции. Примеры консервантов включают бензоат натрия, сорбиновую кислоту и сложные эфиры п-гидроксибензойной кислоты. Также могут применяться антиоксиданты и суспендирующие средства.
Фармацевтические составы включают составы, пригодные для перорального, местного (в том числе накожного, трансбуккального и подъязычного), ректального или парентерального (включая подкожное, внутрикожное, внутримышечное и внутривенное), назального и легочного введения, например, путем ингаляции. Состав можно, при необходимости, в целях удобства представить в виде отдельных единиц дозирования и можно получить любым из способов, хорошо известных в области фармацевтики. Все способы включают этап, на котором обеспечивают объединение активного соединения с жидкими носителями или тонко измельченными твердыми носителями, или и теми, и другими, а затем, при необходимости, придают продукту форму требуемого состава.
Фармацевтические составы, пригодные для перорального введения, где носитель является твердым веществом, наиболее предпочтительно представлены в виде составов на одну дозу, таких как болюсы, капсулы или таблетки, каждый из которых содержит заданное количество действующего вещества. Таблетка может изготавливаться посредством прессования или формования, необязательно с одним или несколькими вспомогательными ингредиентами. Прессованные таблетки можно получать прессованием в соответствующей машине действующего вещества в сыпучей форме, такой как порошок или гранулы, необязательно смешанной со связывающим веществом, скользящим веществом, инертным разбавителем, смазывающим веществом, поверхностно-активным средством или диспергирующим средством. Формованные таблетки можно получать формованием действующего вещества с инертным жидким разбавителем. Таблетки необязательно можно покрывать оболочкой и, если без оболочки, на таблетки необязательно можно наносить насечки. Капсулы можно получать, помещая действующее вещество, либо отдельно, либо в смеси с одним или несколькими вспомогательными ингредиентами, в капсульные оболочки с последующей их герметизацией обычным способом. Крахмальные капсулы аналогичны капсулам, где действующее вещество вместе с любым вспомогательным ингредиентом (ингредиентами) помещается в оболочку из рисовой бумаги. Действующее вещество также находиться в составе диспергируемых гранул, которые можно, например, суспендировать в воде перед
применением или посыпать на пищевой продукт. Гранулы можно упаковывать, например, в саше. Составы, пригодные для перорального введения, где носитель является жидкостью, можно представить в виде раствора или суспензии в водной или неводной жидкой фазе, или в виде жидкой эмульсии типа масло-в-воде.
Составы для перорального введения включают лекарственные формы с контролируемым высвобождением, например таблетки, где действующее вещество находится в составе соответствующей матрицы, контролирующей высвобождение, или покрыто пригодной пленкой, контролирующей высвобождение. Такие составы могут являться особенно удобными для профилактического применения.
Фармацевтические составы, пригодные для ректального введения, где носитель является твердым веществом, наиболее предпочтительно представлены в виде суппозиториев на одну дозу. Пригодные носители включают масло какао и другие материалы, обычно применяемые в данной области. Суппозитории можно в целях удобства формировать путем смешивания действующего вещества с размягченным или расплавленным носителем (носителями) с последующим охлаждением и приданием формы в шаблонах.
Фармацевтические составы, пригодные для парентерального введения, включают стерильные растворы или суспензии действующего вещества в водных или масляных носителях.
Препараты для инъекций можно адаптировать для болюсной инъекции или непрерывной инфузии. Такие препараты в целях удобства представлены в виде однодозовых или многодозовых контейнеров, которые герметизируются после внесения состава до момента использования. Альтернативно, действующее вещество может находиться в форме порошка, который перед применением составляют с пригодным носителем, таким как стерильная апирогенная вода.
Активное соединение также может находиться в составе депо-препаратов длительного действия, которые можно вводить путем внутримышечной инъекции или путем имплантации, например, подкожно или внутримышечно. Депо-препараты могут содержать, например, пригодные полимерные или гидрофобные материалы, или ионообменные смолы. Такие длительно действующие составы особенно подходят для профилактического применения.
Составы, пригодные для легочного введения через ротовую полость, представлены таким образом, что частицы, содержащие активное соединение и, желательно, обладающие диаметром в диапазоне от 0,5 до 7 микрон, доставляются в бронхиальное дерево реципиента.
Один из возможных вариантов состоит в том, что такие составы находятся в форме тонко измельченных порошков, которые в целях удобства могут находиться либо в проницаемой капсуле, предпочтительно, например, из желатина для использования в устройстве для ингаляции, либо, альтернативно, в виде самораспыляющегося состава, содержащего действующее вещество, пригодный жидкий или газообразный пропеллент и, необязательно, другие ингредиенты, такие как поверхностно-активное вещество и/или твердый разбавитель. Пригодные жидкие пропелленты включают пропан и хлорфторуглеводы, а пригодные газообразные пропелленты включают двуокись углерода. Самораспыляющиеся составы также могут использоваться там, где действующее вещество дозируется в виде капель раствора или суспензии.
Такие самораспьшяющиеся составы аналогичны тем, которые известны в данном уровне техники, и могут изготавливаться общепринятыми способами. Соответственно, они представлены в контейнере, снабженном либо ручным, либо автоматически функционирующим клапаном, обладающим требуемыми характеристиками распыления; предпочтительно, клапан дозирующего типа, доставляющий фиксированный объем, например, от 25 до 100 микролитров при каждом приведении его в действие.
В качестве дополнительной возможности, действующее вещество может находиться в форме раствора или суспензии для применения в аэрозольном ингаляторе или распылителе, при помощи которого ускоренный поток воздуха или ультразвуковое встряхивание используется для получения мелкокапельного аэрозоля для ингаляции.
Составы, пригодные для назального введения, включают препараты, как правило, подобные тем, которые описаны выше для легочного введения. При дозировании такие составы, предпочтительно, должны обладать диаметром частиц в диапазоне от 10 до 200 микрон для обеспечения задержки в носовой полости; этого можно достичь, при необходимости, путем применения порошка с пригодным размером частиц или путем выбора соответствующего клапана. Другие пригодные составы включают крупные порошки, обладающие диаметром частиц в диапазоне от 20 до 500 микрон, для введения путем быстрого вдыхания через носовой ход из контейнера, который придерживают возле носа, и назальные капли, содержащие от 0,2 до 5% в отношении веса к объему действующего вещества в водном или масляном растворе или суспензии.
Фармацевтически приемлемые носители хорошо известны специалистам в данной области и включают, но без ограничений, 0,1 М, а предпочтительно, 0,05 М фосфатный буфер или 0,8% солевой раствор. В дополнение, такие фармацевтически приемлемые носители могут являться водными или неводными растворами, суспензиями и эмульсиями. Примерами неводных растворителей являются пропиленгликоль,
полиэтиленгликоль, растительные масла, такие как оливковое масло, и инъекционные органические сложные эфиры, такие как этилолеат. Водные носители включают воду, спиртовые/водные растворы, эмульсии или суспензии, включая солевые и буферные среды. Носители для парентерального введения включают раствор хлорида натрия, раствор Рингера с декстрозой, декстрозу и хлорид натрия, раствор Рингера с лактатом или нелетучие масла. Также могут присутствовать консерванты и другие добавки, такие как, например, антимикробные средства, антиоксиданты, хелатообразующие вещества, инертные газы и тому подобное.
Составы, пригодные для местного применения могут обеспечиваться, например, в виде гелей, кремов или мазей. Такие препараты могут применяться, например, на рану или язву либо непосредственно распределяясь по поверхности раны или язвы, либо находясь на соответствующей основе, такой как бинт, марля, сетка или т.п., которую можно прикладывать к области и накладывать на нее, подлежащую лечению.
Также могут предусматриваться жидкие или порошкообразные составы, которые можно распылять или посыпать непосредственно на участок, подлежащий лечению, например, на рану или язву. Альтернативно, состав можно распылять или насыпать на носитель, такой как бинт, марля, сетка или т.п., а затем нанести на участок, подлежащий лечению.
В соответствии с дополнительным аспектом настоящего изобретения предусмотрен способ получения фармацевтической или ветеринарной композиции, описываемой выше, причем способ включает объединение активного соединения (соединений) с носителем, например, путем примешивания.
В целом, составы получают равномерно и тщательно, объединяя действующее вещество с жидкими носителями или тонко измельченными твердыми носителями, или и теми и другими, а затем, при необходимости, придавая форму продукту. Настоящее изобретение распространяется на способы получения фармацевтической композиции, которые включают объединение средства с фармацевтически или ветеринарно приемлемым носителем или наполнителем.
Введение
Фармацевтические композиции по настоящему изобретению можно адаптировать для ректального, назального, внутрибронхиального, местного (включая трансбуккальное и подъязычное), вагинального или парентерального (включая подкожное, внутримышечное, внутривенное, внутриартериальное и внутрикожное), внутрибрюшинного или интратекального введения. Предпочтительно, состав является составом для перорального введения. Составы в целях удобства могут находиться в единичной лекарственной форме,
т.е. в форме отдельных порций, содержащих однократную дозу или несколько доз, или субъединицы однократной дозы. В качестве примера, составы могут находиться в форме таблеток и капсул с замедленным высвобождением, и могут быть получены любым способом, хорошо известным в области фармацевтики.
Составы для перорального введения по настоящему изобретению могут находиться в виде: отдельных единиц, таких как капсулы, желатиновые капсулы, капли, крахмальные капсулы, пилюли или таблетки, каждая из которых содержит определенное количество действующего вещества; в виде порошка или гранул; в виде раствора, эмульсии или суспензии действующего вещества в водной жидкой фазе или неводной жидкой фазе; или в виде жидкой эмульсии типа масло-в-воде или жидкой эмульсии типа вода-в-масле; или в виде болюса и т.д. Предпочтительно, данные композиции содержат от 1 до 250 мг и, более предпочтительно, от 10-100 мг активного ингредиента на дозу.
Для композиций для перорального введения (например, таблеток и капсул), термин "приемлемый носитель" включает несущие среды, такие как распространенные вспомогательные вещества, например, связывающие средства, например, сироп, гуммиарабик, желатин, сорбит, трагакант, поливинилпирролидон (повидон), метилцеллюлозу, этилцеллюлозу, натриевую соль карбоксиметилцеллюлозы, гидроксипропилметилцеллюлозу, сахарозу и крахмал; наполнители и носители, например, кукурузный крахмал, желатин, лактозу, сахарозу, микрокристаллическую целлюлозу, каолин, маннит, дикальцийфосфат, хлорид натрия и альгиновую кислоту; и скользящие вещества, такие как стеарат магния, стеарат натрия и стеараты других металлов, стеарат глицерина, стеариновую кислоту, силиконовую жидкость, тальк воски, масла и коллоидный кремнезем. Также могут применяться ароматизирующие вещества, такие как мята перечная, масло грушанки, вишневый ароматизатор и т.п.. Может требоваться добавление красителя для того, чтобы сделать лекарственную форму легко выявляемой. Таблетки также можно покрывать оболочкой с помощью способов, хорошо известных в данном уровне техники.
Таблетку можно получить посредством прессования или формования, необязательно с одним или несколькими вспомогательными ингредиентами. Прессованные таблетки можно получать прессованием в пригодной машине действующего вещества в сыпучей форме, такой как порошок или гранулы, необязательно смешанной со связывающим веществом, скользящим веществом, инертным разбавителем, консервантом, поверхностно-активным веществом или диспергирующим средством. Формованные таблетки можно получать формованием в пригодной машине смеси порошкообразного соединения, увлажненного инертным жидким разбавителем. Таблетки
необязательно можно покрывать оболочкой или наносить на них насечки, и можно составлять таким образом, чтобы обеспечить медленное или контролируемое высвобождение действующего вещества.
Другие составы, пригодные для перорального введения, включают леденцы, содержащие действующее вещество в ароматизированной основе, обычно в сахарозе и гуммиарабике или трагаканте; пастилки, содержащие действующее вещество в инертной основе, такой как желатин и глицерин, или сахароза и гуммиарабик; и жидкости для полоскания рта, содержащие действующее вещество в пригодном жидком носителе.
Другие формы введения включают растворы или эмульсии, которые можно инъецировать внутривенно, внутриартериально, интратекально, подкожно, внутрикожно, внутрибрюшинно или внутримышечно, и которые получают из стерильных или стерилизуемых растворов. Инъекционные формы, как правило, содержат от 10 до 1000 мг, предпочтительно от 10 до 250 мг активного ингредиента на дозу.
Фармацевтические композиции по настоящему изобретению также могут находиться в форме суппозиториев, пессариев, суспензий, эмульсий, лосьонов, мазей, кремов, гелей, спреев, растворов или присыпок.
Альтернативным способом трансдермального введения является применение трансдермального пластыря. Например, активный ингредиент можно включать в состав крема, содержащего водную эмульсию полиэтиленгликолей или жидкого парафина. Активный ингредиент также можно включать в концентрации от 1 до 10% по весу в состав мази, содержащей белый воск или белый мягкий парафин в качестве основы, вместе с такими стабилизаторами и консервантами, которые могут потребоваться.
Дозирование
Специалист с обычной квалификацией в данной области может легко определить соответствующую дозу одной из настоящих композиций для введения субъекту без излишнего экспериментирования. Как правило, врач определит фактическую дозировку, которая наиболее подходит для отдельного пациента, и она будет зависеть от множества факторов, включающих активность конкретного используемого средства, устойчивость к инактивации в процессе метаболизма и продолжительность действия данного средства, возраст, вес тела, общее состояние здоровья, пол, режим питания, способ и время введения, скорость экскреции, комбинацию лекарственных средств, тяжесть конкретного состояния и индивидуума, подвергаемого лечению. Дозировки, раскрываемые в данном документе, являются иллюстративными в среднем случае. Как известно, могут существовать отдельные случаи, когда более высокие или более низкие диапазоны доз являются преимущественными, и они входят в объем данного изобретения.
В соответствии с настоящим изобретением можно вводить эффективное количество средства для ингибирования АктЗ. Как известно, данная величина дозы дополнительно будет модифицирована в соответствии с типом введения средства. Например, для достижения "эффективного количества" в краткосрочной терапии предпочтительно парентеральное введение. Внутривенная инфузия соединения в 5% декстрозы в воде или физиологическом растворе, или подобном составе с пригодными вспомогательными веществами является наиболее эффективной, хотя внутримышечная болюсная инъекция также применима. Как правило, парентеральная доза составляет от около 0,01 до около 100 мг/кг; предпочтительно от 0,1 до 20 мг/кг, таким образом, чтобы поддерживать концентрацию лекарственного средства в плазме в концентрации, эффективной для ингибирования киназы. Средства можно вводить от одного до четырех раз в сутки на таком уровне, чтобы достичь общей суточной дозы от около 0,4 до около 400 мг/кг/сутки. Точное количество действующего вещества, которое является терапевтически эффективным, и путь, с помощью которого такое действующее вещество лучше всего вводить, легко определяется специалистом с обычной квалификацией в данной области путем сравнения уровня действующего вещества в крови с концентрацией, требуемой для достижения терапевтического эффекта.
Средства по настоящему изобретению также можно вводить пациенту перорально, таким образом, чтобы концентрация лекарственного средства являлась достаточной для выполнения одного или нескольких терапевтических показаний к применению, раскрытых в данном документе. Как правило, фармацевтическую композицию, содержащую средство, вводят в дозе для приема внутрь от около 0,1 до около 50 мг/кг в соответствии с состоянием пациента. Предпочтительно доза для приема внутрь составляет от около 0,5 до около 20 мг/кг.
Средства по настоящему изобретению можно протестировать в одном из нескольких биологических анализов для определения концентрации средства, которая требуется для достижения заданного фармакологического эффекта.
Набор частей
Другой аспект настоящего изобретения относится к набору, содержащему ингибитор АктЗ, антитело к АктЗ, зонд нуклеиновой кислоты для АктЗ или по меньшей мере один QPCR праймер для АктЗ, для применения в любом из вышеописанных способов.
Диагностика и прогнозирование
Настоящее изобретение также относится к применению АктЗ в качестве биомаркера в диагностике или прогнозировании заболеваний, характеризующихся
пролиферативной активностью, особенно у отдельных пациентов, подвергаемых лечению ингибиторами АктЗ.
Применяемый в данном документе термин "прогностический способ" означает способ, который дает возможность прогнозирования в отношении прогрессирования заболевания человека или животного с диагнозом заболевания, в частности, рака. Более конкретно, виды рака, представляющие интерес, включают виды рака молочной железы, легких, желудка, головы и шеи, толстой и прямой кишки, почек, поджелудочной железы, матки, печени, мочевого пузыря, эндометрия и предстательной железы и лейкозы.
Термин "диагностический способ", применяемый в данном документе, означает способ, который позволяет определить наличие или тип рака у или на человеке или животном. Соответственно маркер обеспечивает возможность оценки успеха в лечении с помощью ингибитора АктЗ. Как отмечалось выше, соответствующая диагностика включает зонды, направленные на любой из генов, которые выявлены в данном документе, такие как, например, праймеры для QPCR, зонды для FISH и так далее.
Термин "прогностический способ", применяемый в данном документе, означает способ, который позволяет определить вероятность того, будет ли субъект поддаваться лечению или отвечать на лечение с использованием конкретного средства/схемы. Такие прогностические способы предоставляют информацию о возможном результате определенной схемы лечения, например, вероятности возникновения у субъекта ответа на указанное лечение, и/или информацию о том, насколько активно следует лечить отдельного пациента в пределах определенной схемы лечения, и/или насколько активно следует лечить отдельного пациента обычными терапевтическими способами, такими как радио/химиотерапия. Прогностические способы, описываемые в данном документе, следовательно, имеют немаловажное применение в области персонализированной медицины.
Один предпочтительный вариант осуществления, таким образом, относится к использованию биомаркера, который описан выше, в практическом применении персонализированной медицины.
В одном предпочтительном варианте осуществления персонализированная медицина применяется для определения того, будет ли субъект поддаваться лечению или отвечать на лечение ингибитором АктЗ или Axl.
В одном предпочтительном варианте осуществления персонализированная медицина применяется для определения особой вероятности того, страдает ли субъект от метастатического рака.
Другой аспект настоящего изобретения относится к прогностическому способу для
определения того, будет ли субъект поддаваться лечению ингибитором Akt3 или Axl, причем указанный способ включает обнаружение возникновения эпителиально-мезенхимального перехода (ЕМТ) у указанного субъекта.
Другой аспект настоящего изобретения относится к применению Akt3 в качестве биомаркера в прогностическом средстве для определения того, будет ли субъект поддаваться лечению или отвечать на лечение ингибитором Akt3 или Axl.
Другой аспект настоящего изобретения относится к прогностическому способу для определения особой вероятности того, страдает ли субъект от метастатического рака, причем указанный способ включает обнаружение возникновения эпителиально-мезенхимального перехода (ЕМТ) у указанного субъекта.
Во всем описании, предпочтительно, способы, описываемые в данном документе, выполняются in vitro или ex vivo.
Настоящее изобретение теперь будет описано более подробно, в качестве примера, но не ограничения, со ссылкой на прилагаемые графические материалы. Многие эквивалентные модификации и варианты будут очевидны специалистам в данной области, принимая во внимание данное раскрытие. Соответственно, изложенные варианты осуществления настоящего изобретения, приводимые в качестве примера, рассматриваются как иллюстративные, а не ограничивающие. Различные изменения в описанных вариантах осуществления можно выполнять без отступления от сущности и объема настоящего изобретения. Все документы, цитированные в данном документе, явным образом включены посредством ссылки.
Краткое описание графических материалов
Фигура 1 является набором фотографий иммуноблотов, изображающих результаты экспериментов эпителиальных клеток молочной железы, подвергающихся ЕМТ;
на фигуре 2 показано, что Akt3 активируется, когда клетки рака молочной железы подвергаются ЕМТ, и данные изменения являются Ах1-зависимыми;
на фигуре 3 показано, что Akt3, а не Aktl, подавляется в ответ на ингибирование Axl в клетках рака молочной железы с тройным негативным фенотипом;
фигура 4 является набором фотографий иммуноблотов, определяющих уровни изоформ Akt в ЕМТ-индуцированных клетках рака молочной железы;
на фигуре 5 показано, что мРНК Akt3, а не Akt 1 и 2, коррелирует с ЕМТ и генами стволовых клеток в клетках рака молочной железы и биоптатах рака молочной железы;
на фигуре 6 показано, что подавление экспрессии Akt3 способно обратить ЕМТ и признаки CSC в эпителиальных клетках молочной железы;
фигура 7 является фотографией гель-экспериментов в отношении активности изоформ Akt;
фигура 8 является фотографией исследований роста клеток рака молочной железы; фигура 9 является набором фотографий культур маммосфер клеток рака молочной железы и графиком;
на фигуре 10 показано, что конститутивно-активная АктЗ (туг-АктЗ), но не конститутивно-активная Aktl, способна индуцировать ЕМТ;
на фигуре 11 показано, что конститутивно-активная АктЗ (МугАктЗ), но не конститутивно-активная Aktl, способна индуцировать ЕМТ и признаки CSC в эпителиальных клетках молочной железы;
на фигуре 12 показано, что клетки, экспрессирующие конститутивно активную Akt3, но не клетки, экспрессирующие конститутивно активную Aktl, демонстрируют способность к росту в маммосферы;
на фигуре 13 показано, что клетки, экспрессирующие конституитивно активную АктЗ, демонстрируют намного более высокую способность к образованию опухолей, чем клетки, экспрессирующие конститутивно активную Aktl;
фигура 14 является фотографией исследований роста клеток рака молочной железы;
фигура 15 является изображением геля из экспериментов, в которых клетки рака молочной железы обрабатывали ингибитором Akt; и
фигура 16 является фотографией гелей из экспериментов по изучению активности изоформ Akt;
на фигуре 17 показано, что конституитивно активная АктЗ, но не конститутивно активная Aktl, локализуется в ядре клетки;
на фигуре 18 показано, что АктЗ и Snail обнаружены в ядерной фракции;
на фигуре 19 показано, что АктЗ локализуется в ядре в культивируемых клетках рака молочной железы с тройным негативным фенотипом и первичных клетках эпителия молочной железы человека;
на фигуре 20 показано, что подавление экспрессии киназы Axl уменьшает ядерную локализацию Akt3, индуцированную ЕМТ;
на фигуре 21 показано, что ингибирование активности киназы Axl ингибирует ядерную локализацию АктЗ;
на фигуре 22 показано, что киназы Aktl и АктЗ способны непосредственно фосфорилировать белок Snail;
на фигуре 23 показано специфическое обнаружение фосфо-АктЗ в клетках MCF7,
WM115HLNCaP. Примеры
Пример 1 Если эпителиальные клетки молочной железы подвергаются ЕМТ, Akt3 активируется, в то время как Akt2 подавляется, и данные изменения являются Axl-зависимыми
Клетки MCF10A (Американская коллекция типовых культур), линию эпителиальных клеток молочной железы, применяемую в качестве модели нормальных эпителиальных клеток молочной железы, культивировали в среде DMEM/F12 с добавлением 5% лошадиной сыворотки, 20 нг/мл EGF, 0,5 мкг/мл гидрокортизона, 100 нг/мл холерного токсина, 10 мкг/мл инсулина, 100 Ед/мл пенициллина и 100 мкг/мл стрептомицина (Sigma-Aldrich). Клетки MCF10A применяли в данном эксперименте вместе с ретровирусным вектором ("Slug"), стимулирующим экспрессию ЕМТ индуктора Slug, и ретровирусным вектором ("Ах12"), стимулирующим экспрессию shRNA, которая понижает экспрессию Axl (векторы описаны в (Gjerdrum С et al. Axl is an essential epithelial-to-mesenchymal transition-induced regulator of breast cancer metastasis and patient survival. Proc Natl Acad Sci U S A. 2010 Jan 19; 107(3): 1124-9). Вкратце, Axl shRNA экспрессировали на основании модифицированного промотора U6 человека в LTR ретровирусных векторов RRI-Red/L087 (GenBank: EU424173), в то время как последовательность Slug кДНК человека из ВС012910 (Open Biosystems) клонировали в CRU5-IRES-GFP ретровирусный вектор (Lorens JB, Jang Y, Rossi AB, Payan DG, Bogenberger JM (2000) Optimization of regulated LTR-mediated expression. Virology 272:715).
Клетки MCF10A трансдуцировали либо с использованием ретровирусного вектора "Slug" отдельно, либо с использованием комбинации ретровирусных векторов "Slug" и "Ах12". Контрольные клетки не трансдуцировали никаким вектором. Белковые экстракты получали из контрольных и трансдуцированных клеточных популяций посредством лизиса в буфере RIPA (PBS с 1% (в объемном отношении) Nonidet Р-40 (Nonidet Р-40), 0,5% (в отношении веса к объему) дезоксихолат натрия и 0,1% (в отношении веса к объему) SDS) с добавлением ингибитора протеазы (13457200; Roche) и 0,2 мМ PMSF. Концентрацию белка определяли с помощью анализа Брэдфорда (BioRad), и 50 мкг общего белка наносили в каждую лунку SDS/PAGE. Проведение гель-электрофореза и иммуноблоттинга осуществляли в соответствии со стандартными процедурами. Применяемые антитела являлись мышиными моноклональными антителами к человеческому Axl (МАВ154; R &D Systems), АКТ1 (Cell Signaling № 2967), Akt2 (Cell Signaling № 3063), Akt3 (Millipore № 1586912), pAKT (Ser473, Cell Signaling 2971), a
актину (Sigma-Aldrich), pERK (Cell Signaling № 4695). Антитело рАКТ взаимодействует с Aktl, Akt2 и Akt3, когда они фосфорилированы по аминокислоте, соответствующей Ser473 B Aktl.
Результаты данных экспериментов показаны на фигуре 1. Как и ожидалось, рАКТ повышается в клетках, подвергающихся ЕМТ (сравните полосы Control, Slug), и данное повышение блокируется при блокировании ЕМТ путем нокдауна Axl (сравните полосы Control, Slug, Axl2-Slug). Неожиданно, экспрессия Akt3 сильно повышается, когда данные эпителиальные клетки молочной железы подвергаются ЕМТ. В отличие от этого, экспрессия Aktl остается постоянной, a Akt2 подавляется. Блокирование Axl в индуцированных с помощью ЕМТ клетках (полоса Axl2-Slug) также блокирует переключение изоформ Akt, указывая на то, что изменение экспрессии от Akt2 на Akt3 зависит от Axl. Следует отметить, что активированный (фосфорилированный) Akt (pAkt) находится в зависимости от уровней Akt3, а не уровней Aktl и 2, предполагая, что основной изоформой фосфо-Akt в данных клетках может являться Akt3. Это подтверждается в примере 4.
Пример 2 Когда трансформированные клетки рака молочной железы подвергаются ЕМТ, Akt3 активируется, и данные изменения являются Axl-зависимыми
Клетки HMLE и HMLER (Elenbaas В, Spirio L, and Weinberg RA. Human breast cancer cells generated by oncogenic transformation of primary mammary epithelial cells. Genes Dev. 2001 Jan l;15(l):50-65), линии экспериментально трансформированных клеток рака молочной железы, культивировали в среде MEGM (Lonza)/ DMEMF12 (Sigma-Aldrich) с добавлением 5 нг/мл EGF, 10 мкг/мл инсулина, 0,5 мкг/мл гидрокортизона, 100 Ед/мл пенициллина и 100 мкг/мл стрептомицина (Sigma-Aldrich). Клетки трансдуцировали либо с использованием ретровирусных векторов "Slug", "Ах12", shRNA контрольной люциферазы (ctr), либо с использованием комбинации ретровирусных векторов "Slug" и "Ах12", как описано в примере 1. Получение белковых экстрактов, проведение гель-электрофореза, иммуноблоттинга и зондирование мембран осуществляли, как описано в примере 1.
Результаты данных экспериментов показаны на фигуре 2. Как обнаружено в примере 1, экспрессия АктЗ сильно повышается, когда данные эпителиальные клетки молочной железы подвергаются ЕМТ (сравните полосы Control, Slug). Клетки HMLE (слева): активированная (фосфорилированная) Akt (pAkt) находится в зависимости от уровней Akt3, а не уровней Aktl (сравните полосы Control и Slug). Клетки HMLER (справа): блокирование Axl в индуцированных с помощью ЕМТ клетках (полоса Slug-
Ах12) также блокирует экспрессию Akt3, указывая на то, что уровни экспрессии Akt3 зависят от Axl.
Пример 3 Akt3, а не Aktl подавляется в ответ на ингибирование Axl в клетках рака молочной железы с тройным негативным фенотипом
Клетки MDA-MB231 (Американская коллекция типовых культур), линию клеток рака молочной железы с тройным негативным фенотипом, культивировали в среде F12 с добавлением 10% фетальной бычьей сыворотки, 100 Ед/мл пенициллина и 100 мкг/мл стрептомицина (Sigma-Aldrich). Клетки трансдуцировали с использованием ретровирусных конструктов, экспрессирующих shAxl ("Ах12") или shRNA контрольной люциферазы ("контроль"), как описано в примере 1 и примере 2. Получение белковых экстрактов, проведение гель-электрофореза, иммуноблоттинга и зондирование мембран осуществляли, как описано в примере 1 и 2.
Результаты показаны на фигуре 3. Клетки MDA-MB231 экспрессируют Axl, Aktl и АктЗ (смотри полосу "контроль"). В соответствии с данными, приведенными в примерах 1 и 2, блокирование Axl ("Ах12") также блокирует экспрессию Akt3, но не оказывает существенного влияния на экспрессию Aktl, указывая на то, что уровни экспрессии Akt3, а не Aktl, зависят от Axl.
Пример 4 Akt3 представляет основную изоформу P-Akt в клетках MCF10A, побужденных к ЕМТ (путем обработки TGF Р)
Клетки MCF10A обрабатывали TGF Р (10 нг/мл) в течение 4 дней. Клетки затем лизировали с помощью буфера для лизиса клеток NP40 (40 мМ HepesNAOH, 75 мМ NaCl, 2 мМ EDTA, 1% NP40, таблетка, содержащая смесь ингибиторов фосфатаз, таблетка, содержащая смесь ингибиторов протеаз (Roche)), счищали с чашки, перемешивали вращательным движением при 4°С в течение 30 мин, центрифугировали при 13000 об/мин в течение 10 мин и собирали надосадочную жидкость. Для иммунопреципитации антитела Aktl (2Н10, Cell Signaling № 2967), Akt2 (Cell Signaling № 3063), Akt3 (Millipore № 07-383) и контрольный IgG (Abeam) (1 мкг/ лизат) добавляли к лизатам и инкубировали в течение ночи при 4°С. На следующий день добавили предварительно блокированные гранулы с белком-G (GE Healthcare) в буфере для лизиса и оставили для связывания при 4 °С в течение 1 часа. Гранулы затем промывали 3 раза (20 мМ трис -НС1 (рН 7,5), 150 мМ NaCl, 1% NP40), белок элюировали путем кипячения в загрузочном буфере для SDS-PAGE. Проведение SDS/PAGE и иммуноблоттинга осуществляли в соответствии со стандартными процедурами. Мембрану зондировали с помощью антител pAktS473 (Cell Signaling № 9271) и PAN-Akt (Cell Signaling № 9272).
Эти данные, представленные на фигуре 4, демонстрируют, что фосфо-АШ
представляет основную изоформу pAkt в ЕМТ-индуцированных клетках MCF10A. Фосфо-Aktl не обнаружили. Это было неожиданным с учетом предыдущих исследований, указьшающих на то, что Aktl отвечает за эффекты Akt.
Пример 5 мРНК Akt3, но не Akt 1 и 2 коррелирует с ЕМТ и генами стволовых клеток в клетках рака молочной железы и биоптатах рака молочной железы
Анализ экспрессии в клеточных линиях рака молочной железы и биоптатах рака молочной железы человека (рака, нормальных) осуществляли, исходя из опубликованных и GEO-представленных данных Affymetrix, как описано (Kilpinen S, Autio R, Ojala К, Iljin К, Bucher E, Sara H, Pisto T, Saarela M, Skotheim RI, Bjorkman M, Mpindi JP, Haapa-Paananen S, Vainio P, Edgren H, Wolf M, Astola J, Nees M, Hautaniemi S, Kallioniemi O. Systematic bioinformatic analysis of expression levels of 17,330 human genes across 9,783 samples from 175 types of healthy and pathological tissues. Genome Biol. 2008;9(9):R139.). Положительная корреляция обозначается знаком плюс (+), более темный серый цвет обозначает более сильную положительную корреляцию, и более высокая достоверность обозначается увеличивающимся количеством звездочек (*). Аналогичным образом отрицательная корреляция обозначается знаком минус (-), более темный серый цвет обозначает более сильную отрицательную корреляцию, и более высокая достоверность обозначается увеличивающимся количеством звездочек (*).
Ген
Эпителиальный маркер
Мезенхимальный маркер
ЕМТ-медиатор
Маркер раковых стволовых клеток
SOX2
SNAI1
CD44
SEMA3C
TWIST1
ZEB1
CDH2
ID4
VIM
ZEB1
AXL
SNAI2
PLXNA2
Результаты показаны на
фигуре 5. АктЗ, не
Aktl и Акт2, показывает сильную
корреляцию с ЕМТ и маркерами стволовых клеток в клеточных линиях рака молочной железы и биоптатах рака молочной железы.
Пример 6 Нокдаун Akt3 способен обратить ЕМТ и признаки CSC в эпителиальных клетках молочной железы
Клетки MCF10A и клетки MDA-MB 231 культивировали, как описано в примере 1 и 3. MCFlOa трансдуцировали с использованием ЕМТ драйвера "Slug" (Slug/контроль), как описано в примере 1. siRNA-опосредованный сайленсинг АктЗ проводили с использованием реагента для трансфекции HiPerFect (Qiagen) в соответствии с протоколом производителя, и клетки культивировали в течение 2-3 дней. Ренатурированные siRNA против Akt3 ("siAKT3"; HsAkt3_2 HP) и GAPDH ("контроль"; Hs_GAPDH_3) применяли в конечных концентрациях 60 нМ (все от Qiagen). SDS/PAGE, иммуноблоттинг и антитела, как описано в примере 1, за исключением крысиных антител к виментину человека (МАВ2105; R &D Systems). Эксперименты 3D на матригеле проводили, как описано (Gjerdrum С, Tiron С, Heiby Т, Stefansson I, Haugen Н, Sandal Т, Collett К, Li S, McCormack E, Gjertsen ВТ, Micklem DR, Akslen LA, Glackin C, Lorens JB. Axl is an essential epithelial-to-mesenchymal transition-induced regulator of breast cancer metastasis and patient survival. Proc Natl Acad Sci USA. 2010 Jan 19;107(3):1124-9.). Клетки визуализировали с помощью флуоресцентной микроскопии (краситель для ядер DAPI), применяя микроскоп Nikon ТЕ2000 (Nikon).
Эти данные, представленные на фигуре 6, показывают, что нокдаун Akt3 способен обратить признаки ЕМТ в двух различных клетках эпителия молочной железы, как показано с помощью подавления мезенхимального маркера виментина и ингибирования инвазивного звездчатого роста в 3D на матригеле.
Пример 7 Конститутивно активный АктЗ, но не конститутивно активный Aktl, способен активировать ЕМТ и активировать регуляторы ЕМТ
SDS/PAGE, иммуноблоттинг и антитела, как описано в примере 1 и 6, за исключением кроличьих к N-кадгерину человека (abl8203; Abeam), кроличьих к Е-кадгерину человека (24Е10; Cell Signaling), кроличьих к Р-катенину человека (L54E2; Cell Signaling), мышиных к Twist (Twist2Cla; Abeam).
Клетки MCF10A, культивированные, как описано в примере 1, трансдуцировали с использованием пустого вектора (CRU5-IRES-GFP, описанный в примере 1) или вектора CRU5-IRES-GFP, несущего конститутивно активную миристилированную форму Aktl
(myrAktl) или конститутивно активную миристилированную форму Akt3 (myrAkt3). В тех случаях, когда направлена на мембраны с помощью добавления последовательности миристоилирования src, Akt становится конститутивно активной (Barthel A, Kohn AD, Luo Y, Roth RA. A constitutively active version of the Ser/Thr kinase Akt induces production of the ob gene product, leptin, in 3T3-L1 adipocytes. Endocrinology. 1997 Aug;138(8):3559-62). Клетки MCF10A трансдуцировали либо с использованием ретровирусного вектора "myr-АКТ1", либо с использованием ретровирусного вектора "туг-АКТЗ". Контрольные клетки ("wt") не трансдуцировали ни одним из двух векторов. Иммуноблоты белков, экстрагированных из данных клеточных линий, зондировали с использованием панели маркеров, связанных с изменением эпителиальных и мезенхимальных клеток и ЕМТ.
Эти данные, представленные на фигуре 7, неожиданно показывают, что конститутивно активная Akt3, но не конститутивно активная Aktl, способна активировать ЕМТ, как показано с помощью активирования мезенхимальных маркеров (N-кадгерина, виментина) и потери эпителиальных маркеров (Е-кадгерина, В-катенина). Экспрессия myr-Akt3 также ведет к активации регуляторов ЕМТ, Snail и Axl, и фосфорилированию Akt, предполагая существование положительной обратной связи.
Пример 8 Конститутивно активная Akt3 (MyrAkt3), но не конститутивно активная Aktl, способна индуцировать ЕМТ и признаки CSC в клетках эпителия молочной железы
Клетки MCF10A клетки использовали в данном эксперименте вместе с ретровирусным вектором ("myr-AKTl"), стимулирующим экспрессию конститутивно активной Aktl, и ретровирусным вектором ("myr-АКТЗ"), стимулирующим экспрессию конститутивно активной АктЗ. Эксперименты 3D в матригеле проводились, как описано в примере 6. Клетки визуализировали при указанном увеличении с помощью фазовоконтрастной и флуоресцентной микроскопии (краситель для ядер DAPI), применяя микроскоп Nikon ТЕ2000 (Nikon).
Результаты показаны на фигуре 8. Эти данные показывают, что конститутивно-активная Akt3, но не конститутивно-активная Aktl, способна индуцировать ЕМТ и признаки CSC в клетках эпителия молочной железы (рост фибробластоидных клеток в 2D культуре и инвазивный звездчатый рост в 3D матригеле).
Пример 9 Клетки, экспрессирующие конститутивно-активную Akt3, но не клетки, экспрессирующие конститутивно-активную Aktl, демонстрируют способность к росту в маммосферы
Используемые клеточные линии являются такими же, как описаны в примере 1. Культивирование маммосфер из клеток MCF10A осуществляли, как описано (Dontu G,
Abdallah WM, Foley JM, Jackson KW, Clarke MF, Kawamura MJ, Wicha MS. In vitro propagation and transcriptional profiling of human mammary stem/progenitor cells. Genes Dev. 2003 May 15; 17(10): 1253-70). Вкратце, отдельные клетки высевали на 35 мм планшеты с ультранизкой адгезией (Corning, США, Номер в каталоге 3471), 20000 жизнеспособных клеток/мл, всего 30000 клеток на лунку. Маммосферы культивировали в течение 10 дней, визуализировали и маммосферы количественно оценили, применяя ImageJ (bttp://rsbweb.nih.gov/ij/index.html). Статистические анализы основывались на t-критерии Стьюдента. Результаты показаны на фигуре 9.
Способность образовывать маммосферы - крупные структуры, состоящие из множества клеток, - считается признаком раковых стволовых клеток. Клетки MCF10A, экспрессирующие конститутивно-активную Akt3, смогли сформироваться в маммосферы. Напротив, клетки, экспрессирующие конститутивно-активную Aktl и необработанные клетки MCF10A не способны образовывать маммосферы. Способность образовывать маммосферы, следовательно, запускается с помощью передачи сигналов посредством Akt3, а не посредством Aktl.
Пример 10 Конститутивно-активная Akt3 (myr-Akt3), но не конститутивно-активная Aktl, способна индуцировать ЕМТ, что приводит к повышению ЕМТ/мезенхимальных маркеров (Axl, виментин, N-кадгерин) и потере эпителиальных маркеров (Е-кадгерин)
Клетки HMLER трансдуцировали с использованием ретровирусных векторов, которые экспрессируют myrAktl или myrAkt3, как описано в примере 8, и анализировали на содержание рецепторного белка Axl, экспрессию эпителиального (Е-кадгерин) и мезенхимальных (виментин, N-кадгерин) маркеров, уровни Akt 1/3 и pAkt, как описано в примере 7.
Результаты показаны на фигуре 10. Конститутивно активная Akt3, но не конститутивно активная Aktl, способна активировать ЕМТ и активировать регуляторы ЕМТ.
Пример 11 Конститутивно-активная Akt3 (MyrAkt3), но не конститутивно-активная Aktl, способна индуцировать ЕМТ и признаки CSC в эпителиальных клетках молочной железы
Клетки HMLER, экспрессирующие myrAktl, myrAkt3 или пустой вектор, вьгоащивали в 2D (слева) и 3D на матригеле (справа), и визуализировали с помощью фазовоконтрастной микроскопии, как описано в примере 8.
Результаты показаны на фигуре 11.
Клетки HMLER, как правило, обладают эпителиальной морфологией (слои
округлых клеток) при выращивании на пластике для тканевой культуры (слева), и не являются инвазивными при выращивании в окружении матригеля (справа). Эти данные показывают, что конститутивно-активная Akt3, но не конститутивно-активная Aktl, способна индуцировать ЕМТ и признаки CSC в трансформированных эпителиальных клетках молочной железы HMLER (рост фибробластоидных клеток в 2D культуре и инвазивный звездчатый рост в 3D матригеле).
Пример 12 Клетки, экспрессирующие конститутивно активную АкгЗ, но не клетки, экспрессирующие конститутивно активную Aktl демонстрируют способность к росту в маммосферы
Клетки HMLER, экспрессирующие myrAktl, myrAkt3 вьфащивали в культуре маммосфер и количественно оценивали, как описано примере 9.
Результаты показаны на фигуре 12.
Образование опухлевых сфер (Tumorsphere) характерно для раковых стволовых клеток. Клетки HMLER в норме не способны образовывать маммосферы, что указывает на отсутствие характеристик раковых стволовых клеток. Трансфекция с помощью вектора, кодирующего активированную Akt3 (тугАкхЗ), но не с помощью вектора, кодирующего активированную Aktl (myrAktl), придает способность образовывать маммосферы.
Пример 13 Клетки, экспрессирующие конститутивно активную Akt3, показывают намного более высокую способность к образованию опухолей, чем клетки, экспрессирующие конститутивно активную Aktl
Клетки HMLER, трансдуцированные с использованием ретровирусных векторов "HMLER/вектор", "HMLER/myrAktl" и "HMLER/myrAkt3", как описано в примере 10, инъецировали мышам-хозяевам в предельных разведениях, как описано (Mani SA, Guo W, Liao MJ, Eaton EN, Ayyanan A, Zhou AY, Brooks M, Reinhard F, Zhang CC, Shipitsin M, Campbell LL, Polyak K, Brisken C, Yang J, Weinberg RA. The epithelial-mesenchymal transition generates cells with properties of stem cells. Cell. 2008 May 16;133(4):704-15).
Результаты представлены на фигуре 13. Эти данные показывают, что экспрессия конститутивно активной Akt3 (HMLER/myrAkt3) значительно повышает способность клеток HMLER к образованию опухолей, в сравнении с контрольными клетками или клетками, экспрессирующими конститутивно активную Aktl (смотри количество опухолей, образованных при 1000 высеянных клеток).
Пример 14 Конститутивно активная Akt3 и Slug, но не конститутивно активная Aktl, способна индуцировать мезенхимальный фенотип и инвазивный рост; ингибитры Akt ингибируют мезенхимальный фенотип
Клетки MCF10A культивировали и трансдуцировали с использованием
ретровирусных конструкций, экспрессирующих myrAktl, MyrAkt3 или Slug, как описано на фигуре 1 и 3. Клетки обрабатывали ингибиторами Akt LY294002 (10 мкМ, Cell Signaling Technology, Номер в каталоге 9901) и Akt VIII (10 мкМ, Merck, Номер в каталоге 124018) в течение 12 часов, как указано. Затем клетки либо визуализировали при указанном увеличении с помощью фазовоконтрастной микроскопии, либо высевали для инвазивного роста в 3D на матригеле, как описано в примере 3. Результаты показаны на фигуре 14.
Данные результаты показывают, что конститутивно активная Akt3 и Slug, но не конститутивно активная Aktl, способна индуцировать мезенхимальный фенотип при 2D росте и инвазивный рост при 3D росте на матригеле. Ингибиторы Akt LY-294002 и АКТ VIII ингибируют мезенхимальный фенотип, индуцированный Akt3, а также мезенхимальный/инвазивный фенотип, индуцированный Slug при 2D и 3D росте, предполагая, что АктЗ требуется для передачи сигнала Slug.
Пример 15 Конститутивно активная Akt3 и Slug, но не конститутивно активная Aktl, способна активировать ЕМТ, и ингибиторы Akt способны частично обращать мезенхимальный фенотип
Клетки MCF10A культивировали и трансдуцировали с использованием ретровирусных конструктов, экспрессирующих myrAktl, MyrAkt3 или Slug, как описано на фигуре 1 и 3. Клетки обрабатывали ингибитором Akt как описано на фигуре 6. SDS/PAGE, иммуноблоттинг и антитела, как описано в примерах 1 и 4.
Результаты показаны на фигуре 15.
Данные результаты показывают, что конститутивно-активная АктЗ и Slug, но не конститутивно-активная Aktl, способна активировать ЕМТ, как показано с помощью активирования маркеров N-кадгерина, виментина и потери эпителиального маркера Е-кадгерина. Ингибитор Akt, АКТ VIII (слева), способен полностью ингибировать активацию Akt (pAkt) и частично обращать мезенхимальный фенотип, как показано с помощью значительного снижения мезенхимальных маркеров N-кадгерина и виментина (слева). Ингибитор Akt, LY-294002, аналогично показывает частичное ингибирование ЕМТ, демонстрируя снижение экспрессии виментина. Ни один ингибитор не привел к повторной экспрессии эпителиального маркера Е-кадгерина.
Пример 16 Сайленсинг Akt3 путем RNAi, но не сайленсинг Aktl в клетках MCF10A, побужденных подвергнуться ЕМТ (с помощью экспрессии H-RasV12 или Slug), значительно снижает уровни P-Akt
Клетки MCF10A трансдуцировали с использованием ретровирусных векторов, кодирующих ЕМТ индукторы Slug и H-RasV12. В данных клетках осуществили
сайленсинг, опосредованный малой интерферирующей РНК, применяя реагент для трансфекции HiPerFect (Qiagen) в соответствии с протоколом производителя, и клетки культивировали в течение 3 дней. Ренатурированные siRNA против Aktl (Hs_AKTl_,_5 Flexitube siRNA), Akt3 (Hs_AKT3_2 HP siRNA) и GAPDH (Hs_GAPDH_3 HP валидированная siRNA) (все от Qiagen) в качестве отрицательного контроля применяли в конечных концентрациях 60 нМ. После сайленсинга клетки лизировали с использованием загрузочного буфера для SDS-PAGE, обрабатывали ультразвуком и кипятили. Лизаты подвергали вестерн-блот анализу, и блоты зондировали, применяя антитела к Aktl, Akt3, pAkt Ser473, описываемые на фигуре 2, и а-тубулину 12gl0 (Hybridoma Bank; http://dshb.biology.uiowa.edu/l 2G10-anti-alpha-tubulin).
Данные результаты представлены на фигуре 16. Данные результаты показывают, что подавление уровня Akt3, но не подавление уровня Aktl, в клетках, побужденных подвергнуться ЕМТ, способно значительно снизить уровень общей P-Akt. Это предполагает, что фосфо-АктЗ представляет основную изоформу pAkt в ЕМТ-индуцированных клетках MCF10A.
Пример 17 Конститутивно активная Akt3, но не конститутивно активная Aktl, локализуется в ядре клетки
Клетки HMLER культивировали, как описано в примере 2, и SDS/PAGE, иммуноблоттинг и антитела применяли, как описано в примере 1, за исключением антител к гистону 3 (Cell Signaling, антитело к гистону НЗ (Histone НЗ Antibody) № 9715). Экстракцию ядер осуществляли в соответствии с инструкциями производителя (Universal Magnetic Co-IP Kit, Active Motif, 54002). Иммунофлуоресцентное окрашивание конститутивно активных Aktl и Akt3 в фиксированных клетках осуществляли, применяя антитела, как в примере 1, с помощью способа, описанного производителем (Cell Signaling, Общий протокол иммунофлуоресценции).
Данные результаты представлены на фигуре 17. Активированная АктЗ (MyrAkt3) локализуется в ядерной фракции в клетках HMLER (вверху). Иммунофлуоресцентное окрашивание обнаруживает окрашивание myrAkt3 в ядре/около ядера, но исключение из ядра myrAktl.
Пример 18 АктЗ и транскрипционный фактор Snail обнаруживаются в подавляющем большинстве случаев в ядерной фракции культивируемых клеток рака молочной железы с тройным негативным фенотипом. Маркеры тубулин (цитоплазматический) и ламин (ядерный) подтверждают успешное фракционирование
Клетки MDA-MB 231 культивировали, как описано в примере 3. SDS/PAGE,
иммуноблоттинг и антитела применяли, как описано в примерах 1 и 16, за исключением ламинина А/С из Santa Cruz, sc-7292. Цитозольные и ядерные белки изолировали, как описано в примере 17.
Результаты данных экспериментов показаны на фигуре 18. Как и ожидалось, транскрипционный фактор Snail обнаруживается в ядре. Неожиданно, Akt3 также являлась практически исключительно ядерной.
Пример 19 Akt3 локализуется в ядре в культивируемых клетках рака молочной железы с тройным негативным фенотипом и первичных клетках эпителия молочной железы человека
Культивирование клеток MDA-MB-231 осуществляли, как описано в примере 3. Первичные клетки эпителия молочной железы человека (НМЕС) изолировали, как описано (Garbe JC, Pepin F, Pelissier FA, Sputova K, Fridriksdottir AJ, Guo DE, Villadsen R, Park M, Petersen OW, Borowsky AD, Stampfer MR, Labarge MA. Accumulation of multipotent progenitors with a basal differentiation bias during aging of human mammary epithelia. Cancer Res. 2012 Jul 15;72(14):3687-701). Определение местонахождения Akt3 (aHTH-Akt3-FITC, верхние панели) в MDA-MB-231 и первичных клетках эпителия молочной железы человека (НМЕС) осуществляли, как описано в примере 17. Ядро окрашивали с помощью DAPI (нижние панели). Полоса: 50 микрон
Результаты данных экспериментов показаны на фигуре 19. Белок АктЗ (верхние панели) локализован в ядрах (сравнить с окрашиванием ядер, нижние панели) как в клетках рака молочной железы, так и в первичных клетках эпителия молочной железы.
Пример 20 Подавление киназы Axl значительно снижает ЕМТ-индуцированную ядерную локализацию Akt3
Клетки HMLER и HMLER/Slug трансдуцировали с использованием ретровирусных векторов, которые экспрессируют Axl-специфическую shRNA (shAxl2) или shRNA контрольной люциферазы (shLuc). Изолировали цитоплазматическую и ядерную клеточные фракции, как описано в примере 17, и измеряли уровень белка Akt3 с помощью иммуноблоттинга в ядерной и цитоплазматической клеточных фракциях. Иммунофлуоресценция трансдуцированных клеток (GFP, цитоплазматический зеленый), окрашенных с помощью aHTH-Akt3-FITC (ядерный зеленый) или ядерного красителя DAPI.
Результаты данного эксперимента показаны на фигуре 20. Индукция ЕМТ с помощью Slug приводит к ядерной локализации АктЗ в Axl-зависимом процессе.
Пример 21 Ингибирование активности киназы Axl ингибирует ядерную локализацию АктЗ
Количественная оценка иммунофлюоресценции ядерной Akt3 (aHTH-Akt3-FITC, верхние панели) в эпителиальных клетках молочной железы (НМЕС), обработанных с помощью растворителя (DMSO), cKit TKI (1 мкМ иматиниба) и Axl TKI (600 нМ BGB324). Полоса: 50 микрон. *Р <0,05.
Результаты, представленные на фигуре 21, показывают, что блокирование активности Axl (BGB324) ингибирует АктЗ ядерную локализацию АктЗ, в то время как ингибирующий cKit (иматиниб) не оказывает влияния на ядерную локализацию.
Пример 22 Киназы Aktl и АктЗ способны непосредственно фосфорилировать белок Snail в биохимическом анализе, не включающем другие белки.
Кодирующую последовательность SNAI1/Snail клонировали в вектор pGEX-4T-l (Promega), и последовательность проверяли. Белок слияния GST экспрессировали в Escherichia coli (Rosetta BL21DE3) и очищали в соответствии с инструкциями производителя (BD Biosciences); фрагмент GST расщепляли с помощью тромбина. In vitro анализы киназ проводили с использованием рекомбинантных Aktl и Akt3 (ProQinase GmbH), субстратных белков Snail и Slug и 32Р-АТР, и обнаруживали с помощью ауторадиографии, как описано (Tuomi et al., 2009).
Результаты, представленные на фигуре 22, показывают, что киназы Aktl и Akt3 способны непосредственно фосфорилировать белок Snail в биохимическом анализе, не включающем другие белки.
Пример 23 SureFire анализ обнаруживает фосфо-АктЗ в стимулированных инсулином клетках меланомы (WM115), которые экспрессируют Akt3. Отсутствие сигнала обнаруживается в линиях клеток молочной железы и предстательной железы, которые экспрессируют Aktl и Akt2, но не Akt3 (MCF7 и LNCaP)
SureFire анализ применяли для специфического обнаружения активированного (фосфорилированного) АктЗ в клетках WM115, MCF7 и LNCaP. Вкратце, клетки лизировали, и антитела, распознающие фосфорилированную Akt (р473) и АктЗ, соединили с акцепторными и донорными гранулами, как описано производителем (PerkinElmer). Клетки либо не стимулировали, либо стимулировали с помощью 10 нМ инсулина в течение 10 минут для активации Akt.
Результаты данных экспериментов показаны на фигуре 23. Как и ожидалось, инсулин способен значительно индуцировать активность Akt3 (фосфорилирование) в клетках меланомы WM115, тогда как сигнал отсутствовал в клетках эпителия молочной железы MCF7 или клетках предстательной железы LNCaP.
Пример 24 Снижение экспрессии Akt3
С помощью выявления соответствующих последовательностей shRNA, например,
как описано в патенте США № 2008014037, возможно подавить экспрессию АктЗ на различные уровни (например, 20%, 40%, 60%, 70%, 80%, 90%, 100%). Попытки индуцировать ЕМТ в клетках млекопитающих, предпочтительно человека, с различными уровнями подавления АктЗ можно использовать для определения минимальной степени подавления АктЗ, необходимой для предупреждения ЕМТ, тем самым определяя терапевтическое окно. Кроме того, путем выбора уровня подавления АктЗ, который является несколько недостаточным для предупреждения ЕМТ, возможно генерировать линию клеток млекопитающего, предпочтительно человека, которая является особенно чувствительной к ингибиторам ЕМТ. В такой клеточной линии существует едва достаточная экспрессия АктЗ для обеспечения возникновения ЕМТ, и соединения, которые хоть немного ингибируют передачу сигнала АктЗ, будут блокировать ЕМТ. Такие клеточные линии, таким образом, являются пригодными инструментами скрининга для ингибиторов ЕМТ, и особенно ингибиторов АктЗ.
Промышленная применимость
Настоящее изобретение промышленно применимо посредством выполнения способов в соответствии с настоящим изобретением.
ФОРМУЛА ИЗОБРЕТЕНИЯ
1. Способ выявления субъекта, имеющего состояние, связанное с Akt3, причем способ включает оценку уровня экспрессии или активности Akt3 у субъекта или в образце, полученном от субъекта.
2. Способ по п. 1 выявления субъекта, подверженного определенному риску развития метастатического или лекарственно-устойчивого рака, причем способ включает оценку уровня экспрессии или активности АктЗ у субъекта или в образце, полученном от субъекта, причем повышенный уровень экспрессии или активности Akt3 указывает на повышенный риск развития у субъекта метастатического или лекарственно-устойчивого рака.
3. Способ по п. 1 выявления присутствия раковых стволовых клеток у субъекта, причем способ включает определение уровня экспрессии или активности Akt3 у субъекта или в образце, полученном от субъекта, причем повышенная экспрессия или активность АктЗ указывает на наличие раковых стволовых клеток (CSC).
4. Способ по п. 1 выявления субъекта, у которого происходит эпителиально-мезенхимальный переход (ЕМТ), причем способ включает определение уровня экспрессии или активности АктЗ у субъекта или в образце, полученном от субъекта, причем повышение экспрессии или активности АктЗ указывает на возникновение ЕМТ.
5. Способ прогнозирования исхода рака у субъекта, причем способ включает оценку активности или экспрессии АктЗ у субъекта или в образце, полученном от субъекта.
6. Способ по п. 5, отличающийся тем, что увеличение активности или экспрессии АктЗ в сравнении с контрольным образцом указывает на восприимчивость к лечению с помощью средства, способного ингибировать или обращать ЕМТ.
7. Способ по п. 6, отличающийся тем, что средство является ингибитором Akt3 или ингибитором Axl.
8. Способ выявления активности Axl, причем способ включает определение уровня экспрессии или активности АктЗ у субъекта или в образце, полученном от субъекта, причем повышенная активность или экспрессия Akt3 коррелирует с активностью Axl.
9. Способ по любому из п.п. 1-8, при котором субъектом является млекопитающее.
10. Способ по п. 9, при котором субъектом является человек.
11. Способ по любому из п.п. 1-10, отличающийся тем, что уровень экспрессии
или активности у субъекта или в образце, полученном от субъекта, определяют в сравнении с контрольным образцом.
12. Способ по любому из п.п. 1-11, дополнительно включающий оценку уровня экспрессии или активности Akt2 у субъекта, или в образце, полученном от субъекта, отличающийся тем, что пониженный уровень экспрессии или активности Akt2 указывает на:
(i) субъект испытывает состояние, связанное с Akt3;
(И) повышенный риск развития метастатического или лекарственно-устойчивого
рака;
(ш) наличие раковых стволовых клеток; и/или (iv) возникновение ЕМТ.
13. Способ по любому из п.п. 1-12, при котором определяют экспрессию АктЗ, а не Aktl и/или Акт2.
14. Способ по любому из п.п. 1-13, отличающийся тем, что уровень экспрессии Akt3 оценивают путем определения числа копий гена, кодирующего АктЗ, по отношению к контрольному образцу, при этом увеличение числа копий указывает на повышенный уровень экспрессии АктЗ.
15. Способ по любому из п.п. 1-14, отличающийся тем, что уровень экспрессии Akt3 оценивают путем определения уровня белка АктЗ или мРНК.
16. Способ по любому из п.п. 1-15, отличающийся тем, что активность Akt3 оценивают путем определения фосфорилирования Akt3, при этом фосфорилирование АктЗ указывает на активную АктЗ.
17. Способ по п. 16, отличающийся тем, что фосфорилирование АктЗ определяют по серину 472.
18. Способ по любому из п.п. 1-17, отличающийся тем, что активность Akt3 оценивают путем определения внутриклеточной локализации белка АктЗ, при этом локализация в ядре указывает на активную Akt3.
19. Способ отбора пациентов, предпочтительно пациентов-людей, для лечения состояния, связанного с Akt3, причем способ включает выявление пациентов, обладающих повышенной активностью или экспрессией АктЗ, и отбор выявленных таким образом пациентов для лечения.
20. Способ отбора пациентов по п. 19, при котором состояние, связанное с АктЗ, представляет собой рак.
21. Способ по любому из п. 19 или п. 20, отличающийся тем, что пациента выявляют в соответствии со способом по любому из п.п. 1-18.
13.
22. Способ по любому из п.п. 19-21, отличающийся тем, что лечение включает введение средства, способного ингибировать или обращать ЕМТ.
23. Способ по п. 22, отличающийся тем, что средство содержит ингибитор Akt3 или ингибитор Axl.
24. Способ по любому из п.п. 1-23, отличающийся тем, что рак или состояние, связанное с Akt3, представляет собой рак, который выбран из рака молочной железы, меланомы, рака предстательной железы, рака яичников, рака ободочной и прямой кишки, рака легких или глиомы.
25. Ингибитор Akt3 для применения при лечении состояния, связанного с АктЗ.
26. Ингибитор АктЗ по п. 25, при этом состояние представляет собой рак.
27. Ингибитор АктЗ для применения в ингибировании ЕМТ.
28. Соединение, способное ингибировать активность АктЗ для применения при предупреждении, ингибировании или лечении устойчивости к лекарственному средству у субъекта, имеющего рак, причем способ включает приведение субъекта в контакт с соединением, способным ингибировать активность АктЗ.
29. Ингибитор АктЗ по любому из п.п. 25-28 в комбинации с другим терапевтическим средством.
30. Способ лечения субъекта, испытывающего состояние, связанное с АктЗ, причем способ включает приведение субъекта в контакт с ингибитором АктЗ или фармацевтическим соединением, выбранным в качестве или полученным из кандидатного соединения, полученного с помощью способа по любому из п.п. 42-46.
31. Способ лечения субъекта по п. 30, испытывающего состояние, связанное с АктЗ, причем способ включает периодическую оценку активности Akt3 у субъекта.
32. Способ по п. 30 или п. 31, при котором состояние, связанное с АктЗ, представляет собой рак.
33. Способ по п.п. 30, 31 или 32, при котором лечение субъекта корректируют в соответствии с обнаруженными уровнями активности АктЗ.
34. Способ по любому из п.п. 30-33, при котором субъекта лечат ингибитором
Axl.
35. Способ ингибирования ЕМТ у субъекта, причем способ включает приведение субъекта в контакт с соединением, способным ингибировать активность АктЗ.
36. Способ ингибирования раковых стволовых клеток у субъекта, причем способ включает приведение субъекта в контакт с соединением, способным ингибировать активность АктЗ.
37. Способ по любому из п.п. 30-36, при котором также приводят субъекта в
контакт с другим противораковым терапевтическим средством.
38. Способ предупреждения или ингибирования устойчивости к лекарственному средству у субъекта, имеющего рак, причем способ включает приведение субъекта в контакт с соединением, способным ингибировать активность АктЗ.
39. Способ по любому из п.п. 30-38, при котором субъектом является млекопитающее.
40. Способ по п. 39, при котором субъектом является человек.
41. Ингибитор Akt3 по любому из п.п. 25-29 или способ лечения по любому из
п.п. 37-40, при котором другое терапевтическое средство представляет собой средство для
лечения рака, которое выбрано из алкилирующих средств, включая алкилсульфонаты,
такие как бусульфан, азотистых ипритов, таких как хлорамбуцил, циклофосфамид,
эстрамустин, ифосфамид, мехлорэтамин, мелфалан и урамустин, производных
этиленимина, таких как тиотепа, нитрозомочевин, таких как кармустин, ломустин и
стрептозоцин, триазенов, таких как дакарбазин, прокарбазин и темозоламид, соединений
платины, таких как цисплатин, карбоплатин, оксалиплатин, сатраплатин и пикоплатин,
оннаплатин, тетраплатин, сприоплатин, ипроплатин, хлорид хлор(диэтилендиамино)-
платины (II), дихлор(этилендиамино)-платина (II), диамино(2-этилмалонато)платина (II),
(1,2-диаминоциклогексан)малонатопл атина (II), (4-карбоксифтало)-( 1,2-
диаминоциклогексан)платина (II), (1,2-диаминоциклогексан)-(изоцитрато)платина (II) и
(1,2-диаминоциклогексан)-цис-(пирувато)платина (II); антиметаболитов, включая
антифолаты, такие как метотрексат, перметрексед, ралтитрексед и триметрексат, аналогов
пиримидина, таких как азацитидин, капецитабин, цитарабин, эдатрексат, флоксуридин,
фторурацил, гемцитабин и троксацитабин, и аналогов пурина, таких как кладрибин,
хлордезоксиаденозин, клофарабин, флударабин, меркаптопурин, пентостатин и
тиогуанин; природных продуктов, включая противоопухолевые антибиотики, такие как
блеомицин, дактиномицин, митрамицин, митомицин, митоксантрон, порфиромицин, и
антрациклинов, таких как даунорубицин, доксорубицин, эпирубицин, идарубицин и
вальрубицин, ингибиторов митоза, таких как алкалоиды барвинка, винбластин, винвезир,
винкристин, виндезин и винорелбин, ферментов, таких как L-аспарагиназа и PEG-L-
аспарагиназа, стабилизаторов полимеров микротрубочек, таких как таксаны паклитаксел и
доцетаксел, ингибиторов топоизомеразы I, таких как камптотецины иринотекан и
топотекан, и ингибиторов топоизомеразы II, таких как подофиллотоксин, амсакрин,
этопозид, тенипозид, лозоксантрон и актиномицин; гормонов и антагонистов гормонов,
включая андрогены, такие как флуоксиместерон и тестолактон, антиандрогены, такие как
бикалутамид, ципротерон, флутамид и нилутамид, кортикостероиды, такие как
38.
дексаметазон и преднизон, ингибиторы ароматазы, такие как аминоглютетимид, анастрозол, экземестан, форместан и летрозол: эстрогены, такие как диэтилстильбэстрол, антиэстрогены, такие как фулвестрант, ралоксифен, тамоксифен и торемифин, агонисты и антагонисты рилизинг-фактора лютеинизирующего гормона (LHRH), такие как абареликс, бузерелин, госерелин, лейпролид, гистрелин, дезорелин, нафарелина ацетат и трипторелин, прогестины, такие как медроксипрогестерона ацетат и мегестрола ацетат, и гормоны щитовидной железы, такие как левотироксин и лиотиронин; ингибиторов пути РКВ, включая перифозин, энзастаурина гидрохлорид и трицирибин, ингибиторов Р13К, таких как семафор и SF1126, и ингибиторов MTOR, таких как рапамицин и аналоги; ингибиторов CDK, включая селициклиб, альвоцидиб и 7-гидроксистауроспорин; ингибиторов СОХ-2, включая целекоксиб; ингибиторов HDAC, включая трихостатин А, субероиланилид гидроксамовой кислоты и хламидоцин; ингибиторов ДНК-метилазы, включая темозоломид, и разнообразных средств, включая алтретамин, триоксид мьпньяка, талидомид, леналидомид, галлия нитрат, левамизол, митотан, гидроксимочевину, октреотид, прокарбазин, сурамин, фотодинамических соединений, таких как метоксален и натрия порфимер, и ингибиторов протеосомы, таких как бортезомиб: средств молекулярной таргетной терапии, в том числе функциональных терапевтических средств, включая средства генной терапии, средства антисмысловой терапии, ингибиторы тирозинкиназы, такие как эрлотиниба гидрохлорид, гефитиниб, иматиниба мезилат и семаксаниб, ингибиторы Raf, такие как сорафениб, и модуляторы экспрессии гена, такие как ретиноиды и рексиноиды, например, адапален, бексаротен, транс-ретиноевая кислота, 9-цис-ретиноевая кислота и К-(4-гидроксифенил)ретинамид; и средств фенотип-направленной терапии, включая моноклональные антитела, такие как алемтузумаб, бевацизумаб, цетуксимаб, ибритумомаб тиуксетан, ритуксимаб и трастузумаб, иммунотоксинов, таких как гемтузумаб озогамицин, радиоиммуноконъюгатов, таких как I-тозитумобаб, и противораковых вакцин; средств биологической терапии, в том числе: интерферонов, таких как интерферон-[альфа]2а и интерферон-[альфа]2Ь, и интерлейкинов, таких как альдеслейкин, денилейкин дифтитокс и опрелвекин, противораковых видов терапии, включая применение защитных или дополнительных средств, в том числе: цитопротекторных средств, таких как амифостин и дексразоксан, фосфонатов, таких как памидронат и золедроновая кислота, и стимулирующих факторов, таких как эпоэтин, дарбэпоэтин, филграстим, PEG-филграстим и сарграмостим; и ингибитора Axl, такого как 1 -(6,7-дигидро-5Я-бензо[6,7]циклогепта[ 1,2-с]пиридазин-3 -ил)-Л^-((7-(5)-пирролидин-1 -ил)-6,7,8,9-тетрагидро-5Я-бензо[7]аннулен-2-ил)-Ш-1,2,4-триазол-3,5-диамин; или дополнительной комбинации химиотерапевтических схем, к примеру комбинаций
карбоплатин/паклитаксел, капецитабин/доцетаксел, фторурацил/левамизол,
фторурацил/лейковорин, метотрексат/лейковорин и трастузумаб/паклитаксел, отдельно или в дополнительной комбинации с карбоплатином и т.п.
42. Способ отбора фармацевтического соединения, пригодного для предупреждения, ингибирования или лечения состояния, связанного с АктЗ, причем способ включает создание группы кандидатных фармацевтических соединений для тестирования, тестирование влияния кандидатных фармацевтических соединений на активность Akt3 в тестовой системе и отбор кандидатного фармацевтического соединения на основании ингибирования активности Akt3.
43. Способ отбора кандидатного фармацевтического соединения, пригодного для лечения метастатического или лекарственно-устойчивого рака, причем способ включает создание группы кандидатных фармацевтических соединений для тестирования, тестирование влияния кандидатных фармацевтических соединений на активность Akt3 в тестовой системе и отбор кандидатного фармацевтического соединения на основании его ингибирования активности АктЗ.
44. Способ отбора кандидатного фармацевтического соединения, пригодного для предупреждения или ингибирования ЕМТ, причем способ включает создание группы кандидатных фармацевтических соединений для тестирования, тестирование влияния кандидатных фармацевтических соединений на активность Akt3 в тестовой системе и отбор кандидатного фармацевтического соединения на основании ингибирования активности АктЗ.
45. Способ отбора кандидатного фармацевтического соединения, пригодного для предупреждения, ингибирования или лечения состояния, связанного с АктЗ, причем способ включает избирательное снижение экспрессии АктЗ в тестируемой клетке, приведение тестируемой клетки в контакт с кандидатным фармацевтическим соединением и определение эффекта кандидатного фармацевтического соединения на ингибирование активности Akt3.
46. Способ отбора кандидатного фармацевтического соединения, пригодного для предупреждения, ингибирования или лечения состояния, связанного с АктЗ, причем способ включает избирательное снижение экспрессии АктЗ в in vitro тестовой системе до низкого уровня, приведение тестовой системы в контакт с кандидатным фармацевтическим соединением и отбор кандидатных фармацевтических соединений, которые ингибируют активность Akt3.
47. Способ по п. 5, при котором отбирают кандидатные фармацевтические соединения, которые значительно или полностью ингибируют активность Akt3.
42.
48. Способ отбора кандидатных фармацевтических соединений по п.п. 45, 46 или п. 47, при котором на ингибирование активности АктЗ указывает снижение ЕМТ.
49. Способ по любому из п.п. 44-48, при котором экспрессию Akt3 в клетках в тестовой системе снижают на 90%, 80%, 70%, 60%, 50%, 40%, 30% или 20%.
50. Способ по п. 49, при котором экспрессию АктЗ снижают настолько, чтобы не вызывать ингибирование ЕМТ.
51. Способ по любому из п.п. 44-50, при котором экспрессию АктЗ избирательно снижают путем введения в клетки в тестовой системе нуклеотида, который препятствует экспрессии АктЗ.
52. Клеточная линия, которая чувствительна к ингибиторам ЕМТ, причем клеточная линия обладает уровнем экспрессии Akt3, который является несколько недостаточным для предупреждения ЕМТ.
53. Клеточная линия по п. 52, которая является клеточной линией человека.
54. Способ выявления соединения, которое ингибирует активность АктЗ, причем способ включает приведение клетки из клеточной линии по п. 52 или п. 53 в контакт с тестируемым соединением и определение ингибирования активности АктЗ в клетке.
55. Способ по п. 54, при котором ингибирование активности Akt3 выявляют по ингибированию ЕМТ.
56. Применение АктЗ в качестве биомаркера для обнаружения возникновения эпителиально-мезенхимального перехода (ЕМТ) у субъекта.
57. Применение по п. 56, где увеличение экспрессии и/или активация АктЗ свидетельствует о возникновении эпителиально-мезенхимального перехода (ЕМТ).
58. Применение АктЗ в качестве биомаркера для обнаружения экспрессии и/или активации Axl, где увеличение экспрессии и/или активация АктЗ свидетельствует об увеличении экспрессии и/или активации Axl.
59. Способ обнаружения возникновения эпителиально-мезенхимального перехода (ЕМТ) в образце, причем указанный способ включает
определение уровня экспрессии или активации АктЗ в образце, выделенном из клетки, группы клеток, животной модели или человека, по отношению к контрольному образцу, где увеличение уровня экспрессии или активация АктЗ по отношению к контрольному образцу свидетельствует о возникновении эпителиально-мезенхимального перехода (ЕМТ).
60. Способ выявления средства, способного ингибировать или обращать эпителиально-мезенхимальный переход (ЕМТ), причем указанный способ включает
60.
введение указанного средства в клетку, группу клеток или животную модель и отслеживание активации и/или экспрессии АктЗ.
61. Способ по п. 60, который включает:
(i) введение средства в клетку, группу клеток или животную модель, не являющуюся человеком; и
(ii) измерение экспрессии АктЗ и/или активации АктЗ в образцах, полученных из обработанных и необработанных клеток или животной модели; и
(ш) обнаружение увеличения экспрессии и/или активации АктЗ в обработанном образце в сравнении с необработанным образцом как указание на способность ингибировать или обращать эпителиально-мезенхимальный переход (ЕМТ).
62. Способ по п. 60 или п. 61, где животная модель не является человеком.
63. Применение или способ по любому из п.п. 57-62, где уровень экспрессии АктЗ оценивают путем определения числа копий гена, кодирующего АктЗ, по отношению к контрольному образцу, где увеличение числа копий указывает на повышенный уровень экспрессии АктЗ.
64. Применение или способ по любому из п.п. 56-63, где уровень экспрессии Akt3 оценивают путем определения уровня белка Akt3 или мРНК.
65. Применение или способ по любому из п.п. 56-64, где активность АктЗ оценивают путем определения фосфорилирования АктЗ, где фосфорилирование АктЗ указывает на активность АктЗ.
66. Применение или способ по п. 65, где фосфорилирование АктЗ определяют по серину 472.
67. Применение или способ по любому из п.п. 56-66, где активность АктЗ оценивают путем определения внутриклеточной локализации белка АктЗ, при этом локализация в ядре указывает на активную АктЗ.
62.
62.
62.
62.
62.
> 5 О ffi T О
с; о S
се О. *0 X
m С
и Я
и н
V V
а: ш
со ¦
r-H
и s
о о о
1/10
0/10
10/10
Ч О О т-
> ~> С
4/10
3/10
10/10
" н о
У о
6/10
6/10
10/10
Инъецированные клетки
106
5/10
6/10
10/10
HMLER/вектор
с2 ш _i
HMLER/myrAkt3
T- CO
-4-"
< <
CL <
со <
W H <
X О Q_ < CD il I 1 ¦
5 1s,
?3.
<
tN и
о: 2
со >
vsa
WO 2013/164788
1/23
PCT/IB2013/053488
WO 2013/164788
1/23
PCT/IB2013/053488
WO 2013/164788
2/23
PCT/IB2013/053488
WO 2013/164788
2/23
PCT/IB2013/053488
WO 2013/164788
4/23
PCT/IB2013/053488
WO 2013/164788
4/23
PCT/IB2013/053488
WO 2013/164788
5/23
PCT/IB2013/053488
WO 2013/164788
5/23
PCT/IB2013/053488
WO 2013/164788
6/23
PCT/IB2013/053488
WO 2013/164788
6/23
PCT/IB2013/053488
WO 2013/164788
10/23
PCT/IB2013/053488
WO 2013/164788
10/23
PCT/IB2013/053488
WO 2013/164788
11/23
PCT/IB2013/053488
WO 2013/164788
11/23
PCT/IB2013/053488
WO 2013/164788
12/23
PCT/IB2013/053488
WO 2013/164788
12/23
PCT/IB2013/053488
WO 2013/164788
12/23
PCT/IB2013/053488
WO 2013/164788
12/23
PCT/IB2013/053488
WO 2013/164788
12/23
PCT/IB2013/053488
WO 2013/164788
12/23
PCT/IB2013/053488
WO 2013/164788
13/23
PCT/IB2013/053488
WO 2013/164788
13/23
PCT/IB2013/053488
WO 2013/164788
14/23
PCT/IB2013/053488
WO 2013/164788
14/23
PCT/IB2013/053488
WO 2013/164788
16/23
PCT/IB2013/053488
WO 2013/164788
16/23
PCT/IB2013/053488
WO 2013/164788
16/23
PCT/IB2013/053488
WO 2013/164788
16/23
PCT/IB2013/053488
WO 2013/164788
16/23
PCT/IB2013/053488
WO 2013/164788
16/23
PCT/IB2013/053488
WO 2013/164788
16/23
PCT/IB2013/053488
WO 2013/164788
16/23
PCT/IB2013/053488
WO 2013/164788
18/23
PCT/IB2013/053488
WO 2013/164788
18/23
PCT/IB2013/053488
WO 2013/164788
19/23
PCT/IB2013/053488
WO 2013/164788
19/23
PCT/IB2013/053488
WO 2013/164788
19/23
PCT/IB2013/053488
WO 2013/164788
19/23
PCT/IB2013/053488
WO 2013/164788
20/23
PCT/IB2013/053488
WO 2013/164788
20/23
PCT/IB2013/053488
WO 2013/164788
20/23
PCT/IB2013/053488
WO 2013/164788
20/23
PCT/IB2013/053488
WO 2013/164788
21/23
PCT/IB2013/053488
WO 2013/164788
21/23
PCT/IB2013/053488
WO 2013/164788
22/23
PCT/IB2013/053488
WO 2013/164788
22/23
PCT/IB2013/053488
WO 2013/164788
23/23
PCT/IB2013/053488
WO 2013/164788
23/23
PCT/IB2013/053488