Патентная документация ЕАПВ

 
Запрос :  ea201400995a*\id

больше ...
Термины запроса в документе


Полный текст патента

(57) Реферат / Формула:

Изобретение предусматривает способы повышения выносливости к высокой температуре или тепловому стрессу у растения, части растения или растительной клетки, причем способ включает введение одной или нескольких нуклеиновых кислот, кодирующих (i) глутаминсинтетазу 1; 2 (GS1; 2); (ii) глутаматдекарбоксилазу 3 (GAD3); (iii) глутаминамидотрансферазу класса I (GAT1); (iv) полипептид MYB55 или любую их комбинацию, в растение, часть растения или растительную клетку. Также предусматриваются способы повышения содержания аминокислот в растении, части растения или растительной клетке, причем способ включает введение одной или нескольких нуклеиновых кислот, кодирующих (i) GS1; 2, (ii) GAD3, (iii) GAT1, (iv) полипептид MYB55 или любую их комбинацию, в растение, часть растения или растительную клетку.


121405
Заявка № 201400995
Заявитель ЮНИВЕРСИТИ ОФ ГУЭЛФ,
СПОСОБЫ ПОВЫШЕНИЯ ВЫНОСЛИВОСТИ К ТЕПЛОВОМУ СТРЕССУ И СОДЕРЖАНИЯ АМИНОКИСЛОТ В РАСТЕНИЯХ
ОБЛАСТЬ ТЕХНИКИ, К КОТОРОЙ ОТНОСИТСЯ ИЗОБРЕТЕНИЕ
Настоящее изобретение относится к способам повышения выносливости к тепловому стрессу или высокой температуре и способам повышения содержания аминокислот в растении, части растения или растительной клетке.
ПРЕДПОСЫЛКИ ИЗОБРЕТЕНИЯ
Растения подвергаются различным стрессовым условиям, которые могут неблагоприятно воздействовать на их продуктивность. Например, тепловой стресс может отрицательно воздействовать на различные аспекты роста и развития растения, в том числе без ограничения фертильность, прорастание семян, рост колеоптиля, налив зерна и/или цвет плодов. См., например, Ashraf et al., Environ. Exp. Bot. 34:275 (1994); Endo et al., Plant Cell Physiol. 50:1911 (2009); Jagadish et al., J. Exp. Bot. 61:143 (2010); Kolupaev et al., Russian J. Plant
Physiol. 52:199 (2005); Lin et al., J. Agric. Food Chem. 58:10545 (2010); Lin-Wang et al., Plant Cell Environ. 34(7):1176 (2011); Morita et al., Ann. Bot. 95:695 (2005)). Рис, который обеспечивает пищей примерно половину мирового населения, может быть особенно чувствительным к тепловому стрессу. См. Peng et al., Proc. Natl. Acad. Sci. USA 101:9971 (2004) (описывающий сниженные урожаи риса в Международном институте риса в ответ на глобальное повышение ночных температур с 1992 по 2003).
Хотя большинство исследований реакции на высокие температуры фокусировались на транскрипционных факторах теплового шока и белках теплового шока, выносливость к высоким температурам является сложным процессом, в котором задействованы многочисленные гены, пути и системы. Действительно, было показано, что ряд белков, молекул и путей играет роль в реакциях на тепловой стресс у хлопчатника, пшеницы, кукурузы и других растений.
Транскрипционные факторы MYB регулируют многочисленные процессы в ходе жизненного цикла растений и делятся на три основные группы на основании количества смежных повторов в их связывающих доменах: R1R2R3-MYB, R2R3-MYB и R1-MYB. Большинство транскрипционных факторов MYB у растений относятся к типу R2R3, которые вовлечены в широкий спектр физиологических реакций, таких как регуляция изопропаноидных и флавоноидных путей, контроля клеточного цикла, роста корня и различных механизмов защиты и ответа на стресс. Du et al., Biochem. (Mosc) 74:1 (2009); Jin and Martin, Plant Mol. Biol. 41:577 (1999); Lee et al., Mol. Plant Microbe Interact. 14:527 (2001); Lin-Wang et al., BMC Plant Biol. 10:50 (2010); Mellway et al., Plant Physiol. 150:924 (2009); Mu et al., Cell Res. 19:1291 (2009); Raffaele et al., Plant Cell 20:752 (2008); Stracke et al., Curr. Opin. Plant Biol. 4:447 (2001); Sugimoto et al., Plant Cell 12:2511 (2000); Yang and Klessig, Proc. Natl. Acad. Sci. USA 93:14972 (1996)). Несмотря на большое количество генов в семействе MYB, ген MYB68 Arabidopsis является единственным, который, как предполагается, играет роль в выносливости к высоким температурам у Arabidopsis. Feng et al., Plant Sci. 167:1099 (2004) (описывающий мутантное no MYB68 растение со сниженным ростом и более высокими уровнями лигнина в корнях при выращивании при высокой температуры).
КРАТКОЕ ОПИСАНИЕ ИЗОБРЕТЕНИЯ
В качестве одного аспекта настоящее изобретение предусматривает способ повышения выносливости к тепловому стрессу или высокой температуре у трансгенного растения, части растения или растительной клетки, причем способ включает введение одной или нескольких выделенных нуклеиновых кислот, кодирующих (i) глутаминсинтетазу 1;2 (GS1;2), (ii) глутаматдекарбоксилазу 3 (GAD3), (iii) глутаминамидотрансферазу класса I (GAT1), (iv) полипептид MYB55 или любую их комбинацию, в растение, часть растения или растительную клетку с получением трансгенного растения, части растения или растительной клетки, которые экспрессируют одну или несколько выделенных нуклеиновых кислот, для выработки GS1;2, GAD3, GAT1, MYB55 или любой их комбинации, приводя таким образом к повышению выносливости к тепловому стрессу или высокой температуре у трансгенного растения, части растения или растительной клетки по сравнению с контролем.
В типичных вариантах осуществления способ включает: (а) введение одной или нескольких выделенных нуклеиновых кислот в растительную клетку с получением трансгенной растительной клетки; и (Ь) регенерацию трансгенного растения из трансгенной растительной клетки из (а), где трансгенное растение содержит в своем геноме одну или несколько выделенных нуклеиновых кислот и характеризуется повышенной выносливостью к тепловому стрессу или высокой температуре.
В дополнительных вариантах осуществления способ включает: (а) введение одной или нескольких выделенных нуклеиновых кислот в растительную клетку с получением трансгенной растительной клетки; (Ь) регенерацию трансгенного растения из трансгенной растительной клетки из (а), где трансгенное растение содержит в своем геноме одну или несколько выделенных нуклеиновых кислот; и (с) отбор трансгенного растения, характеризующегося повышенной выносливостью к тепловому стрессу или высокой температуре, из множества трансгенных растений из (Ь).
В качестве дополнительного аспекта настоящее изобретение предусматривает способ повышения содержания аминокислот в трансгенном растении, части растения или растительной клетке, причем способ включает введение выделенной нуклеиновой кислоты, кодирующей полипептид MYB55, в растение, часть растения или растительную клетку с получением трансгенного
растения, части растения или растительной клетки, которые экспрессируют выделенную нуклеиновую кислоту, для выработки полипептида MYB55, приводя к повышенному содержанию аминокислот в трансгенном растении, части растения или растительной клетке по сравнению с контролем.
В типичных вариантах осуществления способ включает: (а) введение выделенной нуклеиновой кислоты в растительную клетку с получением трансгенной растительной клетки; и (Ь) регенерацию трансгенного растения из трансгенной растительной клетки из (а), где трансгенное растение содержит в своем геноме выделенную нуклеиновую кислоту и характеризуется повышенным содержанием аминокислот.
В дополнительных вариантах осуществления способ включает: (а) введение выделенной нуклеиновой кислоты в растительную клетку с получением трансгенной растительной клетки; (Ь) регенерацию трансгенного растения из трансгенной растительной клетки из (а), где трансгенное растение содержит в своем геноме выделенную нуклеиновую кислоту; и отбор трансгенного растения, характеризующегося повышенным содержанием аминокислот, из множества трансгенных растений из (Ь).
Настоящее изобретение также предусматривает способ получения растения-потомка, происходящего от трансгенного растения согласно настоящему изобретению, где растение-потомок содержит в своем геноме выделенную нуклеиновую кислоту согласно настоящему изобретению и характеризуется повышенной выносливостью к высокой температуре или тепловому стрессу и/или повышенным содержанием аминокислот.
В качестве другого аспекта настоящее изобретение охватывает трансгенное растение, часть растения или растительную клетку, полученную с помощью способа согласно настоящему изобретению, необязательно при этом трансгенное растение, часть растения или растительная клетка характеризуется повышенной выносливостью к тепловому стрессу или высокой температуре и/или повышенным содержанием аминокислот.
Эти и другие аспекты настоящего изобретения изложены более подробно в следующем описании настоящего изобретения.
КРАТКОЕ ОПИСАНИЕ ГРАФИЧЕСКИХ МАТЕРИАЛОВ
На фигуре 1А изображено бескорневое филогенетическое дерево, показывающее сходство между MYB55 Oryza sativa (OsMYB55) и несколькими из их гомологов у других видов.
На фигурах 1B-1F показаны различные последовательности, описанные в данном документе. На фигуре 1В изображена часть промоторной последовательности OsMYB55, которую использовали для управления экспрессией бета-глюкуронидазы (GUS) в анализах экспрессии, описанных в примере 3. На фигуре 1С изображены промоторная последовательность OsMYB55 и примыкающий 5' нетранслируемый участок (UTR). На фигуре 1D изображена последовательность гена OsMYB55, в том числе 5' UTR, промоторная последовательность, кодирующий участок и 3' UTR. На фигуре 1Е изображена нуклеотидная последовательность кДНК OsMYB55. На фигуре 1F изображена аминокислотная последовательность белка OsMYB55. Нуклеотиды, находящиеся в промоторной последовательности подчеркнуты. Нуклеотиды, находящиеся в кодирующей последовательности указаны буквами верхнего регистра. Аминокислоты, находящиеся в ДНК-связывающем участке указаны жирными курсивными буквами.
На фигуре 2А показана промоторная последовательность OsMYB55 с регуляторными элементами, действующими в цис-положении (CARE), и сайтами связывания транскрипционных факторов (TFBS), выделенными в ней. "MeJa" относится к CARE, вовлеченным в реакцию на MeJa. "HSE" относится к CARE, вовлеченным в реакцию на тепловой стресс. "ABRE" относится к CARE, вовлеченным в реакцию на абсцизовую кислоту. "ТСА" относится к CARE, вовлеченным в реакцию на салициловую кислоту. "LTR" относится к CARE, вовлеченным в реакцию на низкую температуру. "Skn-1" относится к CARE, вовлеченным в экспрессию в эндосперме. "GCC бокс" относится к сайтам связывания для транскрипционных факторов активаторного белка-2 (АР-2). "MBS бокс" относится к сайтам связывания для транскрипционных факторов MYB. "W бокс" относится к сайтам связывания для транскрипционных факторов WRKY. "DOF бокс" относится к сайтам связывания для ДНК-связывающих доменов с одним "цинковым пальцем" (DOF). Старт-кодон ATG кодирующей последовательности OsMYB55 указан звездочками.
Фигура 2В представляет собой диаграмму, на которой графически представлено положение возможных CARE в промоторном участке OsMYB55. "MeJa" относится к CARE, вовлеченным в реакцию на MeJa. "HSE" относится к CARE, вовлеченным в реакцию на тепловой стресс. "ABRE" относится к CARE, вовлеченным в реакцию на абсцизовую кислоту. Числа под диаграммой указывают положения CARE относительно кодона инициации ATG.
На фигуре 3 изображены относительные уровни экспрессии генов OsMSB55 на различных стадиях жизненного цикла растений риса дикого типа, выращиваемых в нормальных условиях роста.
Фигура 4 представляет собой график, показывающий относительные уровни транскрипта OsMYB55 (среднее значение ± стандартное отклонение, п=3) в листьях, взятых из растений риса дикого типа, выращиваемых в нормальных условиях роста в течение четырех недель и затем воздействовали температурой 45°С в течение 0,1,6 или 24 часов.
На фигуре 5 показаны поперечные срезы влагалищ листов (I, II), листовой пластинки (III) и корней (IV), взятые от растений риса, экспрессирующих GUS под контролем фрагмента размером 2134 пары оснований (SEQ ID NO:1) из промоторного участка OsMYB55 (OsMYB55npoMOTop-GUS), которые выращивали в нормальных условиях роста в течение 4 недель и затем воздействовали температурой 29°С (слева) или 45°С (справа) в течение 24 часов. Растительные ткани погружали в раствор, содержащий 1 мг/мл 5-бром-4-хлор-3-индолил-В-6-глюкуронида (X-Gluc; Biosynth, Итаска, Иллинойс) для окрашивания белка GUS, и поперечные срезы собирали и визуализировали с использованием светового микроскопа.
Фигура 6 представляет собой график, показывающий уровни транскрипта OsMYB55 в листьях растений риса дикого типа (WT) и трансгенных растений риса, сверхэкспрессирующих OsMYB55 (OsMYB55-4; OsMYB55-11), выращиваемых в нормальных условиях роста в течение четырех недель.
На фигуре 7А показаны семена из растений риса дикого типа (WT) и трансгенных растений риса, сверхэкспрессирующих OsMYB55 (OsMYB55-4; OsMYB55-11), после прорастания и четырех дней роста при 28°С или 39°С.
Фигура 7В представляет собой график, показывающий длину колеоптилей (среднее значение ± стандартное отклонение, п=3) растений риса дикого типа (WT) и трансгенных растений риса, сверхэкспрессирующих
OsMYB55, после прорастания и четырех дней роста при 28°С (контроль) или 39°С (высокая температура). Каждая параллель состояла из 25 проростков.
На фигуре 8А показаны растения риса дикого типа (WT) и трансгенные растения риса, сверхэкспрессирующие OsMYB55 (55:4; 55:11), после прорастания в нормальных условиях роста и четырех недель роста в Turface(r) MVP(r) (PROFILE Products, LLC, Буффало Гров, Иллинойс) при условиях длинного светового дня и либо при условиях нормальной температуры (контроль), либо при условиях высокой температуры (высокая температура).
Фигуры 8B-8D представляют собой графики, показывающие значения (В) высоты растений, (С) надземной вегетативной биомассы и (D) биомассы корней (среднее значение ± стандартное отклонение, п=6) растений риса дикого типа (WT) и трансгенных растений риса, сверхэкспрессирующих OsMYB55 (OsMYB55-4; OsMYB55-11), после прорастания в нормальных условиях роста и четырех недель роста в Turface(r) MVP(r) (PROFILE Products, LLC, Буффало Гров, Иллинойс) при условиях длинного светового дня и либо при условиях нормальной температуры (контроль), либо при условиях высокой температуры (высокая температура).
На фигуре 9А показаны растения риса дикого типа (WT) и трансгенные растения риса, сверхэкспрессирующие OsMYB55 (MYB55-4; MYB55-11), после четырех недель роста в сфагнуме:вермикулите (1:4) при условиях нормального светового дня и либо при условиях нормальной температуры ("29"), либо при условиях высокой температуры ("35").
На фигуре 9В показаны растения риса дикого типа (WT) и трансгенные растения риса, сверхэкспрессирующие OsMYB55 (MYB55-4; MYB55-11), после четырех недель роста в сфагнуме:вермикулите (1:4) при условиях нормального светового дня и при условиях высокой температуры.
Фигура 9С представляет собой график, показывающий надземную сухую биомассу в период вегетативного роста (среднее значение ± стандартное отклонение, п=6) растений риса дикого типа (WT) и трансгенных растений риса, сверхэкспрессирующих OsMYB55 (MYB55-4; MYB55-11), после четырех недель роста при условиях нормального светового дня и либо при условиях нормальной температуры (контроль), либо при условиях высокой температуры (высокая температура).
Фигура 9D представляет собой график, показывающий высоту растения и длину влагалища листа (среднее значение ± стандартное отклонение, п=6) растений риса дикого типа (WT) и трансгенных растений риса, сверхэкспрессирующих OsMYB55 (MYB55-4; MYB55-11), после четырех недель роста при условиях нормального светового дня и при условиях высокой температуры.
На фигуре 10А показаны метелки риса у растения риса дикого типа (крайнее левое растение в каждой группе) и трансгенных растений риса, сверхэкспрессирующих OsMYB55 (два крайних правых растения в каждой группе), после девяти недель роста при условиях нормального светового дня и либо при условиях нормальной температуры (слева), либо при условиях высокой температуры (справа).
На фигуре 10В показаны метелки риса у растения риса дикого типа после 11 недель роста в нормальных условиях роста.
На фигуре ЮС показаны метелки риса у растения риса дикого типа после 11 недель роста при условиях длинного светового дня и при условиях высокой температуры.
На фигуре 10D показаны метелки риса у растения риса дикого типа после 11 недель роста при условиях нормального светового дня и при условиях высокой температуры.
На фигуре 10Е показаны метелки риса у растения риса дикого типа после 17 недель роста в нормальных условиях роста.
На фигуре 10F показаны метелки риса у растения риса дикого типа, выращиваемого в течение 17 недель при условиях длинного светового дня и при условиях высокой температуры.
На фигуре 10G показаны метелки риса у растения риса дикого типа, выращиваемого в течение 17 недель при условиях нормального светового дня и при условиях высокой температуры.
Фигуры 11А-11В представляют собой графики, показывающие процентное снижение значений (А) общей сухой биомассы и (В) урожая зерна растений риса дикого типа (WT) и трансгенных растений риса, сверхэкспрессирующих OsMYB55 (OsMYB55-4; OsMYB55-11), выращиваемых при условиях нормального светового дня и при условиях высокой температуры в течение четырех недель, а затем выращиваемых в нормальных условиях
роста до момента сбора урожая (приблизительно 12 дополнительных недель), по сравнению с эквивалентными растениями, выращиваемыми в нормальных условиях роста до момента сбора урожая (приблизительно 16 недель).
Фигура 12 представляет собой график, показывающий относительные уровни транскрипта (среднее значение ± стандартное отклонение) OsMYB55 в листьях растений риса дикого типа (WT) и трансгенных растений риса, экспрессирующих интерферирующую РНК для OsMYB55 (OsMYB55-RHA\) (OsMYB55::RNAi-12; OsMYB55::RNAi-16), выращиваемых в нормальных условиях роста. Уровень транскрипта OsMYB55 у OsMYB55::RNAi-12 использовали в качестве эталонного значения для расчета относительных уровней транскрипта.
Фигура 13А представляет собой график, показывающий общее содержание аминокислот (среднее значение ± стандартное отклонение, п=3) в листьях из растений риса дикого типа (WT) и трансгенных растений риса, сверхэкспрессирующих OsMYB55 (OsMYB55-4; OsMYB55-11), выращиваемых в течение четырех недель при условиях длинного светового дня и либо при условиях нормальной температуры (контроль), либо при условиях высокой температуры (высокая температура).
Фигуры 13B-13D представляют собой графики, показывающие относительные уровни экспрессии (среднее значение ± стандартное отклонение, п=3) (В) глутаминсинтетазы Oryza sativa (OsGs1;2), (С) глутаминамидотрансферазы класса I Oryza sativa (OsGATI) и (D) глутаминдекарбоксилазы 3 Oryza sativa (OsGAD3) в листьях растений риса дикого типа (WT) и трансгенных растений риса, сверхэкспрессирующих OsMYB55 (OsMYB55-4; OsMYB55-11), выращиваемых при условиях длинного светового дня и при условиях нормальной температуры в течение четырех недель (контроль) или выращиваемых при условиях длинного светового дня и при условиях нормальной температуры в течение четырех недель, а затем подвергнутых воздействию температуры 45°С в течение 1, 6 или 24 часов. Результаты, изображенные на графике, являются типичными для подобных результатов от трех независимых экспериментов.
На фигуре 14А показаны анализы сдвигов электрофоретической подвижности при использовании изменяющихся количеств рекомбинантного
OsMYB55 (0-40 мкг) и 200 нг ДНК, содержащей одну копию промоторного участка, выделенного из (I) OsGs1;2, (II) OsGATI или (III) OsGAD3.
Фигура 14В представляет собой график, показывающий уровни экспрессии (среднее значение ± стандартное отклонение, n=6) GUS в анализе временной экспрессии гена, в котором четырехнедельные растения табака подвергали совместной трансформации вектором, содержащим OsMYB55, и вектором-репортером для GUS, содержащим GUS, под контролем промоторного участка, выделенного из OsGs1;2, OsGATI или OsGAD3.
Фигура 15А представляет собой график, показывающий содержание глутаминовой кислоты (среднее значение ± стандартное отклонение) в листьях из растений риса дикого типа (WT) и трансгенных растений риса, сверхэкспрессирующих OsMYB55 (OsMYB55-4; OsMYB55-11), после четырех недель роста при условиях длинного светового дня и либо при условиях нормальной температуры (контроль), либо при условиях высокой температуры (высокая температура).
Фигура 15В представляет собой график, показывающий содержание у-аминомасляной кислоты (GABA) (среднее значение ± стандартное отклонение) в листьях из растений риса дикого типа (WT) и трансгенных растений риса, сверхэкспрессирующих OsMYB55 (OsMYB55-4; OsMYB55-11), после четырех недель роста при условиях длинного светового дня и либо при условиях нормальной температуры (контроль), либо при условиях высокой температуры (высокая температура).
Фигура 15С представляет собой график, показывающий содержание аргинина (среднее значение ± стандартное отклонение) в листьях из растений риса дикого типа (WT) и трансгенных растений риса, сверхэкспрессирующих OsMYB55 (OsMYB55-4; OsMYB55-11), после четырех недель роста при условиях длинного светового дня и либо при условиях нормальной температуры (контроль), либо при условиях высокой температуры (высокая температура).
Фигура 15D представляет собой график, показывающий содержание пролина (среднее значение ± стандартное отклонение) в листьях из растений риса дикого типа (WT) и трансгенных растений риса, сверхэкспрессирующих OsMYB55 (OsMYB55-4; OsMYB55-11), после четырех недель роста при условиях длинного светового дня и либо при условиях нормальной
температуры (контроль), либо при условиях высокой температуры (высокая температура).
Фигуры 16А-16В представляют собой диаграммы Венна, представляющие количество генов, которые подвергались значительной (А) повышающей регуляции или (В) понижающей регуляции в растениях риса дикого типа (WT) и трансгенных растениях риса, сверхэкспрессирующих OsMYB55 (OsMYB55), после четырех недель роста в нормальных условиях роста и последующего воздействия температуры 45°С в течение одного часа.
На фигурах 17А-Н показана аминокислотная и кодирующая последовательности для различных гомологов MYB55 растений. На фигуре 17А изображены аминокислотная последовательность (SEQ ID NO: 6) и последовательность кДНК (SEQ ID NO: 14) для гомолога MYB55 из Sorghum bicolor. На фигуре 17В изображены аминокислотная последовательность (SEQ ID NO: 7) и последовательность кДНК (SEQ ID NO: 15) для гомолога MYB55 из Zea mays. На фигуре 17С изображена аминокислотная последовательность (SEQ ID N0:7) для гомолога MYB55 из Vitis vinifera. На фигуре 17D изображены аминокислотная последовательность (SEQ ID N0: 9) и последовательность кДНК (SEQ ID N0: 16) для гомолога MYB55 (ранее обозначенного MYB133) из Populus trichocarps. На фигуре 17Е изображены аминокислотная последовательность (SEQ ID NO: 10) и последовательность кДНК (SEQ ID N0: 17) для гомолога MYB55 (ранее обозначенного MYB24) из Malus х domestica. На фигуре 17F изображены аминокислотная последовательность (SEQ ID N0: 11) и последовательность кДНК (SEQ ID N0: 18) для гомолога MYB55 (ранее обозначенного DcMYB4) из Glycine max. На фигуре 17G изображены аминокислотная последовательность (SEQ ID N0: 12) и последовательность кДНК (SEQ ID N0: 19) для гомолога MYB55 из Daucus carota. На фигуре 17Н изображены аминокислотная последовательность (SEQ ID N0: 13) и последовательность кДНК (SEQ ID NO: 20) для гомолога MYB55 (ранее обозначенного MYB36) из Arabidopsis thaliana.
ПОДРОБНОЕ ОПИСАНИЕ ИЗОБРЕТЕНИЯ Следует понимать, что настоящее изобретение можно осуществлять в различных формах, и его не следует рассматривать как ограниченное вариантами осуществления, изложенными в настоящем документе. Наоборот, данные варианты осуществления представлены с тем, чтобы данное раскрытие
было подробным и полным и полностью передавало объем настоящего изобретения специалисту в данной области техники.
Если контекст не указывает иное, в частности, предполагается, что различные признаки настоящего изобретения, описанного в данном документе, можно использовать в любой комбинации.
Более того, настоящим изобретением также предполагается, что в некоторых вариантах осуществления настоящего изобретения любой признак или комбинацию признаков, изложенных в данном документе, можно исключить или опустить. Для иллюстрации, если описание утверждает, что композиция содержит компоненты А, В и С, это, в частности, предполагает, что любое из А, В или С или их комбинации, можно опустить и отклонить по отдельности или в любой комбинации.
Если не указано иное, все технические и научные термины, используемые в данном документе, имеют то же значение, какое обычно понятно среднему специалисту в области техники, к которой относится настоящее изобретение. Терминология, применяемая в описании настоящего изобретения в данном документе, используется только в целях описания конкретных вариантов осуществления и не предназначена для ограничения настоящего изобретения.
Все публикации, патентные заявки, патентные документы и другие источники, которые упоминаются в данном документе, включены посредством ссылки во всей своей полноте. I. Определения.
Используемые в описании настоящего изобретения и прилагаемой формуле изобретения формы единственного числа, как предполагается, также включают формы множественного числа, если контекст явно не указывает иное.
Используемое в данном документе, "и/или" относится к и охватывает любую и все возможные комбинации из одного или нескольких соответствующих перечисленных элементов, а также отсутствие комбинаций при интерпретации в качестве альтернативы ("или").
Выражение "приблизительно", используемое в данном документе при упоминании измеряемой величины, такой как дозировка или период времени и
т.п., предназначено для охвата изменений определенного количества на ± 20%, ± 10%, + 5%, ± 1%, ± 0,5% или даже ± 0,1%.
Выражение "содержат", "содержит" и/или "содержащий" при использовании в данном документе указывает на присутствие определенных признаков, единиц, этапов, операций, элементов и/или компонентов, но не исключают присутствие или добавление одного или нескольких других признаков, единиц, этапов, операций, элементов, компонентов и/или их групп.
Используемая в данном документе переходная фраза "состоящий главным образом из" означает, что объем пункта формулы изобретения следует интерпретировать как охватывающий определенные вещества или этапы, перечисленные в пункте формулы изобретения, и таковые, которые не влияют существенно на основную и новую характеристику (характеристики) заявляемого изобретения. См., In re Herz, 537 F.2d 549, 551-52, 190 U.S.P.Q. 461, 463 (CCPA 1976) (выделение в оригинале); см. также МРЕР § 2111.03. Таким образом, выражение "по сути состоящий из", используемое в пункте формулы изобретения или в описании настоящего изобретения, не предназначено для интерпретации как эквивалентное выражению "содержащий".
Если не указано иное, выражения "тепловой стресс" и "высокая температура" (и подобные выражения) относятся к воздействию на растение, часть растения или растительную клетку повышенными температурами, которые являются более высокими, чем оптимальные для вида и/или сорта растений и/или стадии развития. В типичных вариантах осуществления растение, часть растения или растительная клетка подвергаются воздействию высокой температуры в течение недостаточного времени для получения теплового стресса (например, уменьшенного урожая). В вариантах осуществления настоящего изобретения растение, часть растения или растительная клетка подвергаются воздействию высокой температуры в течение достаточного времени для получения теплового стресса.
Например, в вариантах осуществления настоящего изобретения растение может подвергаться воздействию высокой температуры в течение достаточного периода времени для того, чтобы получить тепловой стресс у растения и в результате привести к неблагоприятному воздействию на функционирование, развитие и/или характеристики растения, например,
ослабленное деление клеток, уменьшенные размеры (например, уменьшенная высота растений), и/или уменьшенное количество растений и/или их частей, и/или ухудшение агрономического признака, такого как уменьшенный урожай, опадение плодов, размер и/или количество плодов, размер и/или количество семян, качество продукции вследствие внешнего вида и/или текстуры, и/или повышенное недоразвитие цветков. Растения, части растений и растительные клетки могут подвергаться воздействию или находиться под воздействием теплового стресса или высокой температуры в ряде обстоятельств, например, культивируемое растение может подвергаться воздействию теплового стресса или высокой температуры из-за температур окружающей среды; растение, часть растения или растительная клетка подвергаются воздействию теплового стресса или высокой температуры в ходе сбора урожая, обработки, хранения и/или перевозки; или растение, часть растения или растительную клетку подвергают воздействию теплового стресса или высокой температуры для достижения желаемого эффекта (например, индукция активности индуцируемого высокой температурой промотора).
Специалист в данной области техники поймет, что выражения "тепловой стресс" и "высокая температура" не являются абсолютными и могут изменяться с видом растения, сортом растения, стадией развития, доступностью воды, типом почвы, географическим положением, продолжительностью дня, временем года, присутствием других абиотических и/или биотических факторов, вызывающих стресс, и других параметров, которые также находятся в компетенции специалиста в данной области. Таким образом, в то время как на один вид может оказывать сильное влияние температура 23°С, другой вид может не подвергаться воздействию до достижения по меньшей мере 30°С и т.п. Как правило, температуры выше 30°С приводят к значительному уменьшению урожаев наиболее важных культур.
В вариантах осуществления настоящего изобретения воздействие теплового стресса или высокой температуры включает воздействие на растение, часть растения или растительную клетку температур по меньшей мере приблизительно 30°С, ЗГС, 32°С, 33°С, 34°С, 35°С, 36°С, 37°С, 38°С, 39°С, 40°С, 4ГС, 42°С, 43°С, 44°С, 45°С, 46°С, 47°С, 48°С, 49°С, 5(ГС, 51 °С, 52°С, 53°С, 54°С или 55°С. В вариантах осуществления настоящего изобретения воздействие теплового стресса или высокой температуры относится к
температурам от приблизительно 30°С до приблизительно 45°С, 46°С, 47°С, 48°С, 49°С, 50°С, 5ГС, 52°С, 53°С, 54°С или 55°С; от приблизительно 31 °С до приблизительно 45°С, 46°С, 47°С, 48°С, 49°С, 5СГС, 5ГС, 52°С, 53°С, 54°С или 55°С; от приблизительно 32°С до приблизительно 45°С, 46°С, 47°С, 48°С, 49°С, 50°С, 5ГС, 52°С, 53°С, 54°С или 55°С; от приблизительно 33°С до приблизительно 45°С, 46°С, 47°С, 48°С, 49°С, 50°С, 5ГС, 52°С, 53°С, 54°С или 55°С; от приблизительно 34°С до приблизительно 45°С, 46°С, 47°С, 48°С, 49°С, 50°С, 51 °С, 52°С, 53°С, 54°С или 55°С; от приблизительно 35°С до приблизительно 45°С, 46°С, 47°С, 48°С, 49°С, 50°С, 51 °С, 52°С, 53°С, 54°С или 55°С; от приблизительно 36°С до приблизительно 45°С, 46°С, 47°С, 48°С, 49°С, 50°С, 51 °С, 52°С, 53°С, 54°С или 55°С; от приблизительно 37°С до приблизительно 45°С, 4б°С, 47°С, 48°С, 49°С, 50°С, 51°С, 52°С, 530С, 54°С или 55°С; от приблизительно 38°С до приблизительно 45°С, 46°С, 47°С, 48°С, 49°С, 50°С, 51 °С, 52°С, 53°С, 54°С или 55°С; от приблизительно 39°С до приблизительно 45°С, 46°С, 47°С, 48°С, 49°С, 50°С, 5ГС, 52°С, 53°С, 54°С или 55°С; или от приблизительно 40°С до приблизительно 45°С, 46°С, 47°С, 48°С, 49°С, 50°С, 5ГС, 52°С, 53°С, 54°С или 55°С. В типичных вариантах осуществления вышеуказанные температуры относятся к дневным температурам.
В дополнительных вариантах осуществления воздействие теплового стресса или высокой температуры включает воздействие на растение, часть растения или растительную клетку ночных температур приблизительно 24°С, 25°С, 26°С, 27°С, 28°С, 29°С, 30°С, 31 °С, 32°С, 33°С, 34°С, 35°С, 36°С, 37°С, 38°С, 39°С, 40°С, 41 °С, 42°С, 43°С, 44°С, 45°С, 46°С, 47°С, 48°С, 49°С, 50°С, 51 °С, 52°С, 53°С, 54°С или 55°С. В вариантах осуществления настоящего изобретения тепловой стресс или высокая температура относится к ночным температурам от приблизительно 25"С до приблизительно 40°С, 41 "С, 42°С, 43°С, 44°С, 45°С, 46°С, 47°С, 48°С, 49°С, 50°С, 5ГС, 52°С, 53°С, 54°С или 55°С; от приблизительно 26°С до приблизительно 40°С, 4ГС, 42°С, 43°С, 44°С, 45°С, 46°С, 47°С, 48°С, 49°С, 50°С, 51 °С, 52°С, 53°С, 54°С или 55°С; от приблизительно 27°С до приблизительно 40°С, 41 °С, 42°С, 43°С, 44°С, 45°С, 46°С, 47°С, 48°С, 49°С, 50°С, 5ГС, 52°С, 53°С, 54°С или 55°С; от приблизительно 28"С до приблизительно 40°С, 41 °С, 42°С, 43°С, 44°С, 45°С, 46°С, 47°С, 48°С, 49°С, 50°С, 51 "С, 52°С, 53°С, 54°С или 55°С; от
приблизительно 29°С до приблизительно 40°С, 41 °С, 42°С, 43°С, 44°С, 45°С, 46°С, 47°С, 48°С, 49°С, 50°С, 5ГС, 52°С, 53°С, 54°С или 55°С; от приблизительно 30°С до приблизительно 40°С, 4ГС, 42°С, 43°С, 44°С, 45°С, 46°С, 47°С, 48°С, 49°С, 50°С, 51 °С, 52°С, 53°С, 54°С или 55°С; от приблизительно ЗГС до приблизительно 40°С, 41 °С, 42'С, 43°С, 44°С, 45°С, 46°С, 47°С, 48°С, 49°С, 5ГУС, 51 °С, 52°С, 53°С, 54°С или 55°С; от приблизительно 32°С до приблизительно 40°С, 4ГС, 42°С, 43°С, 44°С, 45°С, 46°С, 47°С, 48°С, 49°С, 50°С, 51 °С, 52°С, 53°С, 54°С или 55°С; от приблизительно 33°С до приблизительно 40°С, 41 °С, 42°С, 43°С, 44°С, 45°С, 46°С, 47°С, 48°С, 49°С, 50°С, 51 "С, 52°С, 53°С, 54°С или 55°С; от приблизительно 34°С до приблизительно 40°С, 4ГС, 42°С, 43°С, 44°С, 45°С, 46°С, 47°С, 48°С, 49°С, 50°С, 5ГС, 52°С, 53°С, 54°С или 55°С; или от приблизительно 35°С до приблизительно 40°С, 41 °С, 42°С, 43°С, 44°С, 45°С, 46°С, 47°С, 48°С, 49°С, 50°С, 51 °С, 52°С, 53°С, 54°С или 55°С.
Растение, часть растения или растительная клетка могут подвергаться воздействию теплового стресса или высокой температуры в течение любого периода времени. В иллюстративных вариантах осуществления растение, часть растения или растительная клетка подвергают воздействию теплового стресса или высокой температуры в течение периода по меньшей мере приблизительно 1, 2, 5, 10, 15, 20, 30, 40, 50, 60, 90 или 120 минут или дольше; по меньшей мере приблизительно 1, 2, 5, 10, 15, 18, 24, 48, 72 или 96 часов или дольше; по меньшей мере приблизительно 1, 2, 3, 4, 7, 10, 14, 21 или 30 дней или дольше, по меньшей мере приблизительно 1, 2, 3, 4, 5 или 6 недель или дольше; или по меньшей мере приблизительно 1,2,3 или 4 месяцев или дольше.
Необязательно, растение, часть растения или растительная клетка подвергается воздействию теплового стресса или высокой температуры в течение вегетативной стадии роста. Под воздействием на растение, часть растения или растительную клетку тепловым стрессом или высокой температурой в течение вегетативной стадии роста подразумевают, что растение, часть растения или растительная клетка подвергается воздействию теплового стресса или высокой температуры в течение всей вегетативной стадии роста или ее части, например, в течение периода по меньшей мере приблизительно 1, 2, 5, 10, 15, 20, 30, 40, 50, 60, 90 или 120 минут или дольше;
по меньшей мере приблизительно 1, 2, 5, 10, 15, 18, 24, 48, 72 или 96 часов или дольше; по меньшей мере приблизительно 1, 2, 3, 4, 7, 10, 14, 21 или 30 дней или дольше, по меньшей мере приблизительно 1, 2, 3, 4, 5 или 6 недель или дольше; или по меньшей мере приблизительно 1, 2, 3 или 4 месяцев или дольше.
В типичных вариантах осуществления, растение, часть растения или растительная клетка не подвергается воздействию теплового стресса или высокой температуры во время стадий цветения и/или завязывания семян.
Настоящее изобретение охватывает условия теплового стресса или высокой температуры, получаемые при любой комбинации температур и периодов времени, описанных в данном документе.
В типичных вариантах осуществления растение, часть растения или растительная клетка подвергается воздействию теплового стресса или высокой температуры, включающему дневную температуру приблизительно 35"С и ночную температуру приблизительно 26°С, например, в течение периода приблизительно одна, две, три, четыре недели или дольше. В вариантах осуществления настоящего изобретения растение, часть растения или растительная клетка подвергается воздействию теплового стресса или высокой температуры, включающему воздействие температуры до приблизительно 45°С в течение периода по меньшей мере приблизительно 5, 10, 15, 20, 30, 40, 50, 60, 90 или 120 минут или дольше.
Специалист в данной области техники поймет, что, в целом, растение, часть растения или растительная клетка подвергается воздействию сублетального уровня теплового стресса или высокой температуры (например, которое не является смертельным для растения, части растения или растительной клетки).
Используемые в данном документе выражения "повышенная выносливость к тепловому стрессу", "повышение выносливости к тепловому стрессу", "повышенная выносливость к высокой температуре" или "повышение выносливости к высокой температуре" (и подобные выражения) относятся к способности растения, части растения или растительной клетки, подвергающейся воздействию теплового стресса или высокой температуры и содержащей нуклеиновую кислоту (например, выделенную нуклеиновую кислоту), кассету экспрессии или вектор, который описан в данном документе,
выдерживать указанный тепловой стресс или высокую температуру лучше, чем контрольное растение, часть растения или растительная клетка (т.е., растение, часть растения или растительная клетка, которые не содержат нуклеиновую кислоту, кассету экспрессии или вектор, которые описаны в данном документе). Повышенную выносливость к тепловому стрессу или высокой температуре можно измерить с помощью ряда параметров, в том числе без ограничения усиленное деление клеток, увеличенные размеры (например, высота растения) и/или увеличенное количество растений и/или их частей и/или улучшение агрономического признака, такого как повышенный урожай, опадение плодов, размер и/или количество плодов, размер и/или количество семян, и/или повышенное качество продукции вследствие внешнего вида и/или текстуры, и/или уменьшенное недоразвитие цветков. В вариантах осуществления настоящего изобретения повышенную выносливость к тепловому стрессу или высокой температуре можно оценивать по увеличению высоты растения, биомассы растения (например, сухой биомассы) и/или урожая зерна. Увеличение этих показателей (например, урожая, размера растения, высоты растения, биомассы растения, урожая зерна и т.п.) может указывать на то, что присутствует повышение по сравнению с контрольным растением, частью растения или растительной клеткой, которые не подверглись воздействию теплового стресса или высокой температуры, и/или может указывать на то, что присутствует повышение по сравнению с контрольным растением, частью растения или растительной клетки, которые подверглись воздействию теплового стресса или высокой температуры, но не содержат нуклеиновую кислоту, кассету экспрессии или вектор, которые описаны в данном документе. Иными словами, может существовать уменьшение по сравнению с растением, частью растения или растительной клеткой, которые не подвергались воздействию теплового стресса или высокой температуры, но это уменьшение является меньшим, чем у растения, части растения или растительной клетки подвергающимся воздействию теплового стресса или высокой температуры, которые не содержат нуклеиновую кислоту, кассету экспрессии или вектор, которые описаны в данном документе.
"Урожай", как используется в данном документе, относится к получению коммерчески и/или сельскохозяйственно важного растения, растительной биомассы (например, сухой биомассы), части растения (например, корней,
клубней, семян, листьев, плодов, цветков), растительного материала (например, экстракта) и/или другого продукта, вырабатываемого растением (например, рекомбинантного полипептида). В вариантах осуществления настоящего изобретения "увеличенный урожай" оценивают по увеличению высоты растения.
"Повышение содержания аминокислот," "повышенное содержание аминокислот" и подобные выражения, которые используются в данном документе, относятся к увеличению количества и/или концентрации аминокислот. Повышение может представлять собой повышение общего содержания аминокислот и/или может представлять собой повышение содержания одной или нескольких отдельных аминокислот, обнаруживаемых в растениях, в том числе без ограничения глутаминовой кислоты, аргинина, гамма-аминомасляной кислоты (GABA), пролина, аспарагиновой кислоты, аспарагина, треонина, лейцина, изолейцина, треонина, метионина, аланина, валина, глицина, лизина, серина, цистеина, гистидина, триптофана, тирозина, фенилаланина, орнитина, цитруллина или любой их комбинации. В вариантах осуществления настоящего изобретения имеет место повышение содержания глутаминовой кислоты, аргинина, GABA и/или пролина. Повышение содержания аминокислот может иметь место в общей растительной биомассе и/или в одной или нескольких их частях или тканях (например, листьях, влагалищах листа и/или корнях). Повышение содержания аминокислот можно оценить в отношении любого подходящего контроля, например, растения, части растения или растительной клетки, который не содержит нуклеиновую кислоту, кассету экспрессии или вектор, которые описаны в данном документе. В вариантах осуществления настоящего изобретения растение подверглось воздействию теплового стресса или высокой температуры. В вариантах осуществления настоящего изобретения растение не подверглось воздействию теплового стресса или высокой температуры.
Выражение "модулировать" (и грамматические варианты) относится к повышению или снижению.
Используемые в данном документе выражения "повышают", "повышает", "повышенный", "повышающий" и подобные выражения указывают на увеличение по меньшей мере приблизительно на 25%, 50%, 75%, 100%, 150%, 200%, 300%, 400%, 500% или более.
Используемые в данном документе выражения "снижают", "снижает", "сниженный", "снижение" и подобные выражения означают уменьшение по меньшей мере приблизительно на 25%, 35%, 50%, 75%, 80%, 85%, 90%, 95%, 97% или более. В конкретных вариантах осуществления снижение не приводит или, по сути, не приводит к (т.е. несущественное количество, например, менее чем приблизительно 10% или даже 5%) выявляемым активности или количеству.
Используемое в данном документе выражение "гетерологичный" означает чужеродный, экзогенный, ненативный и/или не встречающийся в естественных условиях.
Как используется в данном документе, "гомологичный" означает нативный. Например, гомологичные нуклеотидная последовательность или аминокислотная последовательность означают нуклеотидную последовательность или аминокислотную последовательность, которая в естественных условиях связана с клеткой-хозяином, в которую она встроена, гомологичная промоторная последовательность представляет собой промоторную последовательность, которая в естественных условиях связана с кодирующей последовательностью и т.п.
Как используется в данном документе, "химерная нуклеиновая кислота," "химерная нуклеотидная последовательность" или "химерный полинуклеотид" содержит промотор, имеющий функциональную связь с нуклеотидной последовательностью, представляющей интерес, которая является гетерологичной по отношению к промотору (или наоборот). В конкретных вариантах осуществления "химерная нуклеиновая кислота," "химерная нуклеотидная последовательность" или "химерный полинуклеотид" содержит нуклеиновую кислоту, которая описана в данном документе, функционально связанную с гетерологичной промоторной последовательностью.
"Промотор" представляет собой нуклеотидную последовательность, которая контролирует или регулирует транскрипцию нуклеотидной последовательности (т.е. кодирующей последовательности), которая функционально связана с промотором. Кодирующая последовательность может кодировать полипептид и/или функциональную РНК. Как правило, "промотор" относится к нуклеотидной последовательности, которая содержит сайт связывания для РНК-полимеразы II и управляет инициацией транскрипции. В
целом, промоторы находятся в направлении 5' или выше относительно начала кодирующего участка соответствующей кодирующей последовательности. Промоторный участок может содержать другие элементы, которые действуют как регуляторы экспрессии гена. Они включают консенсусную последовательность TATA бокса и часто консенсусную последовательность СААТ бокса (Breathnach and Chambon, (1981) Аппи. Rev. Biochem. 50:349). У растений СААТ бокс может быть заменен на AGGA бокс (Messing et al., (1983) в Genetic Engineering of Plants, T. Kosuge, C. Meredith and A. Hollaender (eds.), Plenum Press, pp. 211-227).
"Нуклеотидная последовательность, представляющая интерес" относится к любой нуклеотидной последовательности, которая при встраивании в растение придает растению желаемую характеристику, например, повышенную выносливость к тепловому стрессу, высокой температуре и/или засухе. "Нуклеотидная последовательность, представляющая интерес" может кодировать полипептид и/или ингибирующий полинуклеотид {например, функциональную РНК).
"Гетерологичная нуклеотидная последовательность, представляющая интерес" является гетерологичной (например, чужеродной) по отношению к промотору, с которым она функционально связана.
"Функциональная" РНК включает любую нетранслируемую РНК, которая имеет биологическую функцию в клетке, например, регуляция экспрессии гена. Такие функциональные РНК включают без ограничения RNAi (например, siRNA, shRNA), микроРНК, антисмысловую РНК, рибозимы, аптамеры РНК и т.п.
Под используемыми в данном документе выражениями "имеющий функциональную связь" или "функционально связанный" подразумевают, что элементы являются функционально связанными друг с другом, а также обычно являются физически связанными. Например, промотор имеет функциональную связь или является функционально связанным с кодирующей последовательностью (например, нуклеотидной последовательностью, представляющей интерес), если он контролирует транскрипцию последовательности. Таким образом, используемые в данном документе выражения "имеющий функциональную связь" или "функционально связанный" относятся к нуклеотидным последовательностям на одной молекуле нуклеиновой кислоты, которые являются функционально связанными.
Специалист в данной области техники поймет, что контролирующие последовательности (например, промотор) не должны быть смежными с кодирующей последовательностью, поскольку они функционируют для их непосредственной экспрессии. Таким образом, например, промежуточные нетранслируемые и при этом транскрибируемые последовательности могут присутствовать между промотором и кодирующей последовательностью, и промоторная последовательность при этом все еще может рассматриваться как "имеющая функциональную связь" с кодирующей последовательностью.
Под выражением "экспрессируют", "экспрессирующий" или "экспрессия" (или другие грамматические варианты) кодирующей последовательности нуклеиновой кислоты подразумевается, что последовательность транскрибируется. В конкретных вариантах осуществления выражения "экспрессируют", "экспрессирующий" или "экспрессия" (или другие грамматические варианты) могут относится как к транскрипции, так и к трансляции с получением кодируемого полипептида.
Нуклеотидная последовательность или аминокислотная последовательность "дикого типа" относится к встречающимся в естественных условиях ("нативным") или эндогенным нуклеотидной последовательности (включающей соответствующую ей кДНК) или аминокислотной последовательности.
Выражения "нуклеиновая кислота", "полинуклеотид" и "нуклеотидная последовательность" используются в данном документе взаимозаменяемо, если контекст не указывает на иное. Эти выражения охватывают как РНК, так и ДНК, включающую "ДНК, геномную ДНК, частично или полностью синтетическую (например, химически синтезированную) РНК и ДНК и химеры РНК и ДНК. Нуклеиновая кислота, полинуклеотид или нуклеотидная последовательность может быть двухнитевой или однонитевой, и их, кроме того, можно синтезировать с использованием нуклеотидных аналогов или производных (например, инозиновые или фосфоротиоатные нуклеотиды). Такие нуклеотиды можно использовать, например, для получения нуклеиновых кислот, полинуклеотидов и нуклеотидных последовательностей, которые характеризуются измененными способностями к спариванию оснований или повышенной устойчивостью к нуклеазам. Настоящее изобретение дополнительно предусматривает нуклеиновую кислоту, полинуклеотид или
нуклеотидную последовательность, которые являются комплементарной последовательностью (которая может быть либо полной комплементарной последовательностью, либо частичной комплементарной последовательностью) нуклеиновой кислоты, полинуклеотида или нуклеотидной последовательности согласно настоящему изобретению. Нуклеотидные последовательности представлены в данном документе только одной нитью в направлении от 5' к 3' слева направо, если конкретно не указано иное. Нуклеотиды и аминокислоты представлены в данном документе в форме, рекомендованной Комиссией по биохимической номенклатуре IUPAC-IUB, или (для аминокислот) либо с помощью однобуквенного кода, либо с помощью трехбуквенного кода, что в обоих случаях соответствует §1.822 статьи 37 CFR и общепринятому использованию.
Нуклеиновые кислоты и полинуклеотиды согласно настоящему изобретению необязательно являются выделенными. Молекула "выделенной" нуклеиновой кислоты или "выделенный" полинуклеотид представляют собой молекулу нуклеиновой кислоты или полинуклеотид, которые за счет вмешательства человека существует вне своего нативного окружения и таким образом не является природным продуктом. Молекула выделенной нуклеиновой кислоты или выделенный полинуклеотид могут существовать в очищенной форме или могут существовать в окружении, не являющимся нативным, таком как, например, рекомбинантный клетка-хозяин. Таким образом, например, выражение "выделенный" означает отделенный от хромосомы и/или клетки, в которых встречается в естественных условиях. Нуклеиновая кислота или полинуклеотид также является выделенным, если он отделен от хромосомы и/или клетки, в которой он встречается в естественных условиях и затем введен в генетическое окружение, хромосому, местоположение хромосомы и/или клетку, в которых он не встречается в естественных условиях. Молекулы рекомбинантной нуклеиновой кислоты и рекомбинантные полинуклеотиды согласно настоящему изобретению можно рассматривать как "выделенные".
Кроме того, "выделенные" нуклеиновая кислота или полинуклеотид могут представлять собой нуклеотидную последовательность (например, ДНК или РНК), которая не является непосредственно смежной с нуклеотидными последовательностями, с которыми она является непосредственно смежной
(одна на 5' конце и одна на 3' конце) во встречающемся в естественных условиях геноме организма, из которого она была получена. "Выделенные" нуклеиновая кислота или полинуклеотид могут существовать в клетке (например, растительной клетке), необязательно устойчиво встроенными в геном. Согласно данному варианту осуществления "выделенные" нуклеиновая кислота или полинуклеотид могут быть чужеродными по отношению к клетке/организму, в которые они были введены, или они могут быть нативными по отношению к клетке/организму, но существовать в рекомбинантной форме (например, в виде химерных нуклеиновой кислоты или полинуклеотида), и/или может присутствовать дополнительная копия эндогенных нуклеиновой кислоты или полинуклеотида. Таким образом, "молекула выделенной нуклеиновой кислоты" или "выделенный полинуклеотид" также могут включать нуклеотидную последовательность, полученную из и введенную в тот же естественный исходный тип клеток, но которая присутствует в не встречающемся в естественных условиях состоянии, например, присутствует в отличном числе копий, в отличном генетическом фоне и/или под контролем отличных регуляторных последовательностей, нежели обнаруживаемые в нативном состоянии молекулы нуклеиновой кислоты или полинуклеотида.
В типичных вариантах осуществления "выделенные" нуклеиновая кислота или полинуклеотид практически не содержат клеточный материал (в том числе ассоциированные в естественных условиях белки, такие как гистоны, транскрипционные факторы и подобное), вирусный материал, и/или среду культивирования (в случае, если их получают с помощью методик с использованием рекомбинантной ДНК), или химические предшественники или другие химические продукты (в случае химического синтеза). Необязательно, в типичных вариантах осуществления выделенные нуклеиновая кислота или полинуклеотид являются чистыми по меньшей мере приблизительно на 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95% или более чистыми.
Используемые в данном документе выражения "рекомбинантная" нуклеиновая кислота, "рекомбинантный" полинуклеотид или "рекомбинантная" нуклеотидная последовательность относятся к нуклеиновой кислоте, полинуклеотиду или нуклеотидной последовательности, которая была сконструирована, изменена, перегруппирована и/или модифицирована с помощью методик генной инженерии. Выражение "рекомбинантный" не
относится к изменениям, которые происходят в результате естественных событий, таких как спонтанные мутации, или направленный мутагенез.
"Вектор" представляет собой любую молекулу нуклеиновой кислоты для клонирования и/или переноса нуклеиновой кислоты в клетку. Вектор может представлять собой репликон, к которому может быть прикреплена другая нуклеотидная последовательность для обеспечения возможности репликации прикрепленной нуклеотидной последовательности. "Репликон" может представлять собой любой генетический элемент (например, плазмиду, фаг, космиду, хромосому, вирусный геном), который функционирует как автономная единица репликации нуклеиновой кислоты в клетке, т.е., способен к репликации нуклеиновой кислоты под своим собственным контролем. Выражение "вектор" включает как вирусные, так и невирусные (например, плазмидные) молекулы нуклеиновых кислот для введения нуклеиновой кислоты в клетку in vitro, ex vivo и/или in vivo, и он необязательно представляет собой вектор экспрессии. Большое количество векторов, известных из уровня техники, можно использовать для манипуляции, доставки и экспрессии полинуклеотидов. Можно сконструировать векторы, содержащие последовательности, кодирующие селектируемые маркеры, которые обеспечивают отбор клеток, которые содержат вектор и/или имеют некоторые или все из нуклеиновых кислот вектора, интегрированные в геном клетки. Такие маркеры обеспечивают идентификацию и/или отбор клеток-хозяев, которые включают и экспрессируют белки, кодируемые маркером. "Рекомбинантный" вектор относится к вирусному или невирусному вектору, который содержит одну или несколько нуклеотидных последовательностей, представляющий интерес (например, трансгенных), например, два, три, четыре, пять или более нуклеотидных последовательностей, представляющих интерес.
Вирусные векторы использовали в широком спектре применений для доставки генов в клетки, а также в живых субъектов-животных. Вирусные векторы для растений, которые можно использовать, включают без ограничения Agrobacterium tumefaciens, Agrobacterium rhizogenes и геминивирусные векторы. Невирусные векторы включают без ограничения плазмиды, липосомы, электрически заряженные липиды (цитофектины), комплексы нуклеиновая кислота-белок и биополимеры. Дополнительно к нуклеиновой кислоте, представляющей интерес, вектор также может содержать
один или несколько регуляторных участков и/или селектируемых маркеров, полезных при отборе, измерении и мониторинге результатов переноса нуклеиновой кислоты (например, доставки в конкретные ткани, продолжительности экспрессии и т.д.).
Выражение "фрагмент" применительно к нуклеиновой кислоте или полинуклеотиду, как будет понятно, означает нуклеотидную последовательность с уменьшенной длиной по сравнению с эталонной последовательностью или нуклеотидной последовательностью полной длины, и содержащую, состоящую, по сути, из и/или состоящую из смежных нуклеотидов из эталонной последовательности или нуклеотидной последовательности полной длины. Такой фрагмент согласно настоящему изобретению может быть, в случае, когда это является подходящим, включен в больший полинуклеотид, частью которого он является. В некоторых вариантах осуществления такие фрагменты могут включать, состоять, по сути, из и/или состоять из олигонуклеотидов с длиной, которая является большей чем и/или которая составляет по меньшей мере приблизительно 8, 10, 12, 15, 16, 17, 18, 19, 20, 25, 30, 35, 40, 45, 50, 75, 100, 125, 150, 175, 200, 250, 300, 350, 400, 450, 500, 600, 700, 800, 900, 1000, 1100, 1200, 1300, 1400 или 1500 нуклеотидов (необязательно, смежных нуклеотидов) или более из эталонной последовательности или нуклеотидной последовательности полной длины при условии, что фрагмент короче эталонной последовательности или нуклеотидной последовательности полной длины. В типичных вариантах осуществления фрагмент представляет собой биологически активную нуклеотидную последовательность в том значении, в котором это выражение описывается в данном документе.
"Биологически активная" нуклеотидная последовательность представляет собой таковую, которая практически сохраняет по меньшей мере одну биологическую активность, в норме связанную с нуклеотидной последовательностью дикого типа, например, нуклеотидная последовательность кодирует полипептид, который характеризуется ферментативной активностью, связывающей активностью (например, ДНК-связывающей активностью), активностью транскрипционного фактора (например, способность к повышению уровня транскрипции), способностью к повышению выносливости к тепловому стрессу и/или способностью к
повышению содержания аминокислот. В конкретных вариантах осуществления "биологически активная" нуклеотидная последовательность практически сохраняет все из биологических активностей, которыми обладает немодифицированная последовательность. Под "практически сохраняет" биологическую активность подразумевается, что нуклеотидная последовательность сохраняет по меньшей мере приблизительно 50%, 60%, 75%, 85%, 90%, 95%, 97%, 98%, 99% или более от биологической активности нативной нуклеотидной последовательности (и может даже характеризоваться более высоким уровнем активности, чем нативная нуклеотидная последовательность).
Считают, что две нуклеотидные последовательности являются "практически идентичными" друг другу, если они характеризуются по меньшей мере приблизительно 60%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, 99% или даже 100% идентичностью последовательностей. В вариантах осуществления настоящего изобретения "практически идентичная" нуклеотидная последовательность содержит приблизительно 1, 2, 3, 4, 5, 6, 7, 8, 9 или 10 нуклеотидных замен, вставок и/или делеций, рассматриваемых по отдельности или вместе, по сравнению с эталонной последовательностью.
Считают, что две аминокислотные последовательности являются "практически идентичными" друг другу или "практически сходными" друг с другом, если они характеризуются по меньшей мере приблизительно 60%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, 99% или даже 100% идентичностью или сходством последовательностей, соответственно. В вариантах осуществления настоящего изобретения "практически идентичная" аминокислотная последовательность содержит приблизительно 1, 2, 3, 4, 5, 6, 7, 8, 9 или 10 аминокислотных замен, вставок и/или делеций, рассматриваемых по отдельности или вместе, по сравнению с эталонной последовательностью. В вариантах осуществления настоящего изобретения "практически сходная" аминокислотная последовательность содержит приблизительно 1, 2, 3, 4, 5, 6, 7, 8, 9 или 10 аминокислотных замен, вставок и/или делеций, рассматриваемых по отдельности или вместе, по сравнению с эталонной последовательностью, причем аминокислотные замены могут быть консервативными и/или неконсервативными заменами.
Используемое в данном документе выражение "идентичность последовательности" относится к степени, в которой две подвергнутые оптимальному выравниванию последовательности полинуклеотидов или последовательности полипептидов являются неизменными в окне выравнивания компонентов, например, нуклеотидов или аминокислот.
Используемое в данном документе выражение "сходство последовательности" является подобным идентичности последовательности (которая описана в данном документе), но допускает замену консервативных аминокислот (например, аминокислот, чьи боковые цепи характеризуются сходными структурными и/или биохимическими свойствами), которые являются хорошо известными в уровне техники.
Как известно в уровне техники, можно использовать ряд различных программ для идентификации того, характеризуется ли нуклеиновая кислота идентичностью последовательности, или характеризуется ли аминокислотная последовательность идентичностью или сходством последовательности с известной последовательностью. Идентичность или сходство последовательности можно определить с использованием стандартных методик, известных в уровне техники, в том числе без ограничения алгоритма определения локальной идентичности последовательности из Smith & Waterman, Adv. Appl. Math. 2, 482 (1981), с помощью алгоритма выравнивания для определения идентичности последовательности из Needleman & Wunsch, J. Mol. Biol. 48,443 (1970), с помощью способа поиска сходства из Pearson & Lipman, Proc. Natl. Acad. Sci. USA 85,2444 (1988), с помощью компьютерных приложений, в которых реализуются эти алгоритмы (GAP, BESTFIT, FASTA и TFASTA в пакете Wisconsin Genetics Software Package, Genetics Computer Group, 575 Science Drive, Мадисон, Висконсин), программы анализа последовательности Best Fit, описанной Devereux et al., Nucl. Acid Res. 12, 387395 (1984), предпочтительно с использованием настроек по умолчанию, или путем подбора.
Примером пригодного алгоритма является PILEUP. PILEUP создает выравнивание нескольких последовательностей из группы родственных последовательностей с использованием прогрессивных попарных выравниваний. Они также могут быть представлены на графике в виде дерева, показывающего взаимосвязи в кластеризации, использованные для создания
выравнивания. PILEUP использует упрощение способа прогрессивного выравнивания из Feng & Doolittle, J. Mol. Evol. 35, 351-360 (1987); этот способ является подобным описанному Higgins & Sharp, CABIOS 5, 151-153 (1989).
Другим примером пригодного алгоритма является алгоритм BLAST, описанный в Altschul etal., J. Mol. Biol. 215, 403-410, (1990), и Karlin et al., Proc. Natl. Acad. Sci. USA 90, 5873-5787 (1993). Особенно подходящей программой на основе BLAST является программа WU-BLAST-2, которая была получена из Altschul et al., Methods in Enzymology, 266, 460-480 (1996); http://blast.wustl/edu/blast/ README.html. WU-BLAST-2 использует несколько параметров для поиска, которые предпочтительно установлены на значения по умолчанию. Параметры представляют собой динамические значения и устанавливаются программой самостоятельно в зависимости от состава конкретной последовательности и состава конкретной базы данных, при сравнении с которой осуществляется поиск последовательности, представляющий интерес; однако значения можно корректировать для повышения чувствительности.
Дополнительным пригодным алгоритмом является gapped BLAST, о котором сообщалось Altschul etal. Nucleic Acids Res. 25, 3389-3402 (1997).
Программу CLUSTAL также можно использовать для определения сходства последовательностей. Этот алгоритм описан Higgins etal. (1988) Gene 73:237; Higgins etal. (1989) CABIOS 5:151-153; Corpet etal. (1988) Nucleic Acids Res. 16: 10881-90; Huang etal. (1992) CABIOS 8: 155-65; и Pearson etal. (1994) Meth. Mol. Biol. 24: 307-331.
Выравнивание может включать введение гэпов в последовательности, подлежащие выравниванию. Кроме того, для последовательностей, которые содержат либо больше, либо меньше нуклеотидов, чем нуклеиновые кислоты, раскрытые в данном документе, понятно, что в одном варианте осуществления процент идентичности последовательности будет определен на основании количества идентичных оснований нуклеотидов относительно общего количества оснований нуклеотидов. Таким образом, например, идентичность последовательности у последовательностей короче, чем последовательность, конкретно раскрытая в данном документе, будет определена с использованием количества оснований нуклеотидов в более короткой последовательности, в одном варианте осуществления. В расчетах процентной идентичности
относительный вес не присваивается различным проявлениям изменчивости последовательностей, как например, вставки, делеций, замены и т.д.
Две нуклеотидные последовательности также могут считаться в значительной степени идентичными, если две последовательности гибридизируются друг с другом при жестких условиях. Неограничивающие примеры "жестких" условий гибридизации включают условия, представленные жесткостью отмывки 50% формамидом с 5х раствором Денхардта, 0,5% SDS и 1х SSPE при 42°С. "Жесткие условия гибридизации" и "жесткие условия отмывки при гибридизации" в контексте экспериментов по гибридизации нуклеиновой кислоты, таких как Саузерн-гибридизация и Нозерн-гибридизация, являются зависящими от последовательности и отличаются при различных параметрах окружающей среды. Подробное руководство по гибридизации нуклеиновых кислот находится в Tijssen Laboratory Techniques in Biochemistry and Molecular Biology-Hybridization with Nucleic Acid Probes part I chapter 2 "Overview of principles of hybridization and the strategy of nucleic acid probe assays" Elsevier, New York (1993). В некоторых иллюстративных вариантах осуществления две нуклеотидные последовательности, которые считаются в значительной степени идентичными, гибридизируются друг с другом при очень жестких условиях. Как правило, условия гибридизации и отмывки высокой жесткости выбирают так, чтобы температура была приблизительно на 5°С ниже точки плавления (Тт) для конкретной последовательности при определенных ионной силе и рН.
Используемое в данном документе выражение "полипептид" охватывает как пептиды, так и белки (в том числе гибридные белки), если не указано иное.
"Гибридный белок" представляет собой полипептид, получаемый, когда две гетерологичных нуклеотидных последовательности или их фрагменты, кодирующие два (или более) различных полипептидов, не обнаруживаемых слитыми вместе в природе, являются слитыми вместе в соответствующей трансляционной рамке считывания.
Полипептиды согласно настоящему изобретению необязательно являются "выделенными". "Выделенный" полипептид представляет собой полипептид, который за счет вмешательства человека существует вне своего нативного окружения и, таким образом, не является природным продуктом. Выделенный полипептид может существовать в очищенной форме или может
существовать в окружении, не являющемся нативным, таком как, например, рекомбинантная клетка-хозяин. Рекомбинантные полипептиды согласно настоящему изобретению можно рассматривать как "выделенные".
В типичных вариантах осуществления "выделенный" полипептид означает полипептид, который отделен от по меньшей мере некоторых из других компонентов встречающегося в естественных условиях организма или вируса, например, клетки, или вирусных структурных компонентов, или других полипептидов или нуклеиновых кислот, обычно обнаруживаемых связанными с полипептидом, или практически не содержит их. В конкретных вариантах осуществления "выделенный" полипептид является чистым по меньшей мере приблизительно на 1%, 5%, 10%, 25%, 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, 99% или более чистым (вес/вес). В других вариантах осуществления "выделенный" полипептид указывает на то, что достигается по меньшей мере приблизительно 5-кратное, 10-кратное, 25-кратное, 100-кратное, 1000-кратное, 10000-кратное или обогащение белком (вес/вес) по сравнению с исходным материалом. В типичных вариантах осуществления выделенный полипептид представляет собой рекомбинантный полипептид, получаемый с помощью методик, использующих рекомбинантную нуклеиновую кислоту. В вариантах осуществления настоящего изобретения полипептид представляет собой гибридный белок.
Выражение "фрагмент" применительно к полипептиду, как будет понятно, означает аминокислотную последовательность с уменьшенной длиной по сравнению с эталонным полипептидом или полипептидом полной длины, и содержащую, состоящую, по сути, из и/или состоящую из последовательности смежных аминокислот из эталонного полипептида или полипептида полной длины. Такой фрагмент согласно настоящему изобретению может быть, в случае, когда это является подходящим, включен в качестве части гибридного белка, частью которого он является. В некоторых вариантах осуществления такие фрагменты могут включать, состоять, по сути, из и/или состоять из полипептидов с длиной по меньшей мере приблизительно 50, 60, 70, 80, 90, 100, 110, 120, 130, 140, 150, 160, 170, 180, 190, 200, 225, 250, 275, 300, 325, 375, 400, 425, 450, 475 или 500 аминокислот (необязательно, смежных аминокислот) из эталонного полипептида или полипептида полной длины при условии, что фрагмент короче эталонного полипептида или полипептида полной длины. В
типичных вариантах осуществления фрагмент является биологически активным в том значении, в котором это выражение описывается в данном документе.
"Биологически активный" полипептид представляет собой таковой, который практически сохраняет по меньшей мере одну биологическую активность, в норме связанную с полипептидом дикого типа, например, ферментативная активность, связывающая активность (например, ДНК-связывающая активность), активность транскрипционного фактора (например, способность к повышению уровня транскрипции), способность к повышению выносливости к тепловому стрессу и/или способность к повышению содержания аминокислот. В конкретных вариантах осуществления "биологически активный" полипептид практически сохраняет все из биологических активностей, которыми обладает немодифицированная (например, нативная) последовательность. Под "практически сохраняет" биологическую активность, подразумевается, что полипептид сохраняет по меньшей мере приблизительно 50%, 60%, 75%, 85%, 90%, 95%, 97%, 98%, 99% или более от биологической активности нативного полипептида (и может даже характеризоваться более высоким уровнем активности, чем нативный полипептид).
Как используется в данном документе, "эквивалентная" аминокислотная последовательность относится к аминокислотной последовательности, в которой изменены одна или несколько аминокислот. Эквивалент может необязательно иметь "консервативные" изменения, где замененная аминокислота может характеризоваться сходными структурными или химическими свойствами. В частности, при таких изменениях могут руководствоваться известным сходством между аминокислотами по физическим характеристикам, таким как плотность заряда, гидрофобность/гидрофильность, размер и конфигурация, с тем, чтобы аминокислоты замещались другими аминокислотами, характеризующимися, по сути, такими же функциональными свойствами. Например: Ala может быть замещен на Val или Ser; Val может быть замещен на Ala, Leu, Met или lie, предпочтительно на Ala или Leu; Leu может быть замещен на Ala, Val или Не, предпочтительно на Val или lie; Gly может быть замещен на Pro или Cys, предпочтительно на Pro; Pro может быть замещен на Gly, Cys, Ser или Met, предпочтительно на Gly, Cys или Ser; Cys может быть замещен на Gly, Pro, Ser или Met, предпочтительно на Pro или Met; Met может быть замещен на Pro или
Cys, предпочтительно на Cys; His может быть замещен на Phe или Gin, предпочтительно на Phe; Phe может быть замещен на His, Туг или Тгр, предпочтительно на His или Туг; Туг может быть замещен на His, Phe или Тгр, предпочтительно на Phe или Тгр; Тгр может быть замещен на Phe или Туг, предпочтительно на Туг; Asn может быть замещен на Gin или Ser, предпочтительно на Gin; Gin может быть замещен на His, Lys, Glu, Asn или Ser, предпочтительно на Asn или Ser; Ser может быть замещен на Gin, Thr, Pro, Cys или Ala; Thr может быть замещен на Gin или Ser, предпочтительно на Ser; Lys может быть замещен на Gin или Arg; Arg может быть замещен на Lys, Asp или Glu, предпочтительно на Lys или Asp; Asp может быть замещен на Lys, Arg или Glu, предпочтительно на Arg или Glu; и Glu может быть замещен на Arg или Asp, предпочтительно на Asp. После осуществления этих изменений их можно подвергнуть скринингу согласно стандартным методикам для определения их влияния на функцию.
В качестве альтернативы, эквивалентная аминокислотная последовательность может иметь "неконсервативные" изменения (например, замена глицина на триптофан). Аналогичные незначительные изменения также могут включать делеций или вставки аминокислот или как делеций, так и вставки аминокислот. Руководство по определению того, какие аминокислотные остатки можно заменить, вставить или удалить без потери биологической активности, можно найти с использованием компьютерных программ, хорошо известных в уровне техники, например, программного обеспечения LASERGENE(tm).
При проведении замен аминокислот можно учитывать индекс гидрофобное(tm) аминокислот. Важность индексов гидрофобности аминокислот в обеспечении согласованной биологической функции белка в целом известна в данной области техники (см., Kyte and Doolittle, (1982) J. Mol. Biol. 157:105). Предполагается, что относительная гидрофобная характеристика аминокислоты вносит вклад во вторичную структуру получаемого в результате белка, что, в свою очередь, определяет взаимодействие белка с другими молекулами, например, ферментами, субстратами, рецепторами, ДНК, антителами, антигенами и т.п.
Каждой аминокислоте был присвоен индекс гидрофобности на основании ее гидрофобности и характеристик заряда (Kyte and Doolittle, Id.), и эти индексы
являются следующими: изолейцин (+4,5); валин (+4,2); лейцин (+3,8); фенилаланин (+2,8); цистеин/цистин (+2,5); метионин (+1,9); аланин (+1,8); глицин (-0,4); треонин (-0,7); серии (-0,8); триптофан (-0,9); тирозин (-1,3); пролин (-1,6); гистидин (-3,2); глутамат (-3,5); глутамин (-3,5); аспартат (-3,5); аспарагин (-3,5); лизин (-3,9); и аргинин (-4,5).
Также из уровня техники известно, что замену аминокислот можно можно проводить на основании гидрофобности. В патенте США №4554101 указано, что наибольшая средняя локальная гидрофильность белка, которая определяется гидрофильностью его смежных кислот, коррелирует с биологическим свойством белка.
Как подробно указано в патенте США №4554101, аминокислотным остаткам были присвоены следующие значения гидрофильности: аргинин (+3,0); лизин (±3,0); аспартат (+3,0 ± 1); глутамат (+3,0 ± 1); серии (+0,3); аспарагин (+0,2); глутамин (+0,2); глицин (0); треонин (-0,4); пролин (-0,5 ± I); аланин (-0,5); гистидин (-0,5); цистеин (-1,0); метионин (-1,3); валин (-1,5); лейцин (-1,8); изолейцин (-1,8); тирозин (-2,3); фенилаланин (-2,5); триптофан (3,4).
"Введение" в отношении растительной клетки, растительной ткани, части растения и/или растения означает приведение в контакт молекулы нуклеиновой кислоты с растительной клеткой, растительной тканью, частью растения и/или растением таким образом, что молекула нуклеиновой кислоты получает доступ к внутренней части растительной клетки или клетки растительной ткани, части растения или растения. Если введению подлежит более одной молекулы нуклеиновой кислоты, эти молекулы нуклеиновых кислот можно собрать в виде части одного полинуклеотида или конструкта нуклеиновых кислот, или в виде отдельных полинуклеотидов или конструктов нуклеиновых кислот, и можно расположить в одной и той же или в разных конструктах нуклеиновых кислот. Для иллюстрации, данные полинуклеотиды можно вводить в растительные клетки в ходе одного события трансформации, в ходе отдельных событий трансформации или в виде части протокола скрещивания.
Выражение "трансформация", используемое в данном документе, означает введение гетерологичной и/или выделенной нуклеиновой кислоты в клетку. Трансформация клетки может быть стабильной или транзиентной. Таким образом, трансгенные растительная клетка, растительная ткань, часть
растения и/или растение согласно настоящему изобретению могут быть стабильно трансформированы или транзиентно трансформированы.
"Транзиентная трансформация" применительно к полинуклеотиду означает, что полинуклеотид вводится в клетку и не интегрируется в геном клетки.
Используемое в данном документе "стабильное введение", "стабильно введенный", "стабильная трансформация" или "стабильно трансформированный" (и подобные выражения) в отношении полинуклеотида, введенного в клетку, означает, что введенный полинуклеотид стабильно интегрируется в геном клетки (например, в хромосому или в качестве стабильного внехромосомного элемента). Таким образом, введенный полинуклеотид может наследоваться клетками- и растениями-потомками.
"Геном", используемый в данном документе, включает ядерный и/или пластидный геном, и, следовательно, включает интеграцию полинуклеотида, например, в геном хлоропласта. "Стабильная трансформация", используемая в данном документе, может также означать полинуклеотид, который поддерживается внехромосомно, например, в виде минихромосомы.
Используемые в данном документе выражения "трансформированный" и "трансгенный" означают любые растение, растительную клетку, растительную ткань (в том числе каллус) или часть растения, которые содержат целое или часть по меньшей мере одного из рекомбинантных или выделенных нуклеиновой кислоты, полинуклеотида или нуклеотидной последовательности. В типичных вариантах осуществления рекомбинантные или выделенные нуклеиновая кислота, полинуклеотид или нуклеотидная последовательность стабильно встраиваются в геном растения (например, в хромосому или в качестве стабильного внехромосомного элемента), так, что это передается последующим поколениям клетки или растения.
Выражение "часть растения", используемое в данном документе, включает без ограничения репродуктивные ткани (например, лепестки, чашелистики, тычинки, пестики, ложа соцветия, пыльники, пыльца, цветки, плоды, цветочная почка, семязачатки, семена, зародыши, орехи, косточки, колосья, початки кукурузы и шелуха); вегетативные ткани (например, черешки, стебли, корни, корневые волоски, корневые кончики, сердцевина, колеоптили, цветоножки, побеги, ветви, кора, апикальная меристема, пазушная почка,
семядоля, гипокотили и листья); проводящие ткани (например, флоэма и ксилема); специализированные клетки, такие как эпидермальные клетки, паренхиматозные клетки, колленхимные клетки, склеренхимные клетки, имеющие устьица, защитные клетки, кутикула, мезофилльные клетки; каллусная ткань; и черенки. Выражение "часть растения" также включает растительные клетки, в том числе растительные клетки, которые являются интактными в растениях и/или частях растений, протопласты растений, растительные ткани, тканевые культуры растительных клеток из органов растений, растительные каллусы, скопления растительных клеток и подобное. Используемый в данном документе "побег" означает надземные части, в том числе листья и стебли.
Выражение "тканевые культуры" охватывает культуры тканей, клетки, протопласты и каллус.
Используемая в данном документе "растительная клетка" означает структурную и физиологическую единицу растения, которая как правило включает клеточную стенку, но также включает протопласты. Растительная клетка по настоящему изобретению может быть в форме выделенной отдельной клетки, или может быть культивированной клеткой, или может быть частью высокоорганизованной единицы, такой как, например, растительная ткань (в том числе каллус) или орган растения.
Любое растение (или группирования растений, например, в род или более высокий порядок классификации), которые можно использовать в осуществлении настоящего изобретения, включают покрытосемянные или голосемянные, однодольные или двудольные.
Типичные растения включают без ограничения кукурузу (Zea mays), канолу (Brassica napus, Brassica rapa ssp.), люцерну (Medicago saliva), рис (Oryza sativa, в том числе без ограничения разновидности Indica и/или Japonica), рапс (Brassica napus), рожь (Secale cereale), сорго (Sorghum bicolor, Sorghum vulgare), подсолнечник (Helianthus annus), пшеницу (Triticum aestivum), сою (Glycine max), табак (Nicotiana tobacum), картофель (Solanum tuberosum), виды арахиса (Arachis hypogaea), хлопчатник (Gossypium hirsutum), сладкий картофель (Ipomoea batatus), маниоку (Manihot esculenta), кофейное дерево (Cofea spp.), кокососвую пальму (Cocos nucifera), ананас (Ananas comosus), цитрусовые деревья (Citrus spp.), дерево какао (Theobroma cacao), чайное
растение (Camellia sinensis), банан (Musa spp.), авокадо (Persea americana), фиговое дерево (Ficus casica), гуаву (Psidium guajava), манго (Mangifera indica), оливу (Olea europaea), дынное дерево (Carica papaya), анакардию западную (Anacardium occidentale), макадамию (Macadamia integrifolia), миндаль (Prunus amygdalus), виды сахарной свеклы (Beta vulgaris), яблоню (Malus pumila), ежевику (Rubus), клубнику (Fragaria), грецкий орех (Juglans regia), виноград (Wis vinifera), абрикос (Prunus armeniaca), вишню (Prunus), персик (Prunus persica), сливу (Prunus domestica), грушевое дерево (Pyrus communis), арбуз (Citrullus vulgaris), ряску (Lemna), виды овса {Avena sativa), ячмень {Hordium vulgare), овощи, декоративные растения, хвойные, и виды газонной травы (например, для декоративных целей, для зоны отдыха или для кормовых целей), и виды трав, образующих биомассу (например, просо прутьевидное и мискантус).
Овощи включают виды Пасленовых (например, виды томата; Lycopersicon esculentum), салат-латук (например, Lactuea sativa), виды моркови (Caucus carota), цветная капуста (Brassica oleracea), сельдерей (apium graveolens), баклажан (Solanum melongena), спаржу (Asparagus officinalis), бамию (Abelmoschus esculentus), зеленую фасоль (Phaseolus vulgaris), лимскую фасоль (Phaseolus limensis), виды гороха (Lathyrus spp.), члены рода Cucurbita, такие как тыкву Хаббарда (С. Hubbard), тыкву мускатную (С. moschata), тыкву обыкновенную (С. реро), тыкву-горлянку (С. crookneck), С. argyrosperma , С. argyrosperma ssp sororia, С. digitata, С. ecuadorensis, С. foetidissima, С. lundelliana и С. martinezii и члены рода Cucumis, такие как огурец (Cucumis sativus), канталупу (С. cantalupensis) и дыню мускусную (С. melo).
Декоративные растения включают азалию (Rhododendron spp.), гортензию (Macrophylla hydrangea), гибискус (Hibiscus rosasanensis), виды розы (Rosa spp.), виды тюльпана (Tulipa spp.), виды нарцисса (Narcissus spp.), виды петуний (Petunia hybrida), гвоздику (Dianthus caryophyllus), пуансетию (Euphorbia pulcherima) и хризантему.
Хвойные, которые можно использовать в осуществлении настоящего изобретения, включают, например, виды сосны, такие как сосна ладанная (Pinus taeda), сосна Эллиота (Pinus elliotii), сосна желтая (Pinus ponderosa), сосна скрученная широкохвойная (Pinus contorta) и сосна лучистая (Pinus radiata); дугласию тиссолистную (Pseudotsuga menziesii); тсугу западную (Tsuga
canadensis); серебристую ель (Picea glauca); калифорнийское мамонтово дерево (Sequoia sempervirens); виды настоящей пихты, такие как пихта белая (Abies amabilis) и пихта бальзимическая (Abies balsamea); и виды кедра, такие как туя (Thuja plicata) и кипарисовик нутканский (Chamaecyparis nootkatensis).
Газонная трава включает без ограничения представителей рода Зойсия, представители рода Agrostis, виды овсяницы, виды мятлика, представители рода Stenotaphrum, представители рода Свинорой, виды бизоновой травы, виды плевела и виды ежи сборной.
Также включают растения, которые служат, преимущественно, в качестве лабораторных моделей, например, Arabidopsis thaliana. II. Способы повышения выносливости к высокой температуре или тепловому воздействию и/или содержания аминокислот.
Настоящее изобретение предусматривает способы введения глутаминсинтетазы 1;2 (GS1;2; Е.С. 6.3.1.2), глутаматдекарбоксилазы 3 (GAD3; Е.С. 4.1.1.15), глутаминамидотрансферазы I класса (GAT1; Е.С. 2.6.5.2), полипептида MYB55 или любой их комбинации в растительный материал, например, в растение, часть растения (в том числе каллус) или растительную клетку (например, для экспрессии GS1;2, GAD3, GAT1 и/или полипептида MYB55 в растительном материале). В типовых вариантах осуществления способ включает трансформацию растительного материала с помощью нуклеиновой кислоты (например, выделенной нуклеиновой кислоты), кассеты экспрессии или вектора, описанных в данном документе, кодирующих GS1;2, GAD3, GAT1 и/или полипептид MYB55. Растение может являться временно или стабильно трансформированным.
В качестве одного аспекта настоящее изобретение включает способ повышения выносливости к тепловому стрессу или высокой температуре у трансгенного растения, части растения или растительной клетки, причем способ включает введение одной или нескольких нуклеиновых кислот (например, выделенных нуклеиновых кислот), кодирующих (i) GS1;2, (ii) GAD3, (iii) GAT1, (iv) полипептид MYB55 или любую их комбинацию, в растение, часть растения или растительную клетку с получением трансгенного растения, части растения или растительной клетки, которые экспрессируют одну или несколько нуклеиновых кислот для получения GS1;2, GAD3, GAT1, полипептида MYB55 или любой их комбинации (например, в количестве, эффективном для
повышения выносливости к тепловому стрессу или высокой температуре), что, тем самым, приводит к повышенной выносливости к тепловому стрессу или высокой температуре у трансгенного растения, части растения или растительной клетки по сравнению с контрольным растением, частью растения или растительной клеткой. Растение, часть растения или растительная клетка может являться временно или стабильно трансформированным.
Повышенную выносливость к тепловому стрессу или высокой температуре можно оценивать относительно любого соответствующего контрольного растения, например, растения, части растения или растительной клетки, которые не были трансформированы с помощью одной или нескольких нуклеиновых кислот согласно способам по настоящему изобретению. Контрольное растение, как правило, подходит по виду, сорту, возрасту и т.п., и необязательно подвергается воздействию тех же условий роста, например, температуры, почвы, солнечного света, рН, воды и т.п. Выбор подходящего контрольного растения является обычной процедурой для специалистов в данной области.
В типовых вариантах осуществления одна или несколько нуклеиновые кислоты кодируют GS1;2, GAD3 и GAT1. Ферменты могут кодироваться одной или более, чем одной (например, двумя или тремя) выделенными нуклеиновыми кислотами. Например, каждый фермент может кодироваться разной нуклеиновой кислотой. Альтернативно, одна нуклеиновая кислота может кодировать два или все три фермента. Необязательно способ может дополнительно включать введение нуклеиновой кислоты (например, выделенной нуклеиновой кислоты), кодирующей полипептид MYB55, в растение, часть растения или растительную клетку. Полипептид MYB55 может кодироваться отдельной нуклеиновой кислотой или может кодироваться той же нуклеиновой кислотой, что и один или несколько из ферментов GS1;2, GAD3 и/или GAT1.
В определенных вариантах осуществления способ включает: (а) введение одной или нескольких нуклеиновых кислот (например, выделенных нуклеиновых кислот), кодирующих (i) GS1;2, (ii) GAD3, (iii) GAT1, (iv) полипептид MYB55 или любую их комбинацию, в растительную клетку (в том числе клетку каллуса) с получением трансгенной растительной клетки; и (Ь) регенерацию трансгенного растения из трансгенной растительной клетки из (а),
необязательно, где трансгенное растение содержит в своем геноме одну или несколько нуклеиновых кислот и, в качестве дополнительной функции, характеризуется повышенной выносливостью к тепловому стрессу или высокой температуре по сравнению с контрольным растением (например, экспрессирует GS1;2, GAD3, GAT1 и/или полипептид MYB55 в количестве, эффективном для повышения выносливости к тепловому стрессу или высокой температуре у растения).
В дополнительных вариантах осуществления способ включает: (а) введение одной или нескольких нуклеиновых кислот (например, выделенных нуклеиновых кислот), кодирующих (i) GS1;2, (ii) GAD3, (iii) GAT1, (iv) полипептид MYB55 или любую их комбинацию, в растительную клетку (в том числе клетку каллуса) с получением трансгенной растительной клетки; и (Ь) регенерацию трансгенного растения из трансгенной растительной клетки из (а), необязательно, где трансгенное растение содержит в своем геноме одну или несколько нуклеиновых кислот; и (с) отбор трансгенного растения, характеризующегося повышенной выносливостью к тепловому стрессу или высокой температуре (например, трансгенного растения, которое экспрессирует GS1 ;2, GAD3 GAT1 и/или полипептид MYB55 в количестве, эффективном для повышения выносливости к тепловому стрессу или высокой температуре у растения), из множества трансгенных растений из (Ь).
Необязательно, способы по настоящему изобретению могут дополнительно включать осуществление воздействия на растение, часть растения или растительную клетку тепловым стрессом или высокой температурой, например, во время вегетативной стадии роста. Под воздействием на растение, часть растения или растительную клетку тепловым стрессом или высокой температурой во время вегетативной стадии роста подразумевается, что растение, часть растения или растительная клетка подвергают воздействию теплового стресса или высокой температуры в течение всей или части вегетативной стадии роста.
Кроме того, в вариантах осуществления настоящего изобретения способы по настоящему изобретению приводят к повышенной урожайности по сравнению с подходящим контролем, например, к повышению высоты растения, биомассы растений (например, сухой биомассы) и/или семени по сравнению с растением, которое не было получено согласно способам по
настоящему изобретению. Специалисты в данной области будут понимать, что в данном случае может сохраняться сниженная урожайность по сравнению с растением, частью растения или растительной клеткой, на которые не воздействовали тепловым стрессом или высокой температурой.
В типовых вариантах осуществления способ повышения выносливости растения к тепловому стрессу или высокой температуре включает снижение неблагоприятного эффекта на функции, развитие и/или характеристики растения в результате теплового стресса или высокой температуры, например, сниженного деления клеток, размера (например, высоты растения) и/или числа растений и/или их частей, и/или нарушения агрономического признака, такого как пониженная урожайность, опадение плодов, размер и/или число плодов, размер и/или число семян, сниженное качество продукции, обусловленное внешним видом и/или структурой, и/или повышенной недоразвитие цветков.
Настоящее изобретение также предполагает способ повышения содержания аминокислот в трансгенном растении, части растения или растительной клетке, причем способ включает введение нуклеиновой кислоты (например, выделенной нуклеиновой кислоты), кодирующей полипептид MYB55, в растение, часть растения или растительную клетку с получением трансгенного растения, части растения или растительной клетки, которые экспрессируют нуклеиновую кислоту для получения полипептида MYB55 (например, в количестве, эффективном для повышения содержания аминокислот), что, тем самым, приводит к повышенному содержанию аминокислот в трансгенном растении, части растения или растительной клетки по сравнению с контрольным растением, частью растения или растительной клеткой. Растение, часть растения или растительная клетка может являться временно или стабильно трансформированным.
Повышенное содержание аминокислот можно оценивать относительно любого соответствующего контрольного растения, например, растения, части растения или растительной клетки, которые не были трансформированы с помощью нуклеиновой кислоты, кодирующей полипептид MYB55 согслано способам по настоящему изобретению. Контрольное растения, как правило, подходит по виду, сорту, возрасту и т.п., и подвергается воздействию тех же условий роста, например, температуры, почвы, солнечного света, рН, воды и
т.п. Выбор подходящего контрольного растения является обычной процедурой для специалистов в данной области.
В определенных вариантах осуществления способ включает: (а) введение нуклеиновой кислоты (например, выделенной нуклеиновой кислоты), кодирующей полипептид MYB55, в растительную клетку (в том числе клетку каллуса) с получением трансгенной растительной клетки; и (Ь) регенерацию трансгенного растения из трансгенной растительной клетки из (а), необязательно, где трансгенное растение содержит в своем геноме нуклеиновую кислоту и, в качестве дополнительной функции, характеризуется повышенным содержанием аминокислот по сравнению с контрольным растением (например, экспрессирует полипептид MYB55 в количестве, эффективном для повышения содержания аминокислот у растения).
В дополнительных вариантах осуществления способ включает: (а) введение нуклеиновой кислоты (например, выделенной нуклеиновой кислоты), кодирующей полипептид MYB55, в растительную клетку (в том числе клетку каллуса) с получением трансгенной растительной клетки; и (Ь) регенерацию трансгенного растения из трансгенной растительной клетки из (а), необязательно, где трансгенное растение содержит в своем геноме нуклеиновую кислоту; и (с) отбор трансгенного растения, характеризующегося повышенным содержанием аминокислот (например, трансгенного растения, которое экспрессирует MYB55 в количестве, эффективном для повышения содержание аминокислот у растения), из множества трансгенных растений из (Ь).
Необязательно, способы по настоящему изобретению дополнительно включают осуществление воздействия на растение, часть растения или растительную клетку тепловым стрессом или высокой температурой, например, во время вегетативной стадии роста.
В типовых вариантах осуществления у растения, части растения или растительной клетки повышено общее содержание аминокислот. В дополнительных вариантах осуществления повышено содержание одной или нескольких отдельных аминокислот. В определенных вариантах осуществления у растения, части растения или растительной клетки повышено содержание глутаминовой кислоты, аргинина, GABA и/или пролина.
Повышенное содержание аминокислот можно наблюдать относительно общей биомассы растений и/или можно наблюдать в пределах одной или нескольких частей или тканей растения, например, в листе, влагалище листа, корне или любой их комбинации. В типовых вариантах осуществления повышенное содержание аминокислот может присутствовать у трансгенного растения, части растения или растительной ткани, которые регенерированы из трансгенной растительной клетки, полученной согласно способам по настоящему изобретению. Необязательно, содержание одной или нескольких конкретных аминокислот может быть повышено в одной части или ткани растения и содержание другой аминокислоты или комбинации аминокислот повышено в другой части или ткани растения.
Настоящее изобретение также предполагает получение растений-потомков, которые содержат нуклеиновую кислоту (например, выделенную нуклеиновую кислоту), кодирующую GS1;2, GAD3, GAT1, полипептид MYB55 или любую их комбинацию. В вариантах осуществления настоящего изобретения способ дополнительно включает получение растения-потомка, происходящего из трансгенного растения (например, с помощью полового размножения или вегетативного размножения). Необязательно, растение-потомок содержит в своем геноме выделенную нуклеиновую кислоту, кодирующую GS1;2, GAD3, GAT1, полипептид MYB55 или любую их комбинацию, и характеризуется повышенной выносливостью к тепловому стрессу или высокой температуре по сравнению с контрольным растением (например, экспрессирует GS1;2, GAD3, GAT1, полипептид MYB55 или любую их комбинацию в количестве, эффективном для повышения выносливости к тепловому стрессу или высокой температуры у растения). В дополнительных вариантах осуществления растение-потомок содержит в своем геноме выделенную нуклеиновую кислоту, кодирующую GS1;2, GAD3, a GAT1, полипептид MYB55 или любую их комбинацию, и характеризуется повышенным содержанием аминокислот по сравнению с контрольным растением (например, экспрессирует GS1;2, GAD3, GAT1, полипептид MYB55 или любую их комбинацию в количестве, эффективном для повышения содержание аминокислот у растения).
Для иллюстрации, в одном варианте осуществления настоящее изобретение предусматривает способ получения растения-потомка, причем
способ включает (а) скрещивание трансгенного растения, содержащего одну или несколько нуклеиновых кислот (например, выделенных нуклеиновых кислот), кодирующих GS1;2, GAD3, GAT1, полипептид MYB55 или любую их комбинацию, с самим собой или другим растением с получением семени, содержащего одну или несколько нуклеиновых кислот; и (Ь) выращивание растения-потомка из семени с получением трансгенного растения, необязательно, где растение-потомок содержит в своем геноме одну или несколько нуклеиновых кислот, кодирующих GS1;2, GAD3, GAT1, полипептид MYB55 или любую их комбинацию, и характеризуется повышенной выносливостью к тепловому стрессу или высокой температуре и/или характеризуется повышенным содержанием аминокислот по сравнению с контрольным растением (например, экспрессирует GS1;2, GAD3, GAT1, полипептид MYB55 или любую их комбинацию в количестве, эффективном для повышения выносливости к тепловому стрессу или высокой температуры у растения). В дополнительных вариантах осуществления способ может дополнительно включать (с) скрещивание растения-потомка в самим собой или другим растением и (d) повторение этапов (Ь) и (с) в течение дополнительных 0-7 (например, 0, 1, 2, 3, 4, 5, 6 или 7 или любого их диапазона) поколений с получением растения, необязательно, где растение содержит в своем геноме одну или несколько нуклеиновых кислот GS1;2, GAD3, GAT1, полипептида MYB55 или любую их комбинацию и характеризуется повышенной выносливостью к тепловому стрессу или высокой температуре и/или характеризуется повышенным содержанием аминокислот (например, экспрессирует GS1;2, GAD3, GAT1, полипептид MYB55 или их комбинацию в количестве, эффективном для повышения выносливости к тепловому стрессу или высокой температуре и/или содержания аминокислот у растения).
Выражения "GS1;2", "GAD3" и "GAT1 "подразумеваются в широком смысле и охватывают любой "GS1;2", "GAD3" и/или "GAT1", известный в настоящее время или который будет открыт позднее, в том числе их биологически активные эквиваленты, а также биологически активные фрагменты полипептидов GS1;2, GAD3 и GAT1 полной длины и эквиваленты таких фрагментов. Выражения "GS1;2", "GAD3" и "GAT1" также включают модификации (например, делеций и/или усечения) встречающегося в природе полипептида или его эквивалента, которые характеризуются существенно
сходной или идентичной аминокислотной последовательностью с встречающимся в природе полипептидом и обладают ферментативной активностью и/или повышают переносимость теплового стресса или высокой температуры, и/или повышают содержание аминокислот в растении, части растения или растительной клетке. GS1;2, GAD3 и GAT1 могут происходить от любого вида (например, видов растений, включающих без ограничения рис [в том числе сорта indica и/или japonica], пшеницу, ячмень, маис, сорго, разновидности овса, рожь, сахарный тростник, Arabidopsis и т.п.), и выражения "GS1;2," "GAD3" и "GATT также включают встречающиеся в природе аллельные варианты, изоформы, сплайс-варианты и т.п. Кроме того, GS1;2, GAD3 и GAT1 могут быть полностью или частично синтетическими. Эти ферменты хорошо известны в данной области техники и ранее были описаны у ряда видов растений.
Например, известно, что растения имеют множественные изозимы глутаминсинтетазы класса 2. Изозим GS1:2 представляет собой цитозольную форму, и вовлечен в превращение глутамина в глутаминовую кислоту и отражает один из ранних этапов биосинтеза аминокислот. Фермент представляет собой гомооктомер, состоящий из восьми идентичных субъединиц, разделенных на два противостоящих кольца. АТР связывается с верхушкой активного центра вблизи сайта связывания катиона, тогда как глутамат связывается вблизи второго сайта связывания катиона на дне активного центра. Аммоний, а не аммиак, связывается с активным центром, поскольку сайт связывания является полярным и на него воздействует растворитель. Известны нуклеотидная и аминокислотная последовательности ряда GS1;2, например, у риса (№№ доступа в GenBank NP_001051067 и Р14654 [аминокислотная] и АВ180688.1 и NM_001057602 [нуклеотидная]), маиса (№№ доступа в GenBank NP_001105443 м ВАА03433 [аминокислотная] и NM_001111973 (нуклеотидная), сои (№№ доступа в GenBank NP_001242332 [аминокислотная] и NM_001255403 [нуклеотидная]), Arabidopsis (№№ доступа в GenBank NP_176794 [аминокислотная] и NM_105291 [нуклеотидная]), сахарного тростника (№№ доступа в GenBank AAW21275 [аминокислотная] и AY835455 [нуклеотидная]) и т.п. У белков GS1;2 был выявлен ряд функциональных доменов, в том числе домен beta-Grasp и каталитический домен.
Кристаллическая структура GS1a маиса описана у Unno et al. (2006) J. Biol. Chem. 281:29287-29296. см. также, ID в базе данных белков RCSB 2D3C).
GAT1 также известный как карбамоилфосфатсинтетаза, и он вовлечен в первый обязательный этап биосинтеза аргинина у прокариот и эукариот. Известны нуклеотидная и аминокислотная последовательности ряда GAT1, например, у риса (№№ доступа в GenBank BAD08105.1 и NP_001047880 [аминокислотная] и NM_001054415 [нуклеотидная]), маиса (№№ доступа в GenBank NP_001132055 [аминокислотная] и NM_001138583 [нуклеотидная]), сои (№№ доступа в GenBank ХР_003525104 [аминокислотная] и ХМ_003525056 [нуклеотидная]), Arabidopsis (№№ доступа в GenBank NP_566824 [аминокислотная] и NM_113690 [нуклеотидная]) и т.п. В белках GAT1 был выявлен ряд функциональных доменов, в том числе каталитический (активный) центр, который определяется консервативной каталитической триадой из цистеина, гистидина и глутамата. Была описана кристаллическая структура GAT1 из ряда бактерий, в том числе GAT1 из Т. thermophilus (ID в базе данных белков RCSB 2YWD) и P. horikoshiiQD в базе данных белков RCSB 2D7J).
GAD3 вовлечен в превращение L-глутаминовой кислоты в GABA. Известны нуклеотидная и аминокислотная последовательности ряда GAD3, например, у риса (№№ доступа в GenBank АА059316 [аминокислотная] и AY187941 [нуклеотидная]), сои (№№ доступа в GenBank BAF80895 [аминокислотная] и АВ240965 [нуклеотидная]), Arabidopsis (№№ доступа в GenBank NP_178309 [аминокислотная] и NM_126261 [нуклеотидная]) и т.п. В белках GAD3 был выявлен ряд функциональным доменов, в том числе сайт связывания пиридоксаль-5-фосфата (кофактор) и каталитический (активный) центр. Кристаллическая структура GAD3 была охарактеризована у бактерий, в том числе Е. coli (ID в базе данных белков RCSB 3FZ7 и 3FZ6).
В целом, GS1;2, GAT1 и GAD3, применяемые согласно способам по настоящему изобретению, характеризуются ферментативной активностью и/или повышенной выносливостью к тепловому стрессу или высокой температуре при экспрессии в растении, части растения или растительной клетке.
Если не указано иное, полипептиды GS1;2, GAT1 и GAD3 включают гибридные белки, содержащие полипептид GS1;2, GAT1 или GAD3 по настоящему изобретению. Например, может применяться экспрессия этих
полипептидов в качестве гибридного белка, который можно обнаруживать с помощью коммерчески доступного антитела (например, с мотивом FLAG) или в качестве гибридного белка, который, в иных случаях, можно легче обнаруживать или очищать (например, посредством добавления хвоста поли-His). Дополнительно, можно получать гибридные белки, которые улучшают стабильность белка, например, гибридные белки, содержащие белок связывания мальтозы (МВР) или глутатион-Э-трансферазу. В качестве другой альтернативы, гибридный белок может содержать репортерную группу.
Выражения "GS1;2", "GAT1" и "GAD3" охватывают полипептиды полной длины и их биологически активные фрагменты, а также биологически активные эквиваленты каждого из вышеупомянутого, которые характеризуются существенно сходными или существенно идентичными аминокислотными последовательностями (например, по меньшей мере с приблизительно 60%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, 99% или даже 100% сходством или идентичностью аминокислотной последовательности), где биологически активный фрагмент или биологически активный эквивалент сохраняет одну или несколько биологических активностей нативного фермента.
Дополнительно следует понимать, что встречающиеся в природе GS1;2, GAT1 и GAD3, как правило, будут допускать замены в аминокислотной последовательности и по существу сохранять биологическую активность. Выявление стандартным способом биологически активных полипептидов, не относящихся к встречающимся в природе GS1;2, GAT1 и GAD3, аминокислотных замен может основываться на любой характеристике, известной в данной области техники, в том числе относительном сходстве или различиях заместителей боковых цепей аминокислот, например, их гидрофобности, гидрофильности, заряда, размера и т.п. В определенных вариантах осуществления в аминокислотной последовательности, кодирующей полипептид GS1;2, GAT1 или GAD3, сделаны консервативные замены (т.е. замены на аминокислотный остаток с аналогичными свойствами).
В типовых вариантах осуществления биологически активный GS1;2, GAT1 или GAD3 (в том числе их эквиваленты м фрагменты) является каталитически активным и повышает выносливость к тепловому стрессу или высокой температуры у растения, части растения или растительной клетки. Способы оценки ферментативной активности этих ферментов известны в
данной области техники, в качестве способов измерения выносливости растения, части растения или растительной клетки к тепловому стрессу или высокой температуре. Специалисты в данной области смогут стандартным способом выявить биологически активные эквиваленты этих ферментов, а также биологически активные фрагменты и их биологически активные эквиваленты при помощи обширных знаний, которые существуют в данной области техники, и идей настоящей заявки.
Длина фрагмента GS1;2, GAT1 или GAD3 (например, биологически активного фрагмента) не является критической. Иллюстративные фрагменты содержат по меньшей мере приблизительно 50, 60, 70, 80, 90, 100, 110, 120, 130, 140, 150, 160, 170, 180, 190, 200, 225, 250, 275, 300, 325, 350, 375, 400, 425, 450, 475 или 500 аминокислот (необязательно, смежных аминокислот) полипептида полной длины.
В типовых вариантах осуществления биологически активный эквивалент GS1;2, биологически активный фрагмент GS1;2 или его биологически активный эквивалент, содержит каталитический домен и/или домен beta-Grasp, и, необязательно, за пределами этой области(ей) встречается какая-либо вариабельность последовательности. В вариантах осуществления биологически активный эквивалент, биологически активный фрагмент или биологически активный эквивалент фрагмента представляет собой цитозольный полипептид.
В типовых вариантах осуществления биологически активный эквивалент GS1;2, фрагмент GAT1 или их биологически активный эквивалент, содержит каталитический центр, за пределами этой области встречается какая-либо вариабельность последовательности. В вариантах осуществления каталитическая триада (цистеин, гистидин и глутамат) является консервативной.
В типовых вариантах осуществления биологически активный эквивалент GAD3, фрагмент GAD3 или его биологически активный эквивалент, содержит сайт связывания пиридоксаль-5'-фосфата (кофактор) и/или каталитический центр, и, необязательно, за пределами этой области(ей) встречается какая-либо вариабельность последовательности.
В дополнительных вариантах осуществления полипептиды GS1;2, GAT1 и GAD3 представляют собой полипептиды полной длины и исключают биологически активные фрагменты.
Настоящее изобретение дополнительно предусматривает нуклеиновые кислоты, кодирующие полипептиды GS1; GAD3 и GAT1.
Выражение "полипептид MYB55" рассматривается в широком смысле и охватывает встречающиеся в природе полипептиды MYB55, известные в настоящее время или которые будут выявлены позднее, а также их эквиваленты (в том числе фрагменты и их эквиваленты), которые повышают выносливость у тепловому стрессу или высокой температуре и/или повышают содержание аминокислот у растения. Выражение полипептид "MYB55" также включает модификации (например, делеций и/или усечения) встречающегося в природе полипептида MYB55 или его эквивалента, которые характеризуются существенно сходной или идентичной аминокислотной последовательностью с встречающимся в природе полипептидом MYB55 и которые повышают выносливость к тепловому стрессу или высокой температуре и/или повышают содержание аминокислот у растения, части растения или растительной клетки. Кроме того, полипептид MYB55 может происходить от любого вида растений (например, риса [в том числе сортов indica и/или japonica], пшеницы, ячменя, маиса, сорго, разновидностей овса, ржи, сахарного тростника и т.п.), и выражение "MYB55" также включает встречающиеся в природе аллельные варианты, изоформы, сплайс-варианты и т.п. Кроме того, полипептид MYB55 может быть полностью или частично синтетическим.
Полипептиды MYB55 были выявлены у ряда видов растений, в том числе Oryza sativa (например, SEQ ID NO: 5 [аминокислотная] и SEQ ID NO: 4 и нуклеотиды 4062-5126 SEQ ID NO: 3 [нуклеотидная]), Sorghum bicolor (например, SEQ ID NO: 6 [аминокислотная] и SEQ ID NO: 14 [нуклеотидная]), Zea mays (например, SEQ ID NO: 7 [аминокислотная] и SEQ ID NO: 15 [нуклеотидная]), Vitis vinifera (например, SEQ ID NO: 8 [аминокислотная]), Populus trichocarpa (например, SEQ ID NO: 9 [аминокислотная] и SEQ ID NO: 16 [нуклеотидная]), Malus x domestica (например, SEQ ID NO: 10 [аминокислотная] и SEQ ID NO: 17 [нуклеотидная]), Glycine max (например, SEQ ID NO: 11 [аминокислотная] и SEQ ID NO: 18 [нуклеотидная]), Daucus carota (например, SEQ ID NO: 12 [аминокислотная] и SEQ ID NO: 19 [нуклеотидная]) и Arabidopsis
thaliana (например, SEQ ID NO: 13 [аминокислотная] и SEQ ID NO: 20 [нуклеотидная]). См. также, фигуры 1А, D-F, фигуры 17А-Н и SEQ ID NO: 311 из WO2010/200595. Гомологи, выделенные из других организмов, в частности из других растений, можно выявлять стандартным способом с помощью способов, известных в данной области техники. Например, для выявления таких гомологов можно применять PCR и другие методики амплификации и гибридизации, исходя из сходства их последовательности с последовательностями, изложенными в данном документе.
В целом, полипептиды MYB55, применяемые согласно способам по настоящему изобретению, характеризуются активностью транскрипционного фактора и/или повышают выносливость к тепловому стрессу или высокой температуре и/или повышают содержание аминокислот при экспрессии в растении, части растения или растительной клетке.
Если не указано иное, полипептиды MYB55 включают гибридные белки MYB55, содержащие полипептид MYB55 по настоящему изобретению. Например, может применяться экспрессия полипептида MYB55 качестве гибридного белка, который можно обнаруживать с помощью коммерчески доступного антитела (например, с мотивом FLAG) или в качестве гибридного белка, который, в иных случаях, можно легче обнаруживать или очищать (например, посредством добавления хвоста поли-His). Дополнительно, можно получать гибридные белки, которые улучшают стабильность белка, например, гибридные белки, содержащие белок связывания мальтозы (МВР) или глутатион-8-трансферазу. В качестве другой альтернативы, гибридный белок может содержать репортерную группу.
В определенных вариантах осуществления полипептид MYB55 содержит, состоит по сути из или состоит из аминокислотной последовательности из любой из SEQ ID NO: 5-13 или их эквивалентов (в том числе фрагментов и их эквивалентов).
Эквиваленты полипептидов MYB55 по настоящему изобретению охватывают эквиваленты, характеризующиеся существенной идентичностью или сходством аминокислотной последовательности, например, по меньшей мере с приблизительно 60%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, 99% или большей идентичностью или сходством аминокислотной последовательности с аминокислотной последовательностью встречающегося
в природе полипептида MYB55 (например, SEQ ID NO: 5-13), или их фрагмент, необязательно биологически активный фрагмент.
Следует понимать, что встречающийся в природе MYB55 будет допускать замены в аминокислотной последовательности и по существу сохранять биологическую активность. Выявление стандартным способом биологически активных полипептидов MYB55 по настоящему изобретению, не относящихся к встречающимся в природе полипептидам MYB55 (например, SEQ ID NO: 5-13), аминокислотных замен может основываться на любой характеристике, известной в данной области, включая относительные сходства или различия заместителей в боковой цепи аминокислот, например, их гидрофобность, гидрофильность, заряд, размер и т.п. В определенных вариантах осуществления в аминокислотной последовательности, кодирующей полипептид MYB55, сделаны консервативные замены (т.е. замены на аминокислотный остаток с аналогичными свойствами).
Полипептиды MYB55 по настоящему изобретению также охватывают фрагменты полипептида MYB55 и их эквиваленты, которые повышают выносливость к тепловому воздействию или высокой температуре и/или повышают содержание аминокислот у растения, и их эквиваленты. Длина фрагмента MYB55 не является критической. Иллюстративные фрагменты полипептида MYB55 содержат по меньшей мере приблизительно 50, 60, 70, 80, 90, 100, 110, 120, 130, 140, 150, 160, 170, 180, 190, 200, 225, 250 или 275 аминокислот (необязательно, смежных аминокислот) полипептида MYB55 полной длины.
В типовых вариантах осуществления биологически активный эквивалент полипептида MYB55, биологически активный фрагмент полипептида MYB55 или его биологически активный эквивалент, содержит домен связывания ДНК (например, домен связывания ДНК "спираль-петля-спираль") и, необязательно, вся изменчивость происходит за пределами домена связывания ДНК. В вариантах осуществления настоящего изобретения биологически активный эквивалент полипептида MYB55, биологически активный фрагмент полипептида MYB55 или их биологически активный эквивалент содержит аминокислоты 14-113 из SEQ ID NO: 5 или последовательность, по существу подобную им. В вариантах осуществления настоящего изобретения биологически активный эквивалент полипептида MYB55, биологически
активный фрагмент полипептида MYB55 или их биологически активный эквивалент содержит аминокислоты 38-62 из SEQ ID NO: 5 или последовательность, по существу подобную им, и/или аминокислоты 90-113 из SEQ ID NO: 5 или последовательность, по существу подобную им. В вариантах осуществления настоящего изобретения биологически активный эквивалент полипептида MYB55, биологически активный фрагмент полипептида MYB55 или его биологически активный эквивалент содержит аминокислоты 14-64 или последовательность, по существу подобную им. Необязательно, эти области являются консервативными и вся изменчивость происходит за пределами этих последовательностей.
В дополнительных вариантах осуществления полипептид MYB55 содержит, состоит по сути из или состоит из аминокислотной последовательности, выбранной из группы, состоящей из: (а) аминокислотной последовательности из любой из SEQ ID NO: 5-13; (b) аминокислотной последовательности, характеризующейся по меньшей мере приблизительно 60%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, 99% или большей идентичностью или сходством аминокислотной последовательности с аминокислотной последовательностью из любой из SEQ ID NO: 5-13, необязательно, где полипептид MYB55 является биологически активным; и (с) фрагмента, содержащего по меньшей мере приблизительно 50, 60, 70, 80, 90, 100, 110, 120, 130, 140, 150, 160, 170, 180, 190, 200, 225, 250 или 275 аминокислот (необязательно, смежных аминокислот) из аминокислотной последовательности (а) или (Ь) выше, необязательно, где фрагмент повышает выносливость к тепловому стрессу или высокой температуре и/или повышает содержание аминокислот у растения.
Нуклеиновые кислоты, кодирующие полипептиды MYB55 по настоящему изобретению, могут происходить от любого вида (например, вида растения) или могут быть частично или полностью синтетическими. В типовых вариантах осуществления нуклеиновая кислота, кодирующая полипептид MYB55, является выделенной нуклеиновой кислотой.
Настоящее изобретение также предусматривает полинуклеотиды, кодирующие полипептиды MYB55 по настоящему изобретению. В типовых вариантах осуществления нуклеотидная последовательность, кодирующая полипептид MYB55, представляет собой встречающуюся в природе
нуклеотидную последовательность (например, SEQ ID NO: 4, нуклеотиды 40625126 из SEQ ID NO: 3, или SEQ ID NO: 14-20) или кодирует встречающийся в природе полипептид MYB55 (например, SEQ ID NO: 5-13), или является нуклеотидной последовательностью, которая характеризуется существенной идентичностью нуклеотидной последовательности с ней и которая кодирует биологически активный полипептид MYB55.
Кроме того, настоящее изобретение предусматривает полинуклеотиды, кодирующие полипептиды MYB55 по настоящему изобретению, где полинуклеотид гибридизируется с полной комплементарной цепью встречающейся в природе нуклеотидной последовательности, кодирующей полипептид MYB55 (например, SEQ ID NO: 4 или SEQ ID NO: 14-20) или нуклеотидной последовательностью, которая кодирует встречающийся в природе полипептид MYB55 (например, SEQ ID NO: 5-13), при жестких условиях гибридизации, известных специалистам в данной области, и кодирует биологически активный полипептид MYB55.
Кроме того, специалистам в данной области следует принимать во внимание, что в полинуклеотидах, которые кодируют полипептиды MYB55, может существовать изменчивость вследствие вырожденности генетического кода и/или присутствия интронов или других нетранслируемых элементов. Вырожденность генетического кода, которая позволяет различным нуклеотидным последовательностям кодировать один и тот же белок, хорошо известна в данной области техники. Более того, в полинуклеотидах, кодирующих полипептиды MYB55, можно использовать растение- или видо-предпочтительные кодоны, как также хорошо известно в данной области техники.
В приводимых в качестве примера, но не ограничивающих, вариантах осуществления нуклеиновая кислота (например, рекомбинантная или выделенная нуклеиновая кислота), кодирующая полипептид MYB55, содержит, состоит по сути из или состоит из нуклеотидной последовательности, выбранной из группы, состоящей из: (а) нуклеотидной последовательности, содержащей нуклеотидную последовательность из любой из SEQ ID NO: 4 или SEQ ID NO: 14-20; (b) нуклеотидной последовательности, содержащей по меньшей мере приблизительно 50, 75, 100, 125, 150, 175, 200, 225, 250, 275, 300, 325, 350, 375, 400, 425, 450, 475, 500 или 750 или больше нуклеотидов
(например, идущих подряд нуклеотидов) нуклеотидной последовательности из любой из SEQ ID NO: 4 или SEQ ID NO: 14-20 (например, кодирующей биологически активный фрагмент полипептида MYB55 из любой из SEQ ID NO: 5-13); (с) нуклеотидной последовательности, характеризующейся по меньшей мере приблизительно 60%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, 99% или большей идентичностью последовательности с нуклеотидной последовательностью из (а) или (b); (d) нуклеотидной последовательности, которая гибридизируется с полной комплементарной цепью нуклеотидной последовательности из (а) или (Ь) при жестких условиях гибридизации; и (е) нуклеотидной последовательности, которая отличается от нуклеотидной последовательности из любого из (а) - (d) вследствие вырожденности генетического кода. В типовых вариантах осуществления нуклеотидная последовательность кодирует биологически активный полипептид MYB55, который повышает выносливость к тепловому стрессу или высокой температуре и/или повышает содержание аминокислот у растения.
В типовых вариантах осуществления нуклеотидная последовательность кодирует полипептид из любой из SEQ ID NO: 5-13, или эквивалентный полипептид, характеризующийся существенной идентичностью или сходством аминокислотной последовательности с любой из SEQ ID NO: 5-13 (необязательно, биологически активный эквивалент, который повышает выносливость к тепловому стрессу или высокой температуре и/или повышает содержание аминокислот). В типовых вариантах осуществления нуклеотидная последовательность кодирует эквивалент (необязательно, биологически активный эквивалент) полипептида из любой из SEQ ID NO: 5-13 и гибридизируется с полной комплементарной цепью нуклеотидной последовательности из любой из SEQ ID NO: 4 или SEQ ID NO: 14-20 при жестких условиях гибридизации.
В типовых вариантах осуществления нуклеотидная последовательность кодирует полипептид из любой из SEQ ID NO: 5-13. Согласно этому варианту осуществления нуклеотидная последовательность может содержать, состоять по сути из или состоять из любой из SEQ ID NO: 4 или SEQ ID NO: 14-20. III. Кассеты экспрессии.
В типовых вариантах осуществления нуклеиновая кислота по настоящему изобретению (например, выделенная нуклеиновая кислота)
содержится в кассете экспрессии и находится в функциональной связи с промотором, например, гетерологичным промотором. В вариантах осуществления нуклеиновая кислота функционально связана с нативным промотором. В определенных вариантах осуществления нуклеиновая кислота функционально связана с гетерологичным промотором. GS1;2, GAD3, GAT1 и/или полипептид MYB55 могут содержаться в одной или нескольких кассетах экспрессии. Например, каждый из полипептидов может кодироваться различной нуклеиновой кислотой, которая содержится в одной или нескольких кассетах экспрессии (например, одной, двух, трех или четырех). В качестве одной альтернативы, одна нуклеиновая кислота может кодировать два или более полипептидов (например, два, три или четыре), которые могут содержаться в одной или нескольких кассетах экспрессии (например, одной, двух или трех).
Гетерологичный промотор может быть любым пригодным промотором, известным в данной области (в том числе промоторы бактерий, дрожжей, грибов, насекомых, млекопитающих и растений). В определенных вариантах осуществления промотор представляет собой промотор для экспрессии у растений. Отбор промоторов, пригодных к применению с настоящим изобретением, можно осуществить среди многих других типов промоторов. Таким образом, выбор промотора зависит от нескольких факторов, в том числе без ограничения от клеточно- и тканеспецифической экспрессии, желаемого уровня экспрессии, эффективности, индуцибельности и/или селективности. Например, если кроме индуцибельности желательной является экспрессия в специфической ткани или органе, можно применять тканеспецифический или тканепредпочтительный промотор (например, специфический или предпочтительный для корней). В отличие от этого, если желательной является экспрессия в ответ на раздражитель, можно применять промотор, который индуцируется другими раздражителями или химическими соединениями. Если желательной является непрерывная экспрессия во всех клетках растения, можно выбрать конститутивный промотор.
Неограничивающие примеры конститутивных промоторов включают промотор вируса цеструма (стр) (патент США №7166770), промотор гена актина (например, промотор гена актина 1 риса; Wang etal. (1992) Mol. Cell. Biol. 12:3399-3406. а также патент США №5641876), промотор 35S вируса мозаики цветной капусты (CaMV) (Odell etal. (1985) Nature 313:810-812), промотор 19S
CaMV (Lawton etal. (1987) Plant Mol. Biol. 9:315-324), промотор гена опинсинтетазы (например, nos, mas, ocs, etc.; (Ebert etal. (1987) Proc. Natl. Acad. Sci USA 84:5745-5749), промотор гена Adh (Walker etal. (1987) Proc. Natl. Acad. Sci. USA 84:6624-6629), сахарозосинтазный промотор (Yang & Russell (1990) Proc. Natl. Acad. Sci. USA 87:4144-4148) и убиквитиновый промотор.
Некоторые неограничивающие примеры тканеспецифических промоторов для применения с настоящим изобретением включают промоторы, полученные из генов, кодирующих запасные белки семян (например, В-конглицинин, круциферин, напин, фазеолин и т.д.), зеин или белки масляного тельца (такие как олеозин), или белки, вовлеченные в биосинтез жирных кислот (в том числе ацилпереносящий белок, стеароил-АСР десатуразу и десатуразы жирных кислоты (fad 2-1)), и другие нуклеиновые кислоты, экспрессируемые во время эмбрионального развития (такие как, Все4, см., например, Kridl etal. (1991) Seed Sci. Res. 1:209-219; а также патент ЕР №255378). Таким образом, в настоящем изобретении можно применять промоторы, связанные сданными тканеспецифичными нуклеиновыми кислотами.
Дополнительные примеры тканеспецифических промоторов включают без ограничения специфические промоторы для корня RCc3 (Jeong et al. Plant Physiol. 153:185-197 (2010)) и RB7 (патент США № 5459252), промотор гена лектина (Lindstrom etal. (1990) Der. Genet. 11:160-167; и Vodkin (1983) Prog. Clin. Biol. Res. 138:87-98), промотор гена алкогольдегидрогеназы 1 кукурузы (Dennis etal. (1984) Nucleic Acids Res. 12:3983-4000), гена Э-аденозил-Ь-метионинсинтетазы (SAMS) (Vander Mijnsbrugge etal. (1996) Plant and Cell Physiology, 37(8): 1108-1115), промотор генов светособирающего комплекса кукурузы (Bansal etal. (1992) Proc. Natl. Acad. Sci. USA 89:3654-3658), промотор гена белка теплового шока кукурузы (O'Dell etal. (1985) EMBO J. 5:451-458; и Rochester etal. (1986) EMBO J. 5:451-458), промотор гена малой субъединицы RuBP-карбоксилазы гороха (Cashmore, "Nuclear genes encoding the small subunit of ribulose-l,5-bisphosphate carboxylase" pp. 29-39, в Genetic Engineering of Plants, Hollaendered., Plenum Press 1983; и Poulsen etal. (1986) Mol. Gen. Genet. 205:193-200), промотор гена маннопинсинтазы Ti-плазмиды (Langridge etal. (1989) Proc. Natl. Acad. Sci. USA 86:3219-3223), промотор гена нопалинсинтазы Ti-плазмиды (Langridge etal. (1989), выше), промотор гена халконизомеразы петунии (van Tunen etal. (1988) EMBO J. 7:1257-1263), промотор гена богатого
глицином белка 1 фасоли (Keller et al. (1989) Genes Dev. 3:1639-1646), усеченный промотор 35S CaMV (O'Dell et al. (1985) Nature 313:810-812), промотор гена пататина картофеля (Wenzler et al. (1989) Plant Mol. Biol. 13:347354), промотор из клеток корней (Yamamoto etal. (1990) Nucleic Acids Res. 18:7449), промотор гена зеина маиса (Kriz etal. (1987) Mol. Gen. Genet. 207:9098; Langridge etal. (1983) Cell 34:1015-1022; Reina etal. (1990) Nucleic Acids Res. 18:6425; Reina etal. (1990) Nucleic Acids Res. 18:7449; и Wandelt etal. (1989) Nucleic Acids Res. 17:2354), промотор гена глобулина-1 (Belanger et al. (1991) Genetics 129:863-872), промотор cab гена а-тубулина (Sullivan etal. (1989) Mol. Gen. Genet. 215:431-440), промотор гена РЕРСазы (Hudspeth & Grula (1989) Plant Mol. Biol. 12:579-589), промоторы, связанные с комплексами R-генов (Chandler et al. (1989) Plant Cell 1:1175-1183) и промоторы гена халконсинтазы (Franken etal. (1991) EMBO J. 10:2605-2612). Особенно применимым для семяспецифичной экспрессии является промотор гена вицилина гороха (Czako etal. (1992) Mol. Gen. Genet. 235:33-40; а также патент США №5625136). Другими применимыми промоторами для экспрессии в зрелых листьях являются npoMOTops, которые включаются при наступлении старения, например, промотор гена SAG из Arabidopsis (Gan et al. (1995) Science 270:1986-1988).
В дополнение, можно применять промоторы, функционирующие в пластидах. Неограничивающие примеры таких промоторов включают промотор 5'-UTR гена 9 бактериофага ТЗ и другие промоторы, раскрытые в патенте США №7579516. Другие промоторы, пригодные с настоящим изобретением, включают без ограничения промотор гена малой субъединицы S-E9 RuBP-карбоксилазы и промотор гена ингибитора трипсина Кунитца (Kti3).
Другие тканеспецифические или тканепредпочтительные промоторы включают промоторы, специфические или предпочтительные для соцветий, и промоторы, специфические или предпочтительные для меристемы.
В некоторых вариантах осуществления с настоящим изобретением можно применять индуцибельные промоторы. Примеры индуцибельных промоторов, которые можно применять с настоящим изобретением, включают без ограничения промоторы системы репрессора тетрациклина, промоторы системы Lac-penpeccopa, промоторы медь-индуцибельной системы, промоторы салицилат-индуцибельной системы (например, системы PR1a),
глюкокортикоид-индуцибельные промоторы (Aoyama etal. (1997) Plant J. 11:605612) и промоторы экдизон-индуцируемой системы. Другие неограничивающие примеры индуцибельных промоторов включают промоторы, которые индуцируются ABA и тургорным давлением, промотор гена белка, связывающегося с ауксином (Schwob et al. (1993) Plant J. 4:423-432), промотор гена УДФ-глюкозофлавоноидгликозилтрансферазы (Ralston et al. (1988) Genetics 119:185-197), промотор гена ингибитора протеиназы MPI (Cordero etal. (1994) Plant J. 6:141-150), промотор гена глицеральдегид-3-фосфатдегидрогеназы (Kohler etal. (1995) Plant Mol. Biol. 29:1293-1298; Martinez etal. (1989) J. Mol. Biol. 208:551-565; и Quigley etal. (1989) J. Mol. Evol. 29:412421), бензилсульфонамид-индуцибельные промоторы (патент США №5364780) и промоторы гена глутатион-в-трансферазы. Подобным образом можно применять любой пригодный индуцибельный промотор, описанный в Gatz (1996) Current Opinion Biotechnol. 7:168-172 и Gatz (1997) Annu. Rev. Plant Physiol. Plant Mol. Biol. 48:89-108.
Другие подходящие промоторы включают промоторы из вирусов, которые заражают растение-хозяина, в том числе без ограничений промоторы, выделенные из вируса мозаики колоказии, вирус Chlorella (например, промотор гена аденинметилтрансферазы вируса Chlorella; Mitra etal., (1994) Plant Molecular Biology 26:85), вируса бронзовости томата, вируса погремковости табака, вируса некроза табака, вируса кольцевой пятнистости табака, вируса кольцевой пятнистости томата, вируса мозаики огурца, вируса карликовости арахиса, вируса мозаики люцерны и т.п.
В дополнительных вариантах осуществления промотор индуцируется тепловым стрессом или высокой температурой, например, промотор MYB55. Выражение "промотор MYB55" предназначено для обозначения последовательностей промотора, специфически раскрытых в данном документе (например, SEQ ID N0:1, нуклеотиды 1921-4061 из SEQ ID N0:2, нуклеотиды 2562-4061 из SEQ ID N0:2, или SEQ ID N0:2), и их эквивалентов (необязательно, биологически активного эквивалента), характеризующихся существенной идентичностью нуклеотидных последовательностей последовательностям промотора MYB55, специфически раскрытым в данном документе, а также фрагментов промотора MYB55 полной длины (необязательно, биологически активного фрагмента) и их эквивалентов
(необязательно, биологически активных эквивалентов), которые характеризуются существенной идентичностью нуклеотидных последовательностей с фрагментом последовательностей промотора MYB55, специфически раскрытых в данном документе. Выражение "промотор MYB55* включает последовательности из риса, а также гомологи из других видов растений, в том числе встречающиеся в природе аллельные варианты, изоформы, сплайс-варианты и т.д., или он может быть частично или полностью синтетическим.
Гомологи, выделенные из других организмов, в частности из других растений, можно выявлять с помощью способов, известных в данной области техники. Например, для выявления таких гомологов можно применять PCR и другие методики амплификации и гибридизации, исходя из сходства их последовательности с последовательностями, изложенными в данном документе.
Виды биологической активности, связанные с промотором MYB55, включают без ограничения способность контролировать или регулировать транскрипцию функционально связанной кодирующей последовательности. Другой вид неограничивающей биологической активности включает способность связываться с одним или несколькими факторами транскрипции и/или РНК-полимеразой II. Другие виды биологической активности включают без ограничения способность индуцироваться тепловым стрессом, высокой температурой, ABA, MeJa и/или салициловой кислотой.
Таким образом, в иллюстративных вариантах осуществления выделенная нуклеиновая кислота содержит, состоит по сути из или состоит из SEQ ID N0:1, нуклеотидов 1921-4061 из SEQ ID NO:2, нуклеотидов 2562-4061 из SEQ ID N0:2 или SEQ ID N0:2, или эквивалента любого из вышеуказанного (необязательно, биологически активного эквивалента).
Эквиваленты промоторов MYB55 по настоящему изобретению охватывают полинуклеотиды, характеризующиеся существенной идентичностью нуклеотидной последовательности с последовательностями промотора MYB55, специфически раскрытыми в данном документе (например, SEQ ID N0:1, нуклеотидами 1921-4061 из SEQ ID N0:2, нуклеотидами 25624061 из SEQ ID N0:2, или SEQ ID N0:2), или их фрагментами, например по меньшей мере с приблизительно 60%, 70%, 75%, 80%, 85%, 90%, 95%, 97%,
98% или 99% или большей, и они необязательно являются биологически активными. В типовых вариантах осуществления отсутствует вариабельность последовательности в ТАТА-боксе, СААТ-боксе, одном или нескольких элементах теплового шока (HSE) (например, одном, двух или трех), одном или нескольких элементах, реагирующих на ABA (ABRE; например, одном, двух или трех), одном или нескольких элементах, чувствительных к метилжасмонату (MeJa) (например, одном, двух, трех, четырех или пяти), элементе с реакцией на низкую температуру (LTR), одном или нескольких из сайтов связывания DOF ("DOF-бокс"; например, одном, двух или трех), сайте связывания MYB ("MBS-бокс"), сайте связывания АР-2 ("GCC-бокс", одном или нескольких сайтах связывания WRKY ("W-бокс"; например, одном или двух), одном или нескольких из сайтов связывания Skn-1 (например, одном, двух, трех, четырех или пяти) и/или ТСА-элементе (см., например, схематическое изображение на фигурах 2А и 2В), т.е., эти последовательности являются консервативными и любая вариабельность последовательности находится за пределами этих областей.
Промоторы MYB55 по настоящему изобретению также включают полинуклеотиды, которые гибрдизируются с полной коплементарной цепью последовательностей промотора MYB55, специфически раскрытых в данном документе (например, SEQ ID N0:1, нуклеотиды 1921-4061 из SEQ ID N0:2, нуклеотиды 2562-4061 из SEQ ID NO:2, или SEQ ID N0:2), или их фрагментов при жестких условиях гибридизации, известных специалистам в данной области, и они, необязательно, являются биологически активными.
Последовательности промотора MYB55 охватывают фрагменты (необязательно, биологически активные фрагменты) последовательностей промотора MYB55 , специфически раскрытых в данном документе (например, SEQ ID NO:1, нуклеотиды 1921-4061 из SEQ ID N0:2, нуклеотиды 2562-4061 из SEQ ID N0:2, или SEQ ID N0:2) и их эквиваленты. Длина фрагментов промотора MYB55 не является критической. Иллюстративные фрагменты содержат по меньшей мере и/или больше приблизительно 8, 10, 12, 15, 16, 17, 18, 19, 20, 25, 30, 35, 40, 45, 50, 75, 100, 125, 150, 175, 200, 250, 300, 350, 400, 450, 500, 600, 700, 800, 900, 1000, 1100, 1200, 1300, 1400, 1500, 1600, 1700, 1800, 1900, 2000, 2.050, 2100, 2105, 2110, 2115, 2120, 2125, 2130, 2131, 2132, 2133, 2134, 2135, 2136, 2137, 2138 или 2139 или больше нуклеотидов (необязательно, смежных нуклеотидов) последовательности полной длины.
В типовых вариантах осуществления последовательность промотора MYB55 содержит последовательность ТАТА-бокса, последовательность СААТ-бокса, один или несколько HSE-элементов (например, один, два или три), один или несколько ABRE-элементов (например, один, два или три), один или несколько MeJa-элементов (например, один, два, три, четыре или пять), LTR-элемент, один или несколько сайтов связывания DOF ("DOF-бокс"; например, один, два или три), сайт связывания MYB ("MBS-бокс"), сайт связывания АР-2 ("GCC-бокс", один или несколько сайтах связывания WRKY ("W-бокс"; например, один или два), один или несколько сайтов связывания Skn-1 (например, один, два, три, четыре или пять) и/или ТСА-элемент (см., например, схематическое изображение на фигурах 2А и 2В), т.е., эти последовательности являются консервативными и любая вариабельность последовательности находится за пределами этих областей.
В вариантах осуществления настоящего изобретения нуклеиновая кислота, содержащая промотор MYB55, не включает что-либо из кодирующей области MYB55 (например, нуклеотиды 4062-5126 из SEQ ID N0:3; фигура 1D). В вариантах осуществления настоящего изобретения нуклеотидная последовательность, представляющая интерес, не кодирует полипептид MYB55 (например, SEQ ID NO: 5; фигура 1F). В вариантах осуществления настоящего изобретения нуклеотидная последовательность, представляющая интерес, кодирует полипептид MYB55.
Соответственно, в типовых вариантах осуществления настоящее изобретение предусматривает нуклеиновую кислоту (например, рекомбинантную или выделенную нуклеиновую кислоту), содержащую, состоящую по сути из или состоящую из нуклеотидной последовательности, выбранную из группы, состоящей из: (a) SEQ ID N0:1, нуклеотидов 1921-4061 из SEQ ID N0:2, нуклеотидов 2562-4061 из SEQ ID N0:2, или SEQ ID N0:2; (b) нуклеотидной последовательности, содержащей по меньшей мере приблизительно 8, 10, 12, 15, 16, 17, 18, 19, 20, 25, 30, 35, 40, 45, 50, 75, 100, 125, 150, 175, 200, 250, 300, 350, 400, 450, 500, 600, 700, 800, 900, 1000, 1100, 1200, 1300, 1400, 1500, 1600, 1700, 1800, 1900, 2000, 2050, 2100, 2105, 2110, 2115, 2120, 2125, 2130, 2131, 2132, 2133, 2134, 2135, 2136, 2137, 2138 или 2139 или более нуклеотидов (необязательно, смежных нуклеотидов) из SEQ ID NO:1, нуклеотидов 1921-4061 из SEQ ID N0:2, нуклеотидов 2562-4061 из SEQ ID
N0:2, или SEQ ID N0:2; (с) нуклеотидной последовательности, которая гибридизируется с полной комплементарной цепью нуклеотидной последовательности из (а) или (Ь) при жестких условиях гибридизации; и (d) нуклеотидной последовательности, характеризующейся по меньшей мере приблизительно 60%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, 99% идентичностью последовательности с нуклеотидными последовательностями из любого из (а) - (с). В типовых вариантах осуществления нуклеотидная последовательность представляет собой биологически активную последовательность промотора (например, характеризуется промоторной активностью) и, необязательно, индуцируется тепловым стрессом, высокой температурой, ABA, салициловой кислотой и/или MeJa.
В вариантах осуществления настоящего изобретения нуклеотидная последовательность содержит, состоит по сути из или состоит из нуклеотидной последовательности из SEQ ID N0:1, нуклеотидов 1921-4061 из SEQ ID N0:2, нуклеотидов 2562-4061 из SEQ ID N0:2 или SEQ ID N0:2.
Кассеты экспрессии по настоящему изобретению могут дополнительно содержать последовательность терминации транскрипции. В соответствии с настоящим изобретением можно применять любую пригодную последовательность терминации, известную в данной области техники. Область терминации может происходить из одного источника с областью инициации транскрипции, может происходить из одного источника с последовательностью, представляющей интерес, или может быть получена из другого источника. Подходящие области терминации доступны из Ti-плазмиды A. tumefaciens, такие как области терминации октопинсинтетазы и нопалинсинтетазы. См. также, Guerineau etal., Mol. Gen. Genet. 262, 141 (1991); Proudfoot, Ce//64, 671 (1991); Sanfacon etal., Genes Dev. 5,141 (1991); Mogen et al., Plant Ce//2, 1261 (1990); Munroe etal., Gene 91, 151 (1990); Ballas etal., Nucleic Acids Res. 17, 7891 (1989); и Joshi etal., Nucleic Acids Res. 15, 9627 (1987). Дополнительными последовательностями терминации, приводимыми в качестве примера, являются последовательность терминации малой субъединицы RubP-карбоксилазы гороха и последовательность терминации вируса 35S мозаики цветной капусты. Для специалистов в данной области будут очевидными другие пригодные последовательности терминации.
Кроме того, в определенных вариантах осуществления нуклеотидная последовательность, представляющая интерес, функционально связана с сайтом начала трансляции. Сайт начала трансляции может представлять собой нативный сайт начала трансляции, связанный с нуклеотидной последовательностью, представляющей интерес, или может являться другим пригодным старт-кодоном трансляции.
В иллюстративных вариантах осуществления кассета экспрессии включает в направлении транскрипции от 5* к 3' промотор, нуклеотидную последовательность, представляющую интерес, а также область транскрипции и область терминации трансляции, функционирующие у растений.
Специалистам в данной области будет понятно, что кассеты экспрессии по настоящему изобретению могут дополнительно содержать энхансерные элементы и/или тканепредпочтительные элементы в комбинации с промотором.
Кроме того, в некоторых вариантах осуществления для кассеты экспрессии предпочтительно содержать ген селектируемого маркера для отбора трансформированных клеток. Пригодные гены селектируемых маркеров включают без ограничения гены, кодирующие устойчивость к антибиотикам, такие как гены неомицинфосфотрансферазы II (NEO) и
гидромицинфосфотрансферазы (НРТ), а также гены, придающие устойчивость к гербицидным соединениям. Гены устойчивости к гербицидам, как правило, кодируют модифицированный целевой белок, не чувствительный к гербициду, или фермент, который расщепляет или обезвреживает гербицид в растении перед тем, как он сможет подействовать. См., DeBlock et al., EMBO J. 6, 2513 (1987); DeBlock etal., Plant Physiol. 91, 691 (1989); Fromm etal., BioTechnology 8, 833 (1990); Gordon-Kamm etal., Plant Cell2, 603 (1990). Например, устойчивость к гербицидам глифосфату или сульфонилмочевине была получена с помощью генов, кодирующих мутантные целевые ферменты, 5-енолпирувилшикимат-З-фосфатсинтазу (EPSPS) и ацетолактатсинтазу (ALS). Устойчивость к глуфосинат-аммонию, бромоксинилу и 2,4-дихлорфеноксиацетату (2,4-D) была получена с помощью бактериальных генов, кодирующих фосфинотрицинацетилтрансферазу, нитрилазу или 2,4-дихлорфеноксиацетатмонооксигеназу, которые обезвреживают соответствующие гербициды.
Гены селектируемых маркеров, которые можно применять согласно настоящему изобретению, дополнительно включают без ограничения гены, кодирующие: неомицинфосфотрансферазу II (Fraley etal., CRC Critical Reviews in Plant Science 4, 1 (1986)); цианамидгидратазу (Maier-Greiner et al., Proc. Natl. Acad. Sci. USA 88, 4250 (1991)); аспартаткиназу; дигидродипиколинатсинтазу (Perl et al., BioTechnology 11, 715 (1993)); Ъаг-ген (Toki et al., Plant Physiol. 100, 1503 (1992); Meagher etal., Crop Sci. 36, 1367 (1996)); триптофандекарбоксилазу (Goddijn etal., Plant Mol. Biol. 22, 907 (1993)); неомицинфосфотрансферазу (NEO; Southern et al., J. Mol. Appl. Gen. 1, 327 (1982));
гигромицинфосфотрансферазу (/-/РГили HYG; Shimizu etal., Mol. Cell. Biol. 6, 1074 (1986)); дигидрофолатредуктазу (DHFR; Kwok etal., Proc. Natl. Acad. Sci. USA 83, 4552 (1986)); фосфинотрицинацетилтрансферазу (DeBlock et al., EMBO J. 6, 2513 (1987)); дегалогеназу 2,2-дихлорпропионовой кислоты (Buchanan-Wollatron et al., J. Cell. Biochem. 13D, 330 (1989)); синтазу ацетогидроксикислоты (патент США №4761373 от Anderson etal.; Haughn etal., Mol. Gen. Genet. 221, 266 (1988)); 5-енолпирувил-шикимат-фосфатсинтазу (aroA; Comai etal., Nature 317, 741 (1985)); галогенарилнитрилазу (WO 87/04181 от Stalker et al.); ацетил-коэнзим Акарбоксилазу (Parker etal., Plant Physiol. 92, 1220 (1990)); дигидроптероатсинтазу (su/l; Guerineau et al., Plant Mol. Biol. 15, 127 (1990)) и 32 кДа полипептид фотосистемы II (psbA; Hirschberg etal., Science 222, 1346 (1983)).
Также включены гены, кодирующие устойчивость к: хлорамфениколу (Herrera-Estrella et al., EMBO J. 2, 987 (1983)); метотрексату (Herrera-Estrella et al., Nature 303, 209 (1983); Meijer et al., Plant Mol. Biol. 16, 807 (1991)) гигромицину (Waldron etal., Plant Mol. Biol. 5, 103 (1985); Zhijian etal., Plant Science 108, 219 (1995); Meijer etal., Plant Mol. Bio. 16, 807 (1991)); стрептомицину (Jones era/., Mol. Gen. Genet. 210, 86 (1987)); а также спектиномицину (Bretagne- Sagnard etal., Transgenic Res. 5,131 (1996)); блеомицину (Hille etal., Plant Mol. Biol. 7, 171 (1986)); сульфаниламиду (Guerineau etal., Plant Mol. Bio. 15, 127 (1990); бромоксинилу (Stalker et al., Science 242, 419 (1988)); 2,4-D (Streber et al., Bio/Technology 1, 811 (1989)); фосфинотрицину (DeBlock etal., EMBO J. 6, 2513 (1987)); спектиномицину (Bretagne-Sagnard and Chupeau, Transgenic Research 5, 131 (1996)).
Другие гены селектируемых маркеров включают paf-ген (для устойчивости к биланофосу и фосфинотрицину), yALS-ген для устойчивости к имидазолинону, НРН- или HVG-ген для устойчивости к гигромицину, Нт1-ген для устойчивости к Нс-токсину, а также другие селективные средства, традиционно применяемые и известные специалисту в данной области. См., в целом, Yarranton, Curr. Opin. Biotech. 3, 506 (1992); Chistopherson etal., Proc. Natl. Acad. Sci. USA 89, 6314 (1992); Yao etal., Ce//71, 63 (1992); Reznikoff, Mol. Microbiol. 6, 2419 (1992); BARKLEY ETAL, THE OPERON 177-220 (1980); Hu et al., Cell48, 555 (1987); Brown etal., Cell49, 603 (1987); Figge etal., Cell52, 713 (1988); Deuschle etal., Proc. Natl. Acad. Sci. USA 86, 5400 (1989); Fuerst etal., Proc. Natl. Acad. Sci. USA 86,2549 (1989); Deuschle etal., Science 248, 480
(1990) ; Labow etal., Mol. Cell. Biol. 10, 3343 (1990); Zambretti etal., Proc. Natl. Acad. Sci. USA 89, 3952 (1992); Bairn etal., Proc. Natl. Acad. Sci. USA 88, 5072
(1991) ; Wyborski etal., Nuc. Acids Res. 19, 4647 (1991); Hillenand-Wissman, Topics in Mol. AndStruc. Biol. 10, 143 (1989); Degenkolb etal., Antimicrob. Agents Chemother. 35, 1591 (1991); Kleinschnidt et al., Biochemistry 27, 1094 (1988); Gatz etal., Plant J. 2, 397 (1992); Gossen etal., Proc. Natl. Acad. Sci. USA 89, 5547
(1992) ; Oliva et al., Antimicrob. Agents Chemother. 36, 913 (1992); HLAVKA ETAL, HANDBOOK OF EXPERIMENTAL PHARMACOLOGY 78 (1985); и Gill etal., Nature 334, 721 (1988).
Нуклеотидная последовательность, представляющая интерес, может дополнительно быть функционально связана с последовательностью, которая кодирует транзитный пептид, который направляет экспрессию кодируемого полипептида, представляющего интерес, в определенный компартмент клетки. Транзитные пептиды, которые нацеливают накопление белков в клетках высших растений в хлоропласт, митохондрию, вакуоль, ядро и эндоплазматическую сеть (для секреции за пределы клетки), известны в данной области техники. Транзитные пептиды, которые нацеливают белки в эндоплазматическую сеть, желательны для правильного процессинга секретируемых белков. Было показано, что нацеливание экспрессии белков в хлоропласт (например, с помощью транзитного пептида из гена малой субъединицы RubP-карбоксилазы) приводило к накоплению очень высоких концентраций рекомбинантного белка в этой органелле. Последовательность транзитного пептида малой субъединицы RubP-карбоксилазы применяли для
экспрессии и нацеливания генов млекопитающих в растениях (патенты США №5717084 и 5728925 Herrera-Estrella era/.). Альтернативно, для нацеливания экспрессии рекомбинантных белков, например, в митохондрии или эндоплазматической сети можно применять транзитные белки млекопитающих. Было продемонстрировано, что растительные клетки распознают транзитные пептиды млекопитающих, которые нацеливают в эндоплазматическую сеть (патенты США №5202422 и 5639947 Hiatt et al.).
Кроме того, кассета экспрессии может содержать 5-лидерную последовательность, которая действует для усиления экспрессии (транскрипции, посттранскрипционного процессинга и/или трансляции) функционально связанной нуклеотидной последовательности, представляющей интерес. Лидерные последовательности известны в данной области техники и они включают последовательности из: лидерных последовательностей пикорнавирусов, например, лидерной последовательности EMCV (5'-некодирующая область энцефаломиокардита; Elroy-Stein et al., Proc. Elroy-Stein etal., Proc. Natl. Acad. Sci USA, 86, 6126 (1989)).; лидерных последовательностей потивируса, например, лидерной последовательности TEV (вируса гравировки табака; Allison et al., Virology, 154, 9 (1986)); белка связывания тяжелой цепи иммоноглобулина человека (BiP; Macajak and Sarnow, Nature 353, 90 (1991)); нетранслируемой лидерной последовательности из мРНК белка оболочки вируса мозаики люцерны (РНК 4 AMV; Jobling and Gehrke, Nature 325, 622 (1987)); лидерной последовательности вируса табачной мозаики (TMV; Gallie, MOLECULAR BIOLOGY OF RNA, 237-56 (1989)) и лидерной последовательности вируса хлорозной пятнистости маиса (MCMV; Lommel etal., Virology ЪЛ, 382 (1991)). См. также, Della-Cioppa etal., Plant Physiology ЪЛ, 965 (1987).
IV. Трансгенные растения, части растений и растительные клетки.
Настоящее изобретения также предусматривает трансгенные растения, части растений и растительные клетки, полученные с помощью способов по настоящему изобретению и содержащие нуклеиновые кислоты, кассеты экспрессии и векторы, описанные в данном документе.
Соответственно, в качестве одного аспекта настоящее изобретение предусматривает клетку, содержащую нуклеиновую кислоту, кассету экспрессии или вектор, описанные в данном документе. Клетку можно временно или
стабильно трансформировать с помощью нуклеиновой кислоты, кассеты экспрессии или вектора. Кроме того, клетка может представлять собой культивируемую клетку, клетку, полученную из растения, части растения или ткани растения, или клетку in situ в растении, части растения или ткани растения. Клетки могут происходить из любых пригодных видов, в том числе представлять собой клетки растений (например, риса), бактерий, дрожжей, насекомых и/или млекопитающих. В типовых вариантах осуществления клеткой является растительная клетка или бактериальная клетка.
Настоящее изобретение также предусматривает часть растения (в том числе культуру растительной ткани), содержащую нуклеиновую кислоту, кассету экспрессии или вектор, описанные в данном документе. Часть растения можно временно или стабильно трансформировать с помощью нуклеиновой кислоты, кассеты экспрессии или вектора. Кроме того, часть растения может находиться в культуре, может представлять собой часть растения, полученную из растения, или часть растения in situ. В типовых вариантах осуществления часть растения содержит клетку, описанную в данном документе.
Также предусмотрены семена, содержащие нуклеиновую кислоту, кассету экспрессии или вектор, описанные в данном документе. Необязательно, нуклеиновая кислота, кассета экспрессии или вектор стабильно внедрены в геном семени.
Настоящее изобретение также предполагает трансгенное растение, содержащее нуклеиновую кислоту, кассету экспрессии или вектор, описанные в данном документе. Растение можно временно или стабильно трансформировать с помощью нуклеиновой кислоты, кассеты экспрессии или вектора. В типовых вариантах осуществления растение содержит клетку или часть растения, описанные в данном документе.
Более того, настоящее изобретение охватывает сельскохозяйственную культуру, содержащую множество трансгенных растений, описанных в данном документе. Неограничивающие примеры типов сельскохозяйственных культур, содержащих множество трансгенных растений по настоящему изобретению, включают культуры для земледельческого поля, поля для гольфа, газонов и садов населенных пунктов, газонов и садов общего пользования, озеленения придорожной полосы, плодового сада и/или зоны отдыха (например,
возделываемого участка, содержащего множество трансгенных растений по настоящему изобретению).
Также предусмотрены продукты, собранные с растений по настоящему изобретению. Неограничивающие примеры собранных продуктов включают семя, лист, стебель, побег, плод, цветок, корень, биомассу (например, для производства биотоплива) и/или экстракт.
В некоторых вариантах осуществления предлагается обработанный продукт, произведенный из собранного продукта. Неограничивающие примеры обработанного продукта включают полипептид (например, рекомбинантный полипептид), экстракт, лекарственное средство (например, артемицин в качестве противомалярийного средства ), текстильное волокно или тканый материал, отдушку, сухофрукты, биотопливо (например, этанол), табачное изделие (например, сушеный табак, сигареты, жевательный табак, сигары и т.д.), масло (например, подсолнечное масло, кукурузное масло, каноловое масло и т.д.), масло орехов или семян, муку или кормовую муку (например, пшеничную или рисовую муку, кукурузную муку) и/или любой другой корм для животных (например, сою, маис, ячмень, рис, люцерну) и/или продукт питания человека (например, продукт питания из обработанной пшеницы, маиса, риса или сои).
V. Способы введения нуклеиновых кислот.
Настоящее изобретение также предусматривает способы введения нуклеиновой кислоты, кассеты экспрессии или вектора, описанных в данном документе, в целевое растение или растительную клетку (в том числе клетки каллуса или протопласты), часть растения, семя, растительную ткань (в том числе каллус) и т.п. Настоящее изобретение дополнительно включает растения-хозяева, клетки, части растений, семена или культуру тканей (в том числе каллус), временно или стабильно трансформированные с помощью нуклеиновых кислот, кассет экспрессии или векторов, описанных в данном документе.
Настоящее изобретение предусматривает способы введения GS1;2, GAD3, GAT1 и/или полипептида MYB55 в растительный материал, например, растение, часть растения (в том числе каллус) или растительную клетку. В типовых вариантах осуществления способ включает трансформацию растительной клетки с помощью нуклеиновой кислоты, кассеты экспрессии или
вектора по настоящему изобретению, кодирующих GS1;2, GAD3, GAT1 и/или полипептид MYB55, с получением трансформированной растительной клетки и регенерации стабильно трансформированного трансгенного растения из трансформированной растительной клетки.
Настоящее изобретение дополнительно охватывает трансгенные растения (и их потомство), части растений и растительные клетки, полученные с помощью способов по настоящему изобретению.
Также настоящим изобретением предусмотрены семена, полученные из трансгенных растений по настоящему изобретению. Необязательно, семена содержат выделенную нуклеиновую кислоту, кассету экспрессии или вектор, описанные в данном документе, стабильно внедренные в геном.
Способы введения нуклеиновых кислот, временно или стабильно, в растения, растительные ткани, клетки, протопласты, семена, каллус и т.д. известны в данной области техники. Стабильно трансформированные нуклеиновые кислоты могут быть внедрены в геном. Способы трансформации, приведенные в качестве примера, включают биологические способы с применением вирусов и бактерий (например, Agrobacterium), физико-химические способы, такие как электропорация, способы погружения цветочной почки, баллистическая бомбардировка, микроинъекция и т.д. Другие методики трансформации включают трансформацию при помощи технологии вискеров, которая основана на минеральных волокнах (см., например, патент США №5302523 и 5464765), и пыльцевой трубки.
Другие способы трансформации, приводимые в качестве примера, включают без ограничения трансформацию, опосредованную фосфатом кальция, трансформацию, опосредованную циклодекстрином, трансформацию, опосредованную наночастицами, обработку ультразвуком, инфильтрацию, захват нуклеиновых кислот, опосредованный ПЭГ, а также любой другой электрический, химический, физический (механический) и/или биологический механизм, который приводит к введению нуклеиновой кислоты в растительную клетку, в том числе любую их комбинацию. Общие указания по разнообразным способам трансформации растений, известным в данной области техники, включают Miki etal. ("Procedures for Introducing Foreign DNA into Plants" в Methods in Plant Molecular Biology and Biotechnology, Glick, B. R. and Thompson,
J. E., Eds. (CRC Press, Inc., Boca Raton, 1993), pages 67-88) и Rakowoczy-Trojanowska (Cell. Mol. Biol. Lett. 7:849-858 (2002)).
Таким образом, в некоторых определенных вариантах осуществления способ введения в растение, часть растения, растительную ткань, растительную клетку, протопласт, семена, каллус и т.д. включает трансформацию, опосредованную бактериями, трансформацию бомбардировкой частиц, трансформацию, опосредованную фосфатом кальция, трансформацию, опосредованную циклодекстрином, электропорацию, трансформацию, опосредованную липосомами, трансформацию, опосредованную наночастицами, трансформацию, опосредованную полимерами, доставку нуклеиновых кислот, опосредованную вирусами, доставку нуклеиновых кислот, опосредованную вискерами, микроинъекцию, обработку ультразвуком, инфильтрацию, трансформацию, опосредованную полиэтиленгликолем, любой другой электрический, химический, физический и/или биологический механизм, который приводит к введению нуклеиновой кислоты в растение, часть растения и/или их клетку, или их комбинацию.
При одной форме прямой трансформации вектор микроинъецируют непосредственно в растительные клетки с помощью микропипеток для механического переноса рекомбинантной ДНК (Crossway, Mol. Gen. Genetics 202: 179 (1985)).
В другом протоколе генетический материал переносят в растительную клетку с помощью полиэтиленгликоля (Krens, etal. Nature 296, 72 (1982)).
В еще одном способе протопласты сливают с миниклетками, клетками, лизосомами или другими покрытыми способными к слиянию липидами тельцами, которые содержат нуклеотидную последовательность, подлежащую переносу в растение (Fraley, etal., Proc. Natl. Acad. Sci. USA 79, 1859 (1982)).
Нуклеиновые кислоты также можно вводить в растительные клетки с помощью электропорации (Fromm etal., Proc. Natl. Acad. Sci. USA 82, 5824 (1985)). В этом способе протопласты растения электропорируют в присутствии нуклеиновых кислот, содержащих кассету экспрессии. Электрические импульсы с высокой напряженностью поля обратимо проходят сквозь биомембраны, облегчая введение нуклеиновой кислоты. Электропорированные протопласты растений заново формируют клеточную стенку, делятся и регенерируют. Одним преимуществом электропорации является то, что с помощью этого способа
можно трансформировать большие фрагменты ДНК, в том числе искусственные хромосомы.
Баллистическая трансформация обычно включает этапы: (а) обеспечения растительного материала в качестве мишени; (Ь) продвижения микрочастицы, несущей гетерологичную нуклеотидную последовательность, в целевое растение со скоростью, достаточной для пробивания стенок клеток в мишени и отложения нуклеотидной последовательности внутри клетки мишени, тем самым, с обеспечением трансформированной мишени. Этот способ может дополнительно включать этап культивирования трансформированной мишени со средством для отбора и, необязательно, регенерацию трансформированного растения. Как отмечено далее, этот способ можно проводить при помощи нуклеотидной последовательности в виде отдельного преципитата (влажного или лиофилизированного), вместо водного раствора, содержащего нуклеотидную последовательность.
Для практической реализации настоящего изобретения можно применять любое устройство для баллистической трансформации клетки. Иллюстративное устройство раскрыто Sandford et al. (Particulate Science and Technology 5, 27 (1988)), Klein et al. (Nature 327, 70 (1987)) и в ЕР 0 270 356. Такое устройство применялась для трансформации клеток маиса (Klein et al., Proc. Natl. Acad. Sci. USA 85, 4305 (1988)), каллуса сои (Christou et al., Plant Physiol. 87, 671 (1988)), McCabe etal., BioTechnologyQ, 923 (1988), митохондрий дрожжей (Johnston et al., Science 240, 1538 (1988)) и хлоропластов Chlamydomonas (Boynton er al., Science 240, 1534 (1988)).
Альтернативно, можно применять устройство, сконфигурированное, как описано у Klein et al. (Nature 70, 327 (1987)). Это устройство содержит камеру для бомбардировки, которая разделена на два отдельных компартмента с помощью регулируемой по высоте запирающей пластины. Сверху камеры для бомбардировки находится ускорительная трубка. Макрочастицу продвигают вниз по ускорительной трубки на запирающую пластину с помощью порохового разряда. В запирающей пластине имеется образованное в ней высверленное отверстие, по диаметру меньшее, чем микрочастица. Макрочастица переносит микрочастицу(ы), и макрочастицу нацеливают и поджигают в высверленном отверстии. Когда макрочастица останавливается запирающей пластиной, микрочастица(ы) движется через высверленное отверстие. Мишень
располагают в камере для бомбардировки таким образом, что микрочастица(ы), движущаяся сквозь высверленное отверстие, проникает сквозь клеточные стенки клеток в мишени и откладывает представляющую интерес нуклеотидную последовательность, переносимую на них в клетки мишени. Перед использованием в камере для бомбардировке частично выкачивают воздух для предотвращения сопротивления воздуха вследствие чрезмерного замедления микрочастиц. Воздух из камеры выкачивают лишь частично так, чтобы ткань-мишень не высыхала во время бомбардировки. Подходящим является разрежение от приблизительно 400 до приблизительно 800 миллиметров ртутного столба.
В альтернативных вариантах осуществления баллистическую трансформацию производят без применения микрочастиц. Например, водный раствор, содержащий в качестве преципитата нуклеотидную последовательность, представляющую интерес, могут переноситься макрочастицей (например, путем помещения водного раствора непосредственно на контактирующий с пластиной конец макрочастицы без микрочастицы, где она удерживается при помощи поверхностного натяжения), и раствор отдельно продвигается на растительную ткань-мишень (например, посредством продвижения макрочастицы вниз по ускорительной трубке таким же способом, как описано выше). Другие подходы включают помещение преципитата нуклеиновых кислот самого по себе ("влажного" преципитата) или лиофилизированного нуклеотидного преципитата непосредственно на контактирующий с пластиной конец макрочастиц без микрочастицы. Считается, что в отсутствие микрочастицы либо нуклеотидная последовательность должна двигаться к ткани-мишени с большей скоростью, чем необходимая в случае переноса с помощью микрочастицы, либо нуклеотидная последовательность должна проходить более короткое расстояние к мишени (или и то, и другое).
При определенных вариантах осуществления нуклеотидную последовательность доставляют при помощи микрочастицы. Микрочастицу можно получать из любого материала, характеризующегося достаточной плотностью и связывающую способность для продвижения сквозь клеточную стенку, с учетом скорости частицы и расстояния, которое частица должна пройти. Неограничивающие примеры материалов для получения микрочастиц включают металл, стекло, кремнезем, лед, полиэтилен, полипропилен,
поликарбонат и соединения углерода (например, графит, алмаз). Неограничивающие примеры подходящих металлов включают вольфрам, золото и иридий. Размер частиц должны быть достаточно малым, для того чтобы избежать избыточного разрыва клеток, с которыми они контактируют в ткани-мишени, и достаточно большим, для того чтобы придать инерцию, необходимую для проникновения в клетку ткани-мишени, представляющую интерес. Подходящими являются частицы, варьирующие в диаметре от приблизительно половины микрометра до приблизительно трех микрометров. Частицы не должны быть сферическими, поскольку неровности поверхности на частицах могут усиливать их несущую способность.
Нуклеотидную последовательность можно закрепить на частице с помощью осаждения. Точные параметры используемого осаждения будут меняться в зависимости от факторов, таких как используемая процедура ускорения частицы, известная в данной области техники. Несущие частицы, необязательно, можно покрывать инкапсулирующими средствами, такими как полилизин, для улучшения стабильности нуклеотидных последовательностей, закрепленных на них, как обсуждается в ЕР 0270356 (колонка 8).
Альтернативно, растения можно трансформировать с помощью Agrobacterium tumefaciens или Agrobacterium rhizogenes. Перенос нуклеиновых кислот, опосредованный Agrobacterium, использует природную способность А. tumefaciens и A. rhizogenes переносить ДНК в хромосомы растений. Agrobacterium представляет собой патоген растений, который переносит ряд генов, кодируемых в области, называемой Т-ДНК Ti- и Ri-плазмид А. tumefaciens и A. rhizogenes, соответственно, в растительные клетки. Типичным результатом переноса Ti-плазмиды является опухолевый рост, называемый корончатый галл, в котором Т-ДНК стабильно интегрируется в хромосому хозяина. Интеграция Ri-плазмиды в ДНК хромосомы хозяина приводит к состоянию, известному как "болезнь бородатого корня". Способность вызывать заболевание у растения-хозяина можно устранить при помощи делеций генов в Т-ДНК без потери переноса и интеграции ДНК. ДНК, подлежащую переносу, прикрепляют к пограничным участкам, которые определяют конечные точки интегрированной Т-ДНК.
Перенос с помощью сконструированных штаммов Agrobacterium стал традиционным для многих двудольных растений. Однако с некоторыми
сложностями столкнулись при применении Agrobacterium для трансформации однодольных растений, в частности, злаковых растений. Однако трансформация, опосредованная Agrobacterium, была достигнута у некоторых однодольных видов, в том числе видов злаков, таких как рожь, маис (Rhodes et al., Science 240, 204 (1988)) и рис (Hiei et al., (1994) Plant J. 6:271).
В то время как последующее обсуждение будет сосредоточено на применении A. tumefaciens для достижения переноса генов в растения, специалисты в данной области будут понимать, что это обсуждение также применимо к A. rhizogenes. Трансформацию с помощью A. rhizogenes разработали по аналогии с трансформацией A. tumefaciens и она была успешно применена для траснформации, например, люцерны, Solanum nigrum L, и тополя (патент США №5777200 Ryals et al.). Как описано в патенте США №5773693 Burgess et al., предпочтительным является применение обезоруженного штамма A. tumefaciens (как описано далее), однако, можно применять штамм дикого типа A. rhizogenes. Иллюстративным штаммом А. rhizogenes является штамм 15834.
В определенных протоколах штамм Agrobacterium модифицируют так, чтобы он содержал нуклеотидные последовательности, подлежащие переносу в растение. Нуклеотидную последовательность, подлежащую переносу, внедряют в Т-область и, как правило, фланкируют по меньшей мере одним пограничным участком Т-ДНК, необязательно, двумя пограничными участками Т-ДНК. В данной области техники, в частности, известны ряд штаммов Agrobacterium и их можно применять в способах по настоящему изобретению. См., например, Hooykaas, Plant Mol. Biol. 13, 327 (1989); Smith etal., Crop Science 35, 301 (1995); Chilton, Proc. Natl. Acad. Sci. USA 90, 3119 (1993); Mollony etal., Monograph Theor. Appl. GenetЛ/У19, 148 (1993); Ishida etal., Nature Biotechnol. 14, 745 (1996); и Komari etal., The Plant Journal 10, 165 (1996).
В дополнение к Т-области Ti- (или Ri-)mia3MHfla содержит область vir. Область vir важна для эффективной трансформации, и, по-видимому, является видоспецифичной.
В данной области обычно применяют два иллюстративных класса рекомбинантных векторных систем на основе Ti- и Ri-плазмид. В одном классе, называемом "коинтегратом", шаттл-вектор, содержащий представляющий интерес ген, вводят с помощью генетической рекомбинации в неонкогенную Ti
плазмиду, которая содержит элементы как действующие в цис-положении, так и элементы действующие в транс-положении, требуемые для трансформации растений, как, например, в случае шаттл-вектора PMLJ1 из DeBlock etal., EMBO J 3, 1681 (1984) и неонкогенной Ti-плазмиды pGV2850, описанной Zambryski et al., EMBOJ2, 2143 (1983). Во втором классе или "бинарной" системе ген, представляющий интерес, вводят в шаттл-вектор, содержащий элементы действующие в цис-положении, необходимые для трансформации растений. Другие необходимые функциональные элементы обеспечиваются в трансположении с помощью неонкогенной Ti-плазмиды, как показано в качестве примера с помощью шаттл-вектора pBIN19, описанного Bevan, Nucleic Acids Research 12, 8711 (1984), и неонкогенной Ti-плазмиды PAL4404, описанной Hoekma, et al., Nature 303, 179 (1983).
Бинарные векторные системы были разработаны в случае, когда используемые обезоруженная Т-ДНК, несущая гетерологичную нуклеотидную последовательность, представляющую интерес, и функциональные элементы vir присутствуют на отдельных плазмидах. Таким образом, модифицированную область Т-ДНК, содержащую чужеродную ДНК (нуклеиновую кислоту, подлежащую переносу), конструируют в малую плазмиду, которая реплицируется в Е. coli. Эту плазмиду переносят сопряженно при помощи трехродительского скрещивания или посредством электропорации в А. tumefaciens, которая содержит совместимую плазмиду с последовательностями гена вирулентности. Функциональные элементы vir обеспечиваются в трансположении для переноса Т-ДНК в геном растения. Такие бинарные векторы применяют в практике настоящего изобретения.
В определенных вариантах осуществления используют супербинарные векторы. См., например, патент Соединенных Штатов №5591615 и ЕР 0 604 662. Был сконструирован такой супербинарный вектор, содержащий ДНК-область, полученную из области гипервирулентности Ti-плазмиды pTiBo542 (Jin et al., J. Bactehol. 169, 4417 (1987)), содержащейся в супервирулентной A. tumefaciens A281, проявляющей крайне высокую эффективность трансформации (Hood etal., Biotechndl. 2, 702 (1984); Hood etal., J. Bacteriol.
168, 1283 (1986); Komari etal., J. Bacteriol. 166, 88 (1986); Jin etal., J. Bacteriol.
169, 4417 (1987); Komari, Plant Science 60, 223 (1987); № доступа в АТСС 37394.
168,
Иллюстративные супербинарные векторы, известные специалистам в данной области, включают рТОК162 (заявка на японский патент (Kokai) № 4222527, ЕР 504869, ЕР 604662 и патент Соединенных Штатов №5591616) и рТОК233 (Komari, Plant Cell Reports 9, 303 (1990); Ishida et al., Nature Biotechnology 14, 745 (1996)). Другие супербинарные векторы можно сконструировать способами, изложенными в указанных выше литературных источниках. Супербинарный вектор рТОК162 способен к репликации как в Е. coli, так ивА tumefaciens. Кроме того, этот вектор содержит гены virB, virC и virG из области вирулентности pTiBo542. Плазмида также содержит ген устойчивости к антибиотикам, ген селектируемого маркера и представляющую интерес нуклеиновую кислоту, подлежащую трансформации в растение. Нуклеиновая кислота, подлежащая введению в геном растения, обычно располагается между двумя пограничными участками Т-области. Можно сконструировать супербинарные векторы по настоящему изобретению, характризующиеся свойствами, описанными выше в отношении рТОК162. Т-область супербинарных векторов и других векторов для применения в настоящем изобретении конструируют таким образом, что они имеют сайты рестрикции для введения генов, подлежащих доставке. Альтернативно, ДНК, подлежащую трансформации, можно ввести в область Т-ДНК вектора с помощью гомологичной рекомбинации in vivo. См., Herrera-Esterella et al., EMBO J. 2, 987 (1983); Horch etal., Science 223, 496 (1984). Такая гомологичная рекомбинация основана на том факте, что супербинарный вектор имеет область, гомологичную области pBR322 или других подобных плазмид. Таким образом, при ведении двух плазмид вместе, требуемый ген вводят в супербинарный вектор с помощью генетической рекомбинации посредством гомологичных областей.
В растениях, стабильно трансформированных с помощью трансформации, опосредованной Agrobacteria, представляющую интерес нуклеотидную последовательность включают в ядерный геном растения, как правило, фланкируемую с помощью по меньшей мере одного пограничного участка Т-ДНК и обычно двух пограничных участков Т-ДНК.
Растительные клетки можно трансформировать с помощью Agrobacteria любыми способами, известными в данной области техники, например, с помощью совместного культивирования с культивируемыми выделенными
протопластами или трансформации интактных клеток или тканей. В первом способе применяется система с клеточной линией, которая предусматривает культивирование протопластов и последующую регенерацию растения из культивируемых протопластов. Выявление трансформированных клеток или растений, как правило, выполняют с помощью включения селектируемого маркера в трансформирующий вектор или с помощью получения доказательств успешной бактериальной инфекции.
Способы введения нуклеиновой кислоты в растение также могут включать модификацию генетического материала in vivo, способы которой известны в данной области техники. Например, модификацию in vivo можно применять для вставки выделенной нуклеиновой кислоты, описанной в данном документе, в геном растения.
Подходящие способы для модификации in vivo включают методики, описанные в Gao et. al., Plant J. 61, 176 (2010); Li etal., Nucleic Acids Res. 39, 359 (2011); патентах США №№7897372 и 8021867; патентной публикации США №2011/0145940 и международных патентных публикациях №№WO 2009/114321, WO 2009/134714 и WO 2010/079430. Например, для введения выделенной нуклеиновой кислоты, описанной в данном документе, в геном растения можно применять одну или несколько эффекторных нуклеаз, подобных транскрипционным активаторам (TALEN), и/или одну или несколько мегануклеаз. В типовых вариантах осуществления способ включают расщепление генома растения в сайте-мишени с помощью TALEN и/или мегануклеазы и получение полинуклеотида, который содержит последовательность, которая гомологична, по меньшей мере, части сайта-мишени, и дополнительно содержит выделенную нуклеиновую кислоту по настоящему изобретению, так что происходит гомологичная рекомбинация и она приводит к вставке выделенной нуклеиновой кислоты в геном.
Протопласты, трансформированные с помощью любого способа, известного в данной области техники, также можно регенерировать с получением интактных растений с применением известных методик.
Регенерация растений из культивируемых протопластов описана в Evans etal., Handbook of Plant Cell Cultures, Vol. 1: (MacMilan Publishing Co. New York, 1983); и Vasil I. R. (ed.) (Cell Culture and Somatic Cell Genetics of Plants, Acad. Press, Orlando, Vol. I, 1984, and Vol. II, 1986). Фактически все виды растений
можно регенерировать из культивируемых клеток или тканей, в том числе без ограничений все основные виды сахарного тростника, сахарной свеклы, хлопчатника, фруктовых деревьев и бобовых.
Способы регенерации отличаются в зависимости от вида растений, но, как правило, сначала получают суспензию трансформированных протопластов или чашку Петри, содержащую трансформированные эксплантаты. Образуется каллусная ткань, и из каллуса можно индуцировать побеги и затем корень. Альтернативно, в каллусной ткани можно индуцировать образование соматического эмбриона. Эти соматические эмбрионы развиваются как естественные эмбрионы, формируя растения. Питательные среды, как правило, будут содержать различные аминокислоты и гормоны растений, такие как ауксин и цитокины. Также предпочтительным является добавление в среду глутаминовой кислоты и пролина, особенно для таких видов, как кукуруза и люцерна. Эффективная регенерация будет зависеть от среды, от генотипа и от истории культуры. Если контролировать эти три переменные, тогда регенерация обычно является воспроизводимой и повторяющейся.
Регенерированные растения переносят в стандартные почвенные условия и культивируют обычным образом. Растения выращивают и собирают с помощью стандартных процедур.
Альтернативно, трансгенные растения можно получать с помощью способа погружения цветочной почки (см., например, Clough и Bent (1998) Plant Journal 16:735-743, который исключает необходимость культивирования или регенерации растительной ткани. В одном типовом протоколе растения выращивают в почве до тех пор, пока первичное соцветие не достигнет 10 см в высоту. Первичное соцветие обрезают для индукции появления многочисленных вторичных соцветий. Соцветия этих растений обычно погружают в суспензию Agrobacterium, содержащую представляющий интерес вектор, простой сахар (например, сахарозу) и поверхностно-активное вещество. После процесса погружения растения выращивают до созревания и собирают семена. Трансгенные семена этих обработанных растений можно отбирать с помощью проращивания в условиях селективного давления (например, с помощью химического соединения биалафоса). Трансгенные растения, содержащие селектируемый маркер, переживают обработку и их можно пересаживать в отдельные горшки для последующего анализа. См. Bechtold, N.
and Pelletier, G. Methods Mol Biol 82, 259-266 (1998); Chung, M.H. et al. Transgenic Res 9, 471-476 (2000); Clough, S.J. and Bent, A.F. Plant J 16, 735-743 (1998); Mysore, K.S. et al. Plant J 21, 9-16 (2000); Tague, B.W. Transgenic Res 10, 259-267 (2001); Wang, W.C. et al. Plant Cell Rep 22, 274-281 (2003); Ye, G.N. et al. Plant J., 19:249-257 (1999).
Специалисты в данной области могут оптимизировать конкретные условия для трансформации, отбора и регенерации. Факторы, которые влияют на эффективность трансформации, включают вид растения, целевую ткань или клетку, состав питательной среды, гены селективных маркеров, виды векторов и условия освещенности/затемнения. Таким образом, можно менять эти и другие факторы с целью определения оптимального протокола трансформации для любого конкретного вида растений. Показано, что не каждый вид растений будут реагировать одинаковым образом на условия трансформации и может потребоваться несколько различная модификация протоколов, раскрытых в данном документе. Однако, изменяя каждую из переменных можно получить оптимальный протокол для любого вида растений.
Кроме того, генетические свойства, внедренные генно-инженерными методами в трансгенные семена и растения, части растений и/или растительные клетки по настоящему изобретению, описанные в данном документе, могут передаваться посредством полового размножения или вегетативного роста и, таким образом, могут поддерживаться и распространяться в растениях-потомках. Как правило, при поддержании и распространении применяют известные сельскохозяйственные способы, разработанные с учетом конкретных целей, таких как уборка урожая, посев или возделывание.
Настоящее изобретение более подробно описано в следующих примерах, которые предназначены только для иллюстрации, поскольку для специалистов в данной области будут очевидны их многочисленные модификации и вариации.
ПРИМЕРЫ
Применяемое в следующих примерах выражение "нормальные условия роста" обозначает условия роста, включающие температуру в дневное время 29°С, температуру в ночное время 23°С, 12 часов освещенности (примерно 500
мкмоль м"2 с"1) в течение дневного времени и 12 часов темноты в течение ночного времени.
Применяемое в следующих примерах выражение "условия нормальной температуры" обозначает условия роста, включающие температуру в дневное время 29°С и температуру в ночное время 23°С.
Применяемое в следующих примерах выражение "условия высокой температуры" обозначает условия роста, включающие температуру в дневное время 35°С и температуру в ночное время 26°С.
Применяемое в следующих примерах выражение "условия нормального светового дня" обозначает условия роста, включающие 12 часов освещенности (примерно 500 мкмоль м"2 с"1) в течение дневного времени и 12 часов темноты в течение ночного времени.
Применяемое в следующих примерах выражение "условия длинного светового дня" обозначает условия роста, включающие 16 часов освещенности (примерно 500 мкмоль м"2 с"1) в течение дневного времени и 8 часов темноты в течение ночного времени.
ПРИМЕР 1 Характеристика OsMYB55
Последовательность кДНК полной длины длиной 867 п.о. (SEQ ID NO: 4; фигура 1Е) OsMYB55 кодирует фактор транскрипции R2R3-MYB длиной предположительно 289 аминокислот (SEQ ID NO: 5; фигура 1F). Для выявления гомологов OsMYB55 применяли поиск BLAST(r) (Национальный центр биотехнологической информации, Бетесда, Мериленд). Аминокислотные последовательности ближайших гомологов (SEQ ID NO: 6-13; фигуры 17А-Н) применяли для построения филогенетического дерева, показывающего сходство между OsMYB55 и его гомологами (фигура 1А).
Последовательность геномной ДНК, содержащая 5'UTR, промоторную последовательность, кодирующую область MYB55 (содержащую три экзона и два интрона) и 3' UTR, показана на фигуре 1D (SEQ ID NO: 3); 5' UTR и промоторная последовательность отдельно показаны на фигуре 1С (SEQ ID NO: 2). Участок промоторной последовательности OsMYB55 длиной 2134 п.о. (с отсутствием нуклеотидов от -1 до -5) показан на фигуре 1В (SEQ ID NO: 1) и он применялся для разработки репортерного конструкта GUS (пример 3).
Для понимания регуляции гена OsMYB55 проводили анализ промоторной области OsMYB55 (-2100 п.о.) in-silico с применением базы данных PlantCARE (Фламандский межуниверситетский институт биотехнологии, Цвийнаарде, Бельгия; доступно на http://bioinformatics.psb.ugent.be/webtools/plantcare/html/). В промоторной области OsMYB55 были выявлены многочисленные потенциальные CARE и TFBS (фигуры 2А-2В).
Общий анализ экспрессии показал, что OsMYB55 дифференциально экспрессируется в растительных тканях и его экспрессия варьирует на протяжении жизненного цикла растения (фигура 3). Уровни транскриптов были выше во время стадий вегетативного роста вплоть до кущения и стадии закладывания соцветий. В течение этих периодов транскрипция была выше в тканях корня, чем в тканях листа. Самый низкий уровень экспрессии OsMYB55 наблюдался в семенах, как во время развития семян, так и во время созревания семян.
ПРИМЕР 2 Экспрессия OsMYB55 активируется в ответ на тепловой стресс: транскрипты OsMYB55
Семена растений риса дикого типа высаживали в горшки емкостью 500 мл, содержащие среду для роста, включающую сфагнум и вермикулит в соотношении 1:4. Растения выращивали в шкафах для выращивания растений (Conviron, Манитоба, Канада) в условиях полного обеспечения питательными веществами с применением 1 г медленнодействующего удобрения, содержащего азот, фосфор и калий (13-13-13) и обогащенного микроэлементами. Растения выращивали при нормальных условиях роста в течение четырех недель.
После четырех недель роста при нормальных условиях роста растения подвергали воздействию температуры 45°С в течение 0, 1, 6 или 24 часов. От каждого растения собирали листья, их замораживали незамедлительно в жидком азоте и хранили при температуре -80°С.
Количественный анализ листьев с помощью RT-PCR в реальном времени показал, что экспрессия OsMYB55 была активирована после воздействия температуры 45°С в течение одного часа и экспрессия OsMYB55 возвращалась к базовым уровням после воздействия температуры 45°С в течение 6 или 24 часов (фигура 4).
ПРИМЕР 3
Экспрессия OsMYB55 активируется в ответ на тепловой стресс:
репортерный белок GUS
Для разработки конструкта промотор OsMYB55-GUS а фрагмент промоторной области OsMYB55 длиной 2134 пар амплифицировали из геномной ДНК с применением прямого праймера промотор OsMYB55-BamW (5'-TGGTGAGGAGGATTGTGCAAGGATCCGCG-3'; SEQ ID N0:21) и обратного праймера промотор OsMYB55-EcoR1 (5'-CCGGAATTCTTGCACAATCCTCCT САССА-3'; SEQ ID NO: 22).
ДНК выделяли из растений четырехнедельного возраста, выращенных в нормальных условиях роста, с применением способа экстракции бромидом цетилтриметиламмония (СТАВ). Амплифицированный фрагмент (SEQ ID N0: 1; фигура 1В) клонировали в сайт множественного клонирования pCAMBIA1391Z (Cambia, Брисбен, Австралия) между сайтами рестрикции BamHI и EcoRI для стимуляции экспрессии репортерного белка GUS. Трансгенные линии риса, содержащие конструкт промотор OsMYB55-GUS разрабатывали с помощью трансформации, опосредованной Agrobacterium, и положительно трансформированные линии отбирали согласно способам Miki et al., Plant Physiol. 138(4): 1903 (2005).
Семена трансгенных растений риса, экспрессирующих конструкт промотор OsMYB55-GUS, высаживали в горшки емкостью 500 мл, содержащие среду для роста, включающую сфагнум и вермикулит в соотношении 1:4. Растения выращивали в шкафах для выращивания растений (Conviron, Манитоба, Канада) в условиях полного обеспечения питательными веществами с применением 1 г медленнодействующего удобрения, содержащего азот, фосфор и калий (13-13-13) и обогащенного микроэлементами. Растения выращивали при нормальных условиях роста в течение четырех недель.
После четырех недель роста при нормальных условиях роста растения подвергали воздействию температуры 29°С или 45°С в течение 0, 1, 6 или 24 часов. Растительные ткани собирали через 24 часа после воздействия и окрашивали путем погружения в 0,1 М буферный раствор цитрата натрия и HCI, рН 7,0, содержащий 1 мг/мл 5-бром-4-хлор-3-индолил-В-0-глюкуроновую кислоту (X-Gluc) (Biosynth International, Inc., Итаска, Иллинойс), вакуумной инфильтрации в течение пяти минут и инкубации при температуре 37°С в
течение 16 часов. Хлорофилл удаляли из тканей с помощью инкубации тканей в 75% этаноле. До исследования образцы хранили в 10% глицерине. Срезы готовили вручную и исследовали их с помощью световой микроскопии.
Как показано на фигуре 5, экспрессия GUS была выше в растениях, на которые воздействовали температурой 45°С в течение 24 часов, чем в растениях, на которые воздействовали температурой 29°С в течение 24 часов.
ПРИМЕР 4
Трансгенные линии риса, сверхэкспрессирующие OsMYB55
Поскольку экспрессия OsMYB55 активируется в ответ на высокие температуры, мы исследовали, принимает ли участие экспрессия OsMYB55 в одном или нескольких ответах на тепловой стресс и/или выносливости к высоким температурам. Эксперименты проводили на различных стадиях развития для определения влияния сверхэкспрессии OsMYB55 на термостойкость растений.
Конструкты для сверхэкспрессии OsMYB55 создавали с помощью промотора гена убиквитина маиса. Для получения трансгенных растений применяли трансформацию, опосредованную Agrobacterium. Положительно трансформированные растения отбирали с помощью теста на фосфоманнозоизомеразу (PMI) (Negrotto et al. Plant Cell Rep. 19:798 (2000)).
Анализ экспрессии показал, что экспрессия OsMYB55 после четырех недель роста при нормальных условиях роста была в пятьдесят - девяносто раз выше в листьях трансгенных растений риса, сверхэкспрессирующих OsMYB55, по сравнению с растениями риса дикого типа (фигура 6).
ПРИМЕР 5
Сверхэкспрессия OsMYB55 увеличивает длину колеоптиля при высоких
температурах
Семена растений риса дикого типа и трансгенных растений риса, сверхэкспрессирующих OsMYB55, проращивали и выращивали в течение четырех дней при температуре 28°С или 39°С.
Как показано на фигурах 7А и 7В, хотя длина колеоптиля уменьшалась у всех растений, выращенных при температуре 39°С, колеоптили трансгённых растений риса, сверхэкспрессирующих OsMYB55, выращенных при температуре 39°С, были значимо длиннее, чем колеоптили их аналогов дикого типа.
ПРИМЕР 6
Сверхэкспрессия OsMYB55 усиливает рост в условиях длинного
светового дня
Семена растений риса дикого типа и трансгенных растений риса, сверхэкспрессирующих OsMYB55, высаживали в горшки емкостью 500 мл, содержащие Turface(r) MVP(r) (PROFILE Products, LLC, Буффало Гроув, Иллинойс) (среда для роста на основе 100% обожженной кальцинированной глины с размером зерна от 2,5 до 3,5 мм). Растения выращивали в шкафах для выращивания растений (Conviron, Манитоба, Канада) в условиях полного обеспечения питательными веществами с применением 1 г медленнодействующего удобрения, содержащего азот, фосфор и калий (13-1313) и обогащенного микроэлементами. Растения выращивали при нормальных условиях роста сразу после проращивания (10 дней после высадки), затем выращивали в течение 4 недель в условиях длинного светового дня в условиях нормальной температуры или в условиях высокой температуры.
Как показано на фигурах 8A-8D, отсутствовали значимые различия в высоте, вегетативной биомассе и биомассе корней растений, выращенных в условиях нормальной температуры. У растений риса дикого типа, выращенных в условиях высокой температуры, было показано снижение высоты растений (фигура 8В) и повышение сухой биомассы (фигуры 8C-8D). У трансгенных растений риса, сверхэкспрессирующих OsMYB55, выращенных в условиях высокой температуры, было показано меньшее снижение высоты растений (фигура 8В) и значимое повышение биомассы растений по сравнению с их аналогами дикого типа (фигуры 8C-8D).
ПРИМЕР 7
Сверхэкспрессия OsMYB55 усиливает рост в условиях нормального
светового дня
Семена растений риса дикого типа и растений трансгенного риса, сверхэкспрессирующих OsMYB55, высаживали в горшки емкостью 500 мл, содержащие среду для роста, включающую сфагнум и вермикулит в соотношении 1:4. Растения выращивали в шкафах для выращивания растений (Conviron, Манитоба, Канада) в условиях полного обеспечения питательными веществами с применением 1 г медленнодействующего удобрения, содержащего азот, фосфор и калий (13-13-13) и обогащенного
микроэлементами. Растения выращивали при нормальных условиях роста сразу после проращивания (10 дней после высадки), затем выращивали в течение четырех недель при условиях нормального светового дня в условиях нормальной температуры или в условиях высокой температуры.
Как показано на фигурах 9A-9D, отсутствовали значимые различия в высоте и вегетативной биомассе растений, выращенных в условиях нормальной температуры. У растений риса дикого типа, выращенных при высокой температуре, было показано снижение высоты растений (фигура 9С), вегетативной биомассы и длины листового влагалища. У трансгенных растений риса, сверхэкспрессирующих OsMYB55, выращенных в условиях высокой температуры, было показано меньшее снижение вегетативной биомассы по сравнению с их аналогами дикого типа (фигура 9С). Сверхэкспрессия OsMYB55 также ослабляла отрицательные влияния условий высокой температуры на высоту и длину листового влагалищу трансгенных растений риса, сверхэкспрессирующих OsMYB55.
ПРИМЕР 8
Неблагоприятные влияния на рост при непрерывной высокой температуре более выраженные в условиях длинного светового дня, чем в условиях нормального светового дня
Семена растений риса дикого типа и трансгенных растений риса, сверхэкспрессирующих OsMYB55, высаживали в горшки емкостью 500 мл. Растения выращивали в шкафах для выращивания растений (Conviron, Манитоба, Канада) в условиях полного обеспечения питательными веществами с применением 1 г медленнодействующего удобрения, содержащего азот, фосфор и калий (13-13-13) и обогащенного микроэлементами. Растения выращивали при нормальных условиях роста сразу после проращивания (10 дней после высадки), затем выращивали в течение 4, 9, 11 или 17 недель при нормальных условиях роста, с условиях нормального светового дня с условиями высокой температуры или в условиях длинного светового дня либо с условиями нормальной температуры, либо с условиями высокой температуры.
Как показано на фигурах 10A-10G, рост при непрерывной высокой температуре вызывал деформации соцветий и приводил к полному отсутствию завязывания семян в сравнении с ростом в условиях нормальной температуры. Сверхэкспрессия OsMYB55 не снижала значимо частоту возникновения
деформаций соцветий или отсутствия завязывания семян. Как в случае растений риса дикого типа, так и трансгенных растений риса, сверхэкспрессирующих OsMYB55, неблагоприятные влияния на рост при непрерывной высокой температуре были более выраженными у растений выращенных в условиях длинного светового дня, чем у растений, выращенных при условиях нормального светового дня.
ПРИМЕР 9
Сверхэкспрессия OsMYB55 совершествует растения в отношении выносливости к высоким температурам
Семена растений риса дикого типа и трансгенных растений риса, сверхэкспрессирующих OsMYB55, высаживали в горшки емкостью 500 мл. Растения выращивали в шкафах для выращивания растений (Conviron, Манитоба, Канада) в условиях полного обеспечения питательными веществами с применением 1 г медленнодействующего удобрения, содержащего азот, фосфор и калий (13-13-13) и обогащенного микроэлементами. Растения выращивали при нормальных условиях роста сразу после проращивания (10 дней после высадки), затем выращивали в течение четырех недель при нормальных условиях роста или в условиях нормального светового дня с условиями высокой температуры. После четырехнедельного периода обработки растения выращивали при нормальных условиях роста до сбора урожая (около 12 недель).
Как показано на фигурах 11А-11В, хотя рост в условиях высоких температур в течение четырех недель приводил к значительному снижению общей сухой биомассы и урожая зерна как у растений риса дикого типа, так и у трансгенных растений риса, сверхэкспрессирующих OsMYB55, это снижению было менее выраженным у трансгенных растений риса, сверхэкспрессирующих OsMYB55.
ПРИМЕР 10
Растения риса, экспрессирующие конструкт OsMYB55-RNAi
Конструкт OsMYB55-RNA\ готовили согласно способам из Miki et al., Plant Physiol. 138(4): 1903 (2005). Фрагменты последовательности кДНК OsMYB55 длиной 491 п.о. и с низким сходством с другими генами риса амплифицировали с помощью ПЦР с применением прямого праймера OsMY855-491 (5'-CGTCAAGAACTACTGGAACAC С-3'; SEQ ID NO: 23) и обратного праймера
OsMYB55-4M (5'-CCATGTTCGGGAAGTA GCAC-3'; SEQ ID N0:24). Полученный фрагмент клонировали в вектор клонирования ТОРО(r) pENTER (Life Technologies Corp., Карлсбад, Калифорния) и инвертированные последовательности ДНК, отделенные интронной последовательностью GUS, получали с помощью способа сайт-специфической рекомбинации в бинарном векторе pANDA, описанном Miki et al., Plant Physiol. 138(4)1903 (2005), ниже промотора убиквитина маиса с помощью смеси ферментов Gateway LR Clonase (Life Technologies Corp., Карлсбад, Калифорния). Трансгенные линии риса получали с помощью трансформации, опосредованной Agrobacterium, и положительно трансформированные линии отбирали согласно способам из Miki et al., Plant Physiol. 138(4): 1903 (2005).
Хотя у четырехнедельных растений риса, экспрессирующих конструкт OsMVB55-RNAi, уровень транскрипта OsMYB55 был приблизительно в три раза меньше (фигура 12), фенотипической разницы между растениями риса дикого типа и растениями, экспрессирующими конструкт OsMYS55-RNAi, не наблюдалось. Не желая привязываться к теории, в настоящее время считается, что отсутствие различимого фенотипа у растений риса, экспрессирующих конструкт OsMYB55-RNA\, может происходить из-за большого числа представителей семейства факторов транскрипции R2R3-MYB и высокой избыточности в этом семействе.
ПРИМЕР 11
Сверхэкспрессия OsMYB55 увеличивает общее содержание аминокислот
в листьях
Для понимания физиологических и молекулярных механизмов, лежащих в основе усиления термостойкости растений с помощью OsMYB55, собирали различные ткани растений и проводили биохимические анализы для выявления различий между растениями риса дикого типа и трансгенными растениями риса, сверхэкспрессирующими OsMYB55 (например, различия в содержании Сахаров, содержании крахмала, содержании пероксида водорода, содержании аминокислот и др.).
Семена растений риса дикого типа и трансгенных растений риса, сверхэкспрессирующих OsMYB55, высаживали в горшки емкостью 500 мл. Растения выращивали в шкафах для выращивания растений (Conviron, Манитоба, Канада) в условиях полного обеспечения питательными веществами
с применением 1 г медленнодействующего удобрения, содержащего азот, фосфор и калий (13-13-13) и обогащенного микроэлементами. Растения выращивали при нормальных условиях роста сразу после проращивания (10 дней после высадки), затем выращивали в течение четырех недель при нормальных условиях роста или в условиях нормального светового дня с условиями высокой температуры.
После четырехнедельного периода обработки ткани собирали и лиофизировали в течение 24 часов, затем экстрагировали трижды с применением 0,75 мл 100% метанола. Каждую экстракцию проводили при температуре 70°С в течение 15 минут. Экстракты подвергали очистке хлороформом путем добавления 500 мл экстракта к 355 мл воды и 835 мл хлороформа. После центрифугирования верхнюю фазу собирали и лиофизировали, затем растворяли в деионизированной воде. Общее содержание аминокислот оценивали согласно способам из Rosen, Arch. Biochem. Biophys. 6710 (1957).
Как показано на фигуре 13А, листья трансгенных растения риса, сверхэкспрессирующих OsMYB55, имели более высокое общее содержание аминокислот, чем их аналоги дикого типа, при выращивании в условиях длинного светового дня либо с условиями нормальной температуры, либо с условиями высокой температуры. Воздействие условий высокой температуры повышало содержание аминокислот в листьях как у растений риса дикого типа, так и у трансгенных растений риса, сверхэкспрессирующих OsMYB55. Содержание аминокислот в листьях трансгенных растений риса, сверхэкспрессирующих OsMYB55, повышалось более значимо, чем содержание аминокислот в листьях растений риса дикого типа.
ПРИМЕР 12
Сверхэкспрессия OsMYB55 активирует экспрессию генов, вовлеченных в
метаболизм аминокислот
На основе результатов анализа общего содержания аминокислот, мы предположили, что OsMYB55 может принимать участие в активации генов, вовлеченных в метаболизм аминокислот. Для проверки этой гипотезы проводили полногеномный транскриптомный анализ с помощью общего микроматричного анализа растений риса дикого типа и трансгенных растений
риса, сверхэкспрессирующих OcMYB55, которые подвергали воздействию высоких температур.
Поскольку при микроматричном анализе можно пропустить более тонкие изменения экспрессии генов, выполняли количественную ПЦР в реальном времени с помощью праймеров, соответствующих другим генам, вовлеченным в биосинтез и транспорте аминокислот. Количественную RT-PCR в реальном времени проводили с помощью специфических праймеров, разработанных из последовательности выбранных генов. Общую РНК выделяли из тканей растения с помощью реагента для выделения РНК TRI-Reagent (r) (Sigma-Aldrich Corp., Сент-Луис, Миссисипи). Для удаления любого остатка геномной ДНК общую РНК обрабатывали свободной от РНКазы ДНКазой RQ1 (Promega Corp., Мэдисон, Висконсин). кДНК синтезировали из общей РНК с помощью набора системы обратной транскрипции (Quanta Biosciences, Inc., Гейтерсберг, Мэриленд). Для разработки праймеров для целевых генов применяли программное обеспечение Primer Express 2.0 (Applied Biosystems by Life Technologies Corp., Карлсбад, Калифорния). Значения относительного количественного содержания (RQ) каждого целевого гена относительно внутреннего контроля актина 2 рассчитывали с помощью способа 2СТ, описанного Livak и Schmittgen, Methods 25:402 (2001).
Семена растений риса дикого типа и трансгенных растений риса, сверхэкспрессирующих OsMYB55, высаживали в горшки емкостью 500 мл. Растения выращивали в шкафах для выращивания растений (Conviron, Манитоба, Канада) в условиях полного обеспечения питательными веществами с применением 1 г медленнодействующего удобрения, содержащего азот, фосфор и калий (13-13-13) и обогащенного микроэлементами. Растения выращивали в условиях длинного светового дня в условиях нормальной температуры в течение четырех недель и затем подвергали воздействию температуры 45°С в течение 0, 1, 6 или 24 часов.
Было обнаружено три активированных кандидатных гена, существенных для выработки аминокислот: OsGS1;2, OsGATI и OsGAD3 (фигуры 13B-13D). GS1;2 участвует в превращении глутамина в глутаминовую кислоту и отражает один из ранних этапов биосинтеза аминокислот. GAT1, также известный как карбамоилфосфатсинтетаза, вовлечен в первый обязательный этап биосинтеза аргинина у прокариот и эукариот (Holden et al., Current Opin. Structural Biol. 8:679
(1998)). Гены GAD вовлечены в превращение L-глутаминовой кислоты в GABA (Hiroshi, J. Mol. Catalysis В: Enzymatic 10:67 (2000)). Количественный ПЦР-анализ в реальном времени обнаружил активацию трех вышеупомянутых генов через один час после воздействия на растения риса температуры 45°С. Уровни транскриптов OsGATI и OsGAD3 снижались практически до базовых уровней через 6 часов после воздействия температуры 45°С (фигуры 13C-13D), в то время как уровень транскрипта OsGS1;2 сохранялся значительно повышенным через 6 часов после воздействия температуры 45°С (фигура 13В).
Значимого отличия в транскриптах других генов, вовлеченных в метаболизм аминокислот, обнаружено не было.
ПРИМЕР 13
OsMYB55 связывается с генами, вовлеченными в метаболизм
аминокислот
Последовательности ДНК, соответствующие промоторам генов, выявленных в примере 12 (OsGS1;2, OsGATI и OsGAD3), анализировали с помощью базы данных PlantCARE (Фламандский межуниверситетский институт биотехнологии, Цвийнаарде, Бельгия; доступно на
http://bioinformatics.psb.ugent.be/webtools/plantcare/html/). Результаты показали, что все три промотора содержали потенциальный сайт связывания для белков MYB, мотив CAGTTA. Мотив CAGTTA, расположенный в 1079 п.о., 460 п.о. и 554 п.о. от первого кодона ATG в OsGS1;2, OsGATI и OsGAD3 кДНК, соответственно. Поскольку мотив CAGTTA является боксом связывания для факторов транскрипции MYB и является, таким образом, потенциальным сайтом связывания для OsMYB55, проводили анализ изменения электрофоретической подвижности (EMSA), чтобы определить, связывается ли OsMYB55 с CAGTTA-боксом OsGS1;2, OsGATI и OsGAT3 in vitro.
Рекомбинантный OsMYB55 готовили следующим образом. Кодирующую область кДНК полной длины OsMYB55 амплифицировали с применением прямого праймера MYB55-P28-BamHI (5'-CGCGGAT
CCATGGGGCGCGCGCCGT-3'; SEQ ID NO: 25) и обратного праймера MYB55-P28-Hinlll (5'-CCCAAGCTTTGTCAGGGTGTTGCAGAGACCCTGT-3'; SEQ ID NO: 26). Продукт ПЦР и вектор pET15b (Novagen(r), EMB Biosciences) расщепляли с помощью BamHI и Hindlll. После лигирования конструкт трансформировали в RIL-компетентные клетки Arctic Express (DE3) (Agilent Technologies, Санта-
Клара, Калифорния) в соответствии с иструкциями изготовителя. Рекомбинантный OsMYB55 очищали с помощью системы очистки с His-меткой (Qiagen, Inc., Валенсия, Калифорния).
Потенциальные сайты связывания OsMYB55 из промоторов OsGS1;2, OsGATI и OsGAD3 амплифицировали с помощью специфических праймеров с получением продуктов ДНК, содержащих одну копию их соответствующих боксов связывания MYB.
EMSA проводили с различным количеством рекомбинантного белка OSMYB55 (0, 10, 20 или 40 мкг) и ДНК-продуктов OsGS1;2, OsGATI и OsGAD3 (0 или 200 нг) с помощью набора EMSA (№ по кат. Е33075, Molecular Probes, Inc., Юджин, Орегон). Образцы, содержащие ДНК и/или белок, загружали в Ready Gel ТВЕ с градиентом 4-20% полиакриламидного нативного геля (Bio-Rad Laboratories, Геркулес, Калифорния) при 200 В в течение 45 минут. ДНК в геле окрашивали с помощью SYBR(r) Green, поставляемым в наборе EMSA, и визуализировали с помощью системы визуализации ChemiDoc(tm) (Bio-Rad Laboratories, Геркулес, Калифорния).
Как показано на фигуре 14А, OsMYB55 сильно связывался с промоторными последовательностями OsGS1;2, OsGATI и OsGAD3, содержащими мотив CAGTTA-бокса.
ПРИМЕР 14
OsMYB55 активирует гены, вовлеченные в метаболизм аминокислот
Связывание белка OsMYB55 с промоторными последовательностями OsGs1;2, OsGATI и OsGAD3 подтверждает гипотезу о том, что OsMYB55 может повышать содержание аминокислот вследствие активации этих генов. Для исследования этой гипотезы проводили анализ активации транскрипции с помощью стратегии временной экспрессии генов с применением GUS в качестве репортерного белка.
Последовательности ДНК, соответствующие промоторам OsGS1;2, OsGAD3 и OsGATI клонировали в содержащий интроны репортерный вектор GUS. Последовательность ДНК промоторов OsGS1;2, OsGAD3 и OsGATI (1,5-2 т.п.о. выше старт-кодбна ATG кДНК) амплифицировали из геномной ДНК риса с помощью прямого праймера промотора OsGS1;2 (5'-CACCTGCGGTGAATGGAAGACGTTTG -3'; SEQ ID NO: 27) и обратного праймера промотора OsGS1;2 (5'-TGCTCAAAGCAGAAGAGATCTGAATGAG-3';
SEQ ID N0:28), прямого праймера промотора OsGATI (5'-CACCGACGGAGGAAGTAGTG TGGAACCAT-3'; SEQ ID NO: 29) и обратного праймера промотора OsGATI (5'-TGGTGGTAGGGTG CGGC -3'; SEQ ID NO: 30) или прямого праймера промотора OsGAD3 (5'-CACCCAGATCAAATGTCA AAAGGGGCG-3'; SEQ ID NO: 31) и обратного праймера промотора OsGAD3 (5'-CTTGCCT GCCGAGCTATCAACC-3'; SEQ ID NO: 32). Полученные фрагменты клонировали в вектор ТОРО pENTER (Life Technologies Corp., Карлсбад, Калифорния) и конечный конструкт готовили с помощью способа сайт-специфической рекомбинации в векторе DMC162 gateway с помощью смеси ферментов Gateway(r) LR Clonase(r) (Life Technologies Corp., Карлсбад, Калифорния). OsMYB55 вводили в вектор DMC32 вслед за промотором 35S с помощью прямого праймера OsMYB55-Pent (5'-ATGGGGCGCGCGCCGTG-3'; SEQ ID NO: 33) и обратного праймера OsMYB55-Pent (5-CTATGTCAGGGTGTTGCAGAG ACC-3'; SEQ ID NO: 34). Эту плазмиду применяли в качестве активатора при анализе временной экспрессии совместной трансформации. Для нормализации значений активности GUS применяли ген люциферазы светляка (Photinus pyralis), запускаемый промотором 35S в плазмиде pJD312 (любезно предоставленным д-ром Virginia Walbot, Стэнфордский университет). Равные количества ДНК из различных плазмидных конструктов трансформировали с помощью бомбардировки частиц в листья четырехнедельного табака (Nicotiana plumbaginifolia). После инкубации в течение 48 часов при комнатной температуре в темноте из каждого образца экстрагировали общий белок и измеряли активность GUS и люциферазы. Активность GUS определяли с помощью измерения расщепления субстрата В-глюкуронидазы 4-метилумбеллиферил-Р-О-глюкуронида (MUG). Активность люциферазы измеряли с помощью набора системы анализа люциферазы (№ по кат. Е1500, Promega Corp., Мэдисон, Висконсин), следуя инструкциям изготовителя. В этом эксперименте в качестве отрицательного контроля применяли пустые векторы.
Как показано на фигуре 14В, OsMYB55 активировал экспрессию OsGs1;2, GAT1 и GAD3 в клетках эпидермиса табака почти в восемь раз по сравнению с контрольным экспериментом. Совместно с результатами примера 13 эти результаты указывают на то, что OsMYB55 непосредственно регулирует экспрессию OsGs1;2, OsGATI и OsGAD3.
ПРИМЕР 15
Сверхэкспрессия OsMYB55 увеличивает содержание глутаминовой
кислоты и аргинина в листьях
Семена растений риса дикого типа и трансгенных растений риса, сверхэкспрессирующих OsMYB55t высаживали в горшки емкостью 500 мл. Растения выращивали в шкафах для выращивания растений (Conviron, Манитоба, Канада) в условиях полного обеспечения питательными веществами с применением 1 г медленнодействующего удобрения, содержащего азот, фосфор и калий (13-13-13) и обогащенного микроэлементами. Растения выращивали при нормальных условиях роста сразу после проращивания (10 дней после высадки), затем выращивали в течение четырех недель в условиях длинного светового дня либо с условиями нормальной температуры, либо с условиями высокой температуры.
После четырехнедельного периода обработки ткани собирали и лиофизировали в течение 24 часов, затем экстрагировали трижды с применением 0,75 мл 100% метанола. Каждую экстракцию проводили при температуре 70°С в течение 15 минут. Экстракты подвергали очистке хлороформом путем добавления 500 мл экстракта к 355 мл воды и 835 мл хлороформа. После центрифугирования верхнюю фазу собирали и лиофизировали, затем растворяли в деионизированной воде. Содержание глутаминовой кислоты и аргинина определяли с помощью наборов L-глутаминовой кислоты и аргинина (Megazyme Intl., Брей, Ирландия) в соответствии с инструкциями изготовителя.
Глутаминовая кислота является одной из первых аминокислот, которая синтезируется из азотистых соединений и может превращаться в другие аминокислоты. В соответствии с результатом, что трансгенные растения риса, сверхэкспрессирующие OsMYB55, имеют более высокие уровни транскриптов OsGS1;2, чем растения риса дикого типа при выращивании при нормальных условиях роста, трансгенные растения риса, сверхэкспрессирующие OsMYB55, имели более высокое содержание глутаминовой кислоты в корнях при выращивании при нормальных условиях роста. Содержание глутаминовой кислоты в листьях трансгенных растений риса, сверхэкспрессирующих OsMYB55, было аналогичным содержанию ее в растения риса дикого типа при нормальных условиях роста (фигура 15А). При выращивании растений в
условиях высокой температуры повышалось содержание глутаминовой кислоты в листьях и листовых влагалищах как у растений риса дикого типа, так и у трансгенных растений риса, сверхэкспрессирующих OsMYB55, но повышение было значительно выше у трансгенных растений риса, сверхэкспрессирующих OsMYB55, по сравнению с их аналогами дикого типа (фигура 15А).
Аргинин требуется для биосинтеза полиамина у растений, который, как было указано, вовлечен в ряд процессов, связанных с развитием растений и стрессовыми состояниями, включая воздействие высокой температуры (Alcazar et al., Biotech. Lett. 28:1867 (2006); Cheng et al., J. Integrative Plant Biol. 51:489 (2009)). Наши результаты показали, что листья трансгенных растений риса, сверхэкспрессирующих OsMYB55, имели такой же уровень аргинина, что и растения риса дикого типа при выращивании в условиях нормальной температуры в течение четырех недель (фигура 15С). При выращивании растений в условиях высокой температуры повышалось содержание аргинина в листьях как у растений риса дикого типа, так и у трансгенных растений риса, сверхэкспрессирующих OsMYB55, но повышение было значительно выше у трансгенных растений риса, сверхэкспрессирующих OsMYB55 (фигура 15С).
ПРИМЕР 16
Сверхэкспрессия OsMYB55 повышает содержание GABA в листьях
Семена растений риса дикого типа и трансгенных растений риса, сверхэкспрессирующих OsMYB55, высаживали в горшки емкостью 500 мл. Растения выращивали в шкафах для выращивания растений (Conviron, Манитоба, Канада) в условиях полного обеспечения питательными веществами с применением 1 г медленнодействующего удобрения, содержащего азот, фосфор и калий (13-13-13) и обогащенного микроэлементами. Растения выращивали при нормальных условиях роста сразу после проращивания (10 дней после высадки), затем выращивали в течение четырех недель в условиях длинного светового дня либо с условиями нормальной температуры, либо с условиями высокой температуры.
Ткани растений собирали и определяли содержание GABA, как описано у Zhang and Bown, Plant J. 44:361 (2005). Вкратце, 0,1 г замороженной ткани экстрагировали с помощью 400 мкл метанола при температуре 25°С в течение 10 минут. Образцы высушивали в вакууме и растворяли в 1 мл 70 мМ хлорида лантана. Затем образцы встряхивали в течение 15 минут, центрифугировали
при 13000 х g в течение 5 минут и 0,8 мл супернатанта отбирали во вторую пробирку емкостью 1,5 мл. К нему добавляли 160 мкл 1 М КОН, с последующим встряхиванием в течение 5 мин. и центрифугированием, как описано ранее. Полученный супернатант применяли в спектрометрическом анализе GABA, описанном ниже.
1 мл пробы для анализа, содержащей 550 мкл образца, 150 мкл 4 мМ NADP+, 200 мкл 0,5 М буфера пирофосфата К+ (приготовленного с помощью добавления 0,15 М фосфорной кислоты по каплям для достижения рН 8,6), 50 мкл 2 единиц GABASE на мл и 50 мкл 20 мМ а-кетоглутарата. Исходный А считывали при 340 нм перед добавлением а-кетоглутарата, а конечный А считывали через 60 мин. Разницу в значениях А использовали для построения калибровочной кривой. Коммерческий препарат фермента GABASE растворяли в 0,1 М буфере K-Pi (рН 7,2), содержащем 12,5% глицерина и 5 мМ 2-меркаптоэтанола. Полученный раствор замораживали до применения.
В этом исследовании в условиях нормальной температуры было обнаружено повышение содержания GABA в листьях у трансгенных растений риса, сверхэкспрессирующих OsMYB55, по сравнению с их аналогами дикого типа (фигура 15В). При выращивании растений в условиях высокой температуры повышалось содержание GABA в листьях как у растений риса дикого типа, так и у трансгенных растений риса, сверхэкспрессирующих OsMYB55, но повышение было значительно более очевидным у трансгенных растений риса, сверхэкспрессирующих OsMYB55 (фигура 15В).
ПРИМЕР 17
Сверхэкспрессия OsMYB55 повышает содержание пролина в листьях
Семена растений риса дикого типа и трансгенных растений риса, сверхэкспрессирующих OsMYB55, высаживали в горшки емкостью 500 мл. Растения выращивали в шкафах для выращивания растений (Conviron, Манитоба, Канада) в условиях полного обеспечения питательными веществами с применением 1 г медленнодействующего удобрения, содержащего азот, фосфор и калий (13-13-13) и обогащенного микроэлементами. Растения выращивали при нормальных условиях роста сразу после проращивания (10 дней после высадки), затем выращивали в течение четырех недель в условиях длинного светового дня либо с условиями нормальной температуры, либо с условиями высокой температуры.
Ткани растений собирали и определяли содержание пролина согласно протоколу, ранее описанному Abraham et al., Methods Mol. Biol. 639317 (2010). Вкратце, 100 мг замороженных тканей экстрагировали с помощью 500 мкл 3% сульфосалициловой кислоты и супернатант применяли для количественного определения пролина. Реакционную смесь из 200 мкл ледяной уксусной кислоты и 200 мкл кислого нингидрина добавляли к 200 мкл экстракта. Реакционную смесь инкубировали при температуре 96°С в течение 60 минут и реакцию прекращали с помощью льда. Пролин экстрагировали из образцов в 1 мл толуола и после центрифугирования измеряли поглощение в верхней фазе при 520 нм. Концентрацию пролина определяли с помощью стандартной кривой и рассчитывали на основе сырого веса.
В этом исследовании в условиях нормальной температуры не было обнаружено значимого отличия в содержании пролина между растениями риса дикого типа и трансгенными растениями риса, сверхэкспрессирующими OsMYB55 (фигура 15D). При выращивании растений в условиях высокой температуры повышалось содержание пролина в листьях как у растений риса дикого типа, так и у трансгенных растений риса, сверхэкспрессирующих OsMYB55, но повышение было значительно выше у трансгенных растений риса, сверхэкспрессирующих OsMYB55 (фигура 15D).
ПРИМЕР 18
Гибридизация на микрочипах и анализ данных
Семена растений риса дикого типа и трансгенных растений риса, сверхэкспрессирующих OsMYB55, высаживали в горшки емкостью 500 мл. Растения выращивали в шкафах для выращивания растений (Conviron, Манитоба, Канада) в условиях полного обеспечения питательными веществами с применением 1 г медленнодействующего удобрения, содержащего азот, фосфор и калий (13-13-13) и обогащенного микроэлементами. Растения выращивали при нормальных условиях роста в течение четырех недель и затем подвергали воздействию температуры 45°С в течение одного часа. Собирали листья растений риса дикого типа и трансгенных растений и выделяли общую РНК.
Двухцепочечную кДНК синтезировали из 5 мкг общей РНК из каждого образца. Меченую комплементарную РНК, синтезированную из кДНК, гибридизировали с полногеномной матрицей риса (номер по кат. 900601,
Affymetrix, Inc., Санта-Клара, Калифорния). Сигнал гибридизации матриц получали с помощью GeneChip Scanner 3000 (Affymetrix, Inc., Санта-Клара, Калифорния) и количественно определяли с помощью Microarray Suite 5.0 (Affymetrix, Inc., Санта-Клара, Калифорния). 25 измерений при помощи набора зондов обобщали в виде взвешенного среднего всех зондов в наборе, вычитая нижние 5% средней интенсивности всей матрицы с помощью специального алгоритма. Общую интенсивность всех наборов зондов каждой матрицы дополнительно приводили к значению 100 целевой интенсивности для возможности проведения прямого сравнения. Данные анализировали с помощью программного обеспечения GeneSpring (Agilent Technologies, Санта-Клара, Калифорния). Сначала выявляли гены с двукратным изменением, а затем применяли ANOVA для выявления значимых генов (t-критерий Уэлча при пороговом р-значении 0,05).
Как показано на фигурах 16А-16В, были обнаружены многочисленные гены, способные к активации и/или подавлению в ответ на высокие температуры роста, как у растений риса дикого типа, так и у трансгенных растений риса, сверхэкспрессирующих OsMYB55.
ПРИМЕР 19 Статистическая обработка
Все виды статистической обработки выполняли с помощью SigmaStat (SPSS Inc., Чикаго, Иллинойс) с уровнем ошибки, установленным при а = 0,05. Значимое отличие между видами обработки тестировали с помощью критерия достоверно значимой разницы Тьюки.
ПРИМЕР 20 Обсуждение
Был выявлен фактор транскрипции MYB, который повышает выносливость растений риса к высокой температуре во время вегетативной стадии роста. Сверхэкспрессия OsMYB55 улучшала рост и урожайность растений в условиях высокой температуры. Трансгенные растения поддерживали большую высоту растения и большую сухую биомассу по сравнению с растениямй'дйкого типа, выращенными при высокой температуре. Воздействие высокой температуры на растения дикого типа в течение четырех недель в первые шесть недель жизненного цикла снижало урожай зерна при сборе урожая. Однако, снижение было значительно меньшим у трансгенных
растений. Совместно эти результаты указывают на то, что трансгенные линии лучше растут и проявляют лучшие характеристики при высокой температуре, чем линии дикого типа. Хотя наблюдалось положительное влияние сверхэкспрессии OsMYB55 на выносливость растения к высоким температурам по сравнению с диким типом, никакого значимой отличия при RNAi-нокдауне в его экспрессии показано не было. Вероятно, это происходит из-за высокого уровня избыточности в этой семействе генов, хотя это могло быть связано с тем фактом, что эти линии все еще характеризовались некоторой экспрессией, хотя и сниженной, гена OsMYB55.
Для исследования функции OsMYB55 в усилении роста растений при высокой температуре проводили различные биохимические и молекулярные анализы. Гистологический анализ тканей листьев, листовых влагалищ и стеблей растений дикого типа и трансгенных растений, выращенных при высокой температуре, не выявил никакого значимого различия (данные не показаны), что свидетельствует о том, что большая высота растений и длина листовых влагалищ являются результатами улучшения общих характеристик растения, а не влияния на рост или деление клеток. В дополнение, биохимический анализ на крахмал, сахара и пероксид водорода, как показатель антиоксидантной активности, не показал значительных изменений у трансгенных растений по сравнению с растениями дикого типа (данные не показаны). Rivero et al., Plant Biol. (Stuttg) 6:702 (2004), высказали предположение о важности азотистых соединений и пролина в выносливости растений к высоким температурам. Мы исследовали нитраты и соединения четвертичного аммония у растений дикого типа и трансгенных растений, выращиваемых при двух различных температурах, и значимого различия обнаружено не было (данные не показаны).
В настоящем исследовании растения, которые сверхэкспрессировали OsMYB55, характеризовались повышением в общем содержании аминокислот. Анализ транскриптов ряда факторов транскрипции теплового шока и белков теплового шока, которые, как известно, вовлечены в реакции растений на высокую температуру, не выявил значимого различия между растениями дикого типа и трансгенными растениями (данные не показаны). Общий транскриптомный анализ выявил три мишени для OsMYB55 риса, а именно,
OsGS1;2, GAT1 и GAD3. OsMYB55 связывается in vitro с промоторами этих генов и трансактивирует их в клетках листьев табака.
Сверхэкспрессия OsMYB55 приводит к улучшению выносливости к высоким температурам и повышает уровень как общего содержания аминокислот в листьях, так и, в частности, глутаминовой кислоты, пролина, аргинина и GABA. Следует отметить, что хотя содержание пролина повышалось в линиях со сверхэкспрессией в ответ на высокую температуру, значимых различий в экспрессии генов, вовлеченных в биосинтез пролин, не было. Эти результаты свидетельствуют о том, что повышение содержания пролина является непрямым и могло происходить вследствие других путей, в том числе разложения белков, как предполагали Becker и Fock, Photosynthesis Res. 8267 (1986).
В заключение необходимо отметить, что сверхэкспрессия OsMYB55 приводит к повышенной выносливости к высоким температурам у растений риса во время стадий вегетативного роста. Это ведет к увеличенной биомассе и, в случае последующего роста растений при нормальных условиях роста, к увеличенной продуктивности семян. Это свойство будет приобретать повышенное значение, поскольку во многих важных областях выращивания риса урожайность снижена из-за более высоких температур на фоне глобального потепления. Следовательно для облегчения решения этой проблемы очень важным является исследование различных генетических решений, связанных с получением урожая. Одним возможным решением является модулирование экспрессии OsMYB55, как самого по себе, так и в комбинации с другими генами.
Вышеизложенное является иллюстрацией настоящего изобретения и не подразумевает его ограничение. Настоящее изобретение определяется следующей формулой изобретения, в которую следует включать также и эквиваленты пунктов формулы изобретения.
Все публикации, патентные заявки, патенты, номера доступа в базах данных и другие источники литературы, цитируемые в данном документе, включены по ссылке во всей их полноте для объяснения идей, относящихся к предложению и/или абзацу, в котором приведен литературный источник.
ПЕРЕЧЕНЬ ПОСЛЕДОВАТЕЛЬНОСТЕЙ
<110> ЮНИВЕРСИТИ ОФ ГУЭЛФ
<120> СПОСОБЫ ПОВЫШЕНИЯ ВЫНОСЛИВОСТИ К ТЕПЛОВОМУ СТРЕССУ И СОДЕРЖАНИЯ
АМИНОКИСЛОТ В РАСТЕНИЯХ
<130> 9207-70WO
<150> US 61/610288
<151> 2012-03-13
<160> 35
<170> Patentln версия 3.5
<210> 1
<211> 2134
<212> ДНК
<213> Oryza sativa
cacacgatag ggacggctcg acggtagggg aggaggaata atgcaggcag gatgttacta 1440
tggccacgtt tagttggtta gtgtgacaaa aaatttttaa aagtatacag acatacataa 1500
5 tatatattta aagtattaaa ggtagactaa taacaaaata aattacagat ttcacatata 1560
aactgtgagg tgaatttatt aagtttaatt aatccttcat tagcaaatgt ttactgtagc 1620
atcacattgt caaatcatgg cgtaattaga ctcaaaagat tcgtttcgca atttacatgc 1680
aaactgtgca attggttttt ttccatattt aatgcttcat atatgtattc aaatatttga 1740
tgtgacggaa ttttttaaag tttaaattca aatatttgat gtgacggaat tttttaaagt 1800
15 ttgaagggaa ataaacacgg cctatggcgc aaaattgtac tacaaactcc ctttcgcgag 1860
acgagagaat gcaacgccgt gccgctctgg cggctggggc ccaaccgcga aaggcaatcc 1920
atccctctct ctccccgtcg cgtaaggccg ctataaatca acccgtcgcg ggttgcattg 1980
catcggtcgg tctcggtcgc tgccgtccct gtgcttggag tagacacgag ccggtgacgc 2040
gcatatcgtc ttctgctcga gatcgatcga tcgatcgctt ggttggttgc tgcgactgcg 2100
25 agggaggccg cgggtggtga ggaggattgt gcaa 2134
<210> 2 <211> 4061 30 <212> ДНК
<213> Oryza sativa
<400> 2
gatttggatg aacttgggtt gcatttgggc tttctatatg ggcctgaatt tgaatttcct 60
tgggatgcaa aattctctcg aggaaaaaag tacaccgaag gtccctcaac ttggcatcga 120
gttacaaaat cgtcccccaa ccacaaaacc ggatacaacg catcccccaa cttataaaac 180
40 cagtgcatac tgatcccggt tttagctgac atggcggctg actcagcgtg gaacccacgt 24 0
gggccccata tgtcaggatg ccacgtcggc cagcctctcc cttcctttcc tgtcccctcc 300
tttcgtctcg acttgttagg atgcaacgtc atcagcaggg cggccggcgg tggggagggg 360
gttgccaggg tgagaggtcc gacggccggc gggcgatgcg gcggcggcaa cgtggcggct 420
gagacacgag agaaggggaa ggcagcggac cagcgttgtg gcggagaggc ggcagcaggc 4 80
50 gtgcgagtgt cgtggcggag agggcggagg cggtagctgc ggcggagagg cgatggcggc 54 0
ggatgcgagc gtcgtggcgg agaggaggcg gcggcggcgg ctgccacgcg ggagggcagg 600
ccgaaggcga cggcgtgggc gagcgtggag gcacgcgacg gcgaggctgc cgctccgccc 660
gtcgcctctt ctctctcagg tttctcctcg tctgggtggg caggtcggcc ggcgggttgg 720
gaaggaaggg aaggggttgg ggtgatggct tgctggagct gcttcggctg cagccggtcg 780
60 atcgcagcag gaggcgaggt ccggctgccg gagccgttcc agctgccggc gcccttgccc 840
agctagccgc atggtctagg gacttgttcg ctttcatcgt tcttcgaatt ctctccccgt 900
ttcttcgtgt actgtttaat tggttcttaa tctgctcata aattaatcgt cgtcatctat 960
ggcctggatt gccggatagt atctttgtgc ttgtaaattt tcagcggcta tgcgagagct 1020
cgtgccaaat ttgatatgcg agagttttgt tgtttgtttc gccggcgacc gagcaggacg 1080
gattgaccct gcccaggatc atcaatacac ctaactcgtc tggtcaaagg caaaattgct
ataaatgaaa gggctaatat aacactcgca cacacacgat agggacggct cgacggtagg 10 tatggccacg tttagttggt tagtgtgaca aatatatatt taaagtatta aaggtagact taaactgtga ggtgaattta ttaagtttaa
gcatcacatt gtcaaatcat ggcgtaatta gcaaactgtg caattggttt ttttccatat 20 gatgtgacgg aattttttaa agtttaaatt gtttgaaggg aaataaaciic ggcctatggc agacgagaga atgcaacgcc gtgccgctct
ccatccctct ctctccccgt cgcgtaaggc tgcatcggtc ggtctcggtc gctgccgtcc 30 gcgcatatcg tcttctgctc gagatcgatc cgagggaggc cgcgggtggt gaggaggatt
35 <210> 3
<211> 10000
<212> ДНК
<213> Oryza sativa
40 <400> 3
gatttggatg aacttgggtt gcatttgggc
tgggatgcaa aattctctcg aggaaaaaag
45 gttacaaaat cgtcccccaa ccacaaaacc
cagtgcatac tgatcccggt tttagctgac
gggccccata tgtcaggatg ccacgtcggc
tttcgtctcg acttgttagg atgcaacgtc gttgccaggg tgagaggtcc gacggccggc 55 gagacacgag agaaggggaa ggcagcggac gtgcgagtgt cgtggcggag agggcggagg ggatgcgagc gtcgtggcgg agaggaggcg
ccgaaggcga cggcgtgggc gagcgtggag gtcgcctctt ctctctcagg tttctcctcg 65 gaaggaaggg aaggggttgg ggtgatggct atcgcagcag gaggcgaggt ccggctgccg
agctagccgc
: atggtctagg
' gacttgttcg
ctttcatcgt
tcttcgaatt
ctctccccgt
900
ttcttcgtgt
actgtttaat
tggttcttaa
tctgctcata
aattaatcgt
cgtcatctat
960
ggcctggatt
gccggatagt
atctttgtgc
ttgtaaattt
tcagcggcta
tgcgagagct
1020
cgtgccaaat
ttgatatgcg
agagttttgt
tgtttgtttc
gccggcgacc
gagcaggacg
1080
ggtccgggca
ccggagcgac
aggcaccgcg
cgccgtcgcc
caccgccacg
cggaaacgac
1140
cggtgatgcg
gcagccgcac
cggcctgccg
gaggaccggg
caaatggtgg
gcgaagcggg
1200
caacgacgcg
ggccggagtg
gccggccggc
ggtgggcagg
cacgctgcgg
gagaggaagg
1260
ggctgcggcg
gcaggggcgc
agaaggtcag
gccgcaccgg
caggcggctg
tcgacatcga
1320
ccatttagag
ggcagagaga
ggacaagaac
ggggagagga
gagagcggag
gcggatggcg
1380
ccgacgggga
gcgggatggg
gatagcaagg
ccgtcatcgc
cgtcgtcgtc
catggcgtgg
1440
ggaggccgcc
tccgctccgc
ctgtcgcctg
cctgccgccg
ccgacccgcc
tgcccaccgg
1500
ccgccgaacc
tcctcctctc
ccgcctcgcc
ccgtcggctt
cctccccaac
ccgtcggccg
1560
gcctgcccac
ccagacgagg
tgaaagctga
gagagaagag
gggaaagaga
gagatgacgt
1620
ggcatcctga
catgtgggtt
ccacgctgac
atgtgggttc
cacgctgagt
cagctgctac
1680
gtcggaaaaa
actgaggtca
aaaccgccga
gggacctagt
ttgccctggt
tttgtaagtt
1740
ggaggatgcg
ttgtatccgg
ttttgcggtt
ggaggacgat
tttgtaactc
gatgacaagt
1800
tgagggacct
tcggtgtact
ttttccttct
ctcgatgcca
ctggattggg
ccggtttgga
1860
ccaatttgcg
tgcattttga
gctttccatg
tgggccgtag
tttgcattcc
tttttttttt
1920
gagaaactac
cagaatgccc
gtatgttgca
acacgatttt
aattaattaa
agaaaatatc
1980
attaatctat
tattataatc
ttttaattca
attgatgtag
atatttgttc
ctgacttgtg
2040
gattttttta
gtctcacact
ctcccttttt
tttctttctc
atgggagtgg
tcgatatgtg
2100
cagcgtctaa
caccacatgt
cctttttctt
cgaaaaaaga
gttctccctt
ataactttta
2160
taaggagtat
agatagtttg
cattccttgc
ttgctgcttt
ttttatagat
ataatttgca
2220
tttccttgtt
gcactgatca
ttagctcatt
agttcatccc
atgaggacat
gatgacagta
2280
tgacactacc
cagaatgatt
atttttcact
taatatttgg
agatttatct
cgacgtcact
2340
gggtggcata
taagggatgc
gacaaacact
ccatatcaat
cgaggaattt
cctctcgtct
2400
tgaattatga
ctgatcatga
cttgtcatta
gagaagttaa
agaaaaagat
gggacttatc
2460
aggagagact
aaaaaaagag
tagccctacg
agtagtttag
tgtgttttgc
catactacca
2520
tgtgatggtg
atgtcaaaaa
catggggctc
gcgtaaccgc
aaaactaagg
ctgtcccaga
2580
cacactaatc
aaaagcattc
gaatttagaa
ctcctataat
ttgttagttt
gtttaatcac
2640
tctttgtgtc
tcatgatgat
tcatgcttgc
ataattgcat
acacttctcg
actctaagct
2700
tggaccacac
aacccgtaca
taggacgaaa
ccgaaagcat
cacccaaaaa
aaaaaaaact
2760
aatgtgcccc
tctttagcat
gtcagaataa
tatggaaaag
gcgtcgagca
gaaacaaata
2820
tgtcaagagt ¦
ttgacaaacc
tgacaactgc
caatgcagcc
aatgagccaa
gcagcaactt
2880
gttgatggct ggtaggcttt cccattatat tctggcaaaa actttgcttc catttttcta 2940 ttgacgacga tgagttcgcc gattccggcc gggccggctc agcttttctc cttcggctag 3000 5 cgtttggacg cacacttttg agagaatcga aacacggaga gaagtgctcc gatgcatgac 3060
acctcctttt ccacgtactt aacgccaaag ggaaacaatg atatgcagtg aacacaaagg 3120
gattgaccct gcccaggatc atcaatacac gttgaggctt cttcgtgtgt gaaagcatgg 3180
ctaactcgtc tggtcaaagg caaaattgct gctatcctaa aacaaatagt actaggataa 3240
ataaatgaaa gggctaatat aacactcgca cacacgcgag acgacaaaat ggagagctag 3300
15 cacacacgat agggacggct cgacggtagg ggaggaggaa taatgcaggc aggatgttac 3360
tatggccacg tttagttggt tagtgtgaca aaaaattttt aaaagtatac agacatacat 3420
aatatatatt taaagtatta aaggtagact aataacaaaa taaattacag atttcacata 3480
taaactgtga ggtgaattta ttaagtttaa ttaatccttc attagcaaat gtttactgta 354 0
gcatcacatt gtcaaatcat ggcgtaatta gactcaaaag attcgtttcg caatttacat 3600
25 gcaaactgtg caattggttt ttttccatat ttaatgcttc atatatgtat tcaaatattt 3660
gatgtgacgg aattttttaa agtttaaatt caaatatttg atgtgacgga attttttaaa 3720
gtttgaaggg aaataaacac ggcctatggc gcaaaattgt actacaaact ccctttcgcg 3780
agacgagaga atgcaacgcc gtgccgctct ggcggctggg gcccaaccgc gaaaggcaat 384 0
ccatccctct ctctccccgt cgcgtaaggc cgctataaat caacccgtcg cgggttgcat 3900
35 tgcatcggtc ggtctcggtc gctgccgtcc ctgtgcttgg agtagacacg agccggtgac 3960
gcgcatatcg tcttctgctc gagatcgatc gatcgatcgc ttggttggtt gctgcgactg 4020
cgagggaggc cgcgggtggt gaggaggatt gtgcaaaaaa aatggggcgc gcgccgtgct 4080
gcgacaaggc gagcgtgaag cgggggccgt ggtcgccgga ggaggacgag cagctgcgga 4140
gctacgtcca gagccacggc atcggcggca actggatcgc gctcccgcag aaagcaggtc 4200
45 ggtattagtg cactgctcgt cgtcgtcgat gctagccggt gatgaaacgc catgtttgta 4260
tgtgaattct gatgtctgcg tgttctcttg tgtgattcag ggctcaaccg ctgcggcaag 4320
agctgcaggc tccggtggct caactacctg aggccggaca tcaagcacgg cggctacacc 4 380
gagcaggagg accacatcat ctgctcgctc tacaactcga ttggaagcag gtgatgattt 4440
aagccggaga tgaatatttc ttttttcttt cactgatcct gttctgagtt cttgaactga 4500
55 ctctgtttgc gtgcgttgcc aggtggtcca tcatcgcgtc gaagctcccc ggccggactg 4560
acaacgacgt caagaactac tggaacacca agctcaagaa gaaagccatg ggcgccgtgc 4 620
agccgcgcgc cgccgcctcg gcgccgagcc aatgcacgtc gtcagcgatg gcgccggcgc 4680
tctcgccggc ctcctcgtcc gtcaccagct cgagcggcga cgcctgcttc gccgccgccg 4740
ccaccaccac caccaccatg tacccgccac cgacgacgcc gccgcagcag cagttcatcc 4800
65 gcttcgacgc accacccgcg gcggcggcgg cggcatcccc gaccgacctc gcgcccgtgc 4860
caccaccggc caccgtcacg gcggacggcg acggcggctg ggcgtccgac gccttgtccc 4 920
tcgacgacgt
: gttcctcggc
: gagctcacgg
ccggcgagcc
gctgttccct
tacgccgagc
4980
tgttcagcgg
cttcgccggc
gcggcgccgg
acagcaaggc
caccttggag
ctctcggcgt
5040
gctacttccc
: gaacatggcg
gagatgtggg
cggcctccga
ccacgcctac
gccaagccac
5100
agggtctctg
caacaccctg
acataggagg
acacgctaaa
acctccattg
aattcttgcg
5160
tagctgcgaa
cgcaacggcg
atcgatcgat
gcgtcgccac
ttgctactag
cataattctt
5220
gctctctttt
ttttttcaat
ttttttctct
tcttcgagtg
gcccattctc
tagctggcgt
5280
tttctcgtgt
attatgagtg
atcgattatt
acatgtaaat
taatccatag
atgtatctgc
5340
actgatccaa
attctccagc
gattacgctt
gtcagttcgt
acgcgatcca
tccgttggct
5400
tggctctccg
gtacaccgga
caagttagcg
cgtcccgaaa
acgatacgcc
cctgtctgtc
5460
tccctctcgc
cgagccgaag
tcacttcaca
tgtacagtgt
cacagtgaca
aatctgacga
5520
gacgaaatgt
taggtgaggc
acaagaggtt
cagaagaaca
acgtgtgcga
gacatggacc
5580
agttctcgtg
cggcgcgcac
gcacagtgtc
atggacttga
cccgttccgg
ttttcgaggg
5640
ccaatgggga
ggagaggcgt
gtggacggtt
ttctgtcacg
ttacacgtag
gagtattttt
5700
tttcctctca
ttttgttttt
gatttttgcc
cggtggcaag
ttgatcctga
tcgtatggcc
5760
tagggggcct
atgggccgtg
gatcacatgg
taattgggtg
tcattgttta
tttgggtagt
5820
ctcacttggg
gcatggatag
tgtctctttg
taaagtgatt
gaagacttca
agtgcacgac
5880
aaggacgagc
ctagttgacc
ctggaaatgg
agggaggatc
ggtttcgaag
aagcttcctt
5940
gacaattgtc
atgctcgtga
tgggctctat
acatatgatc
agaggagacc
tctagttaaa
6000
agtctctcta
actaattact
ccaaaaaaaa
gtctctctaa
ctttgctcat
tgtgggttta
6060
tcaatgtcta
ggcaaattaa
aaccatcaat
aataacatgt
taacagtact
taccttgttg
6120
gattttacta
gcttagtgta
cgccagggat
ccacacattt
tccaggtctt
cgtggtcggc
6180
atgagaaaat
ccggcaaaag
ccaagtagaa
caaggccaaa
ggatgggaaa
aagccagtgc
6240
aatcctccac
tgtagtttta
tttggaaagt
agatgaatat
ggattttttt
tataaaaaac
6300
aaacttttat
ttacatttga
aaacaaaccc
caaaataact
tattttacaa
ataaaccatt
6360
tgtggagaaa
acaacaggca
aggtcccctt
ataacgttgc
attttttcat
tttggtcttt
6420
taagacaatt
gagtcgaaaa
atcctatata
attcaaccta
ggttataagc
ggcatctact
6480
acacaacggt
aatggcagag
gattcacttc
caaggtgtac
atctatctgg
tttgtcaagc
6540
aaatctttaa
tttcgttgct
tgacattgtc
ttgcgaggga
tcaagtttca
gttttggtta
6600
aaaatatggc
accacatttt
ttttacttgt
tcttaatcac
tcttccccta
tgcgattgtt
6660
acttttaacc
atagttctct
ttatatagcg
tgtattaccc
gtcaacaacg
aggcgtctgt
6720
ggtgactttg
tcaatctcca
agatttaccg
gtccagcctt
caaagatgct
cataggggta
6780
gggtttgtgt
gcgtgcgttc
ataagggtga
gggtgcgtgt
gtgttgtgag
tgtctgcgtt
6840
gtattgtgta
gttctaaaaa
aaacgtaatt
ataaaaagac
agtgcaatta
cgtagtaaat
6900
ataggtaatt
tattgtgtaa
aaacgatttg
ataatatatt
ttgaaaaatg
tggtatgata
6960
aatatagcta gttccattaa gttttagtcc atgtttaaca tatatttgta cctcgttcgt 7020
gtttccttca tacgcatagc agtaacttat gttttgcatt ttacaaagca gttacgatga 7080
gtaggtcatt gtagctcatt tacatatgga gggttgtgat tttgttagta ccttgacatt 7140
gactcaaagc ggcacatctc ggcatcaaag gtaggtggca aaatgcattc gtcaaggaca 7200
aatagacaaa catgcattga tcgaatagtg ccttcagagc cgtggacttc tgcgttatca 7260
gttcgttgag gtatctcttt gatttgacat gagaaatgga ccatgtgaca gcaagaacga 7320
aatgcatgga tgcagtgtcc taactggata gcttgctcct ttcagaatta aaagctgctc 7380
15 acttgctagc tcagataagt gtcaagacat agtaacagtg tcttcagact ctgctttggt 7440
ttgttgctct aactgaagaa ttattgctca ccaaacggat aagcatatgc acatgtatca 7500
gcaaccggca ttcggttgga ccagtactga cgcagattgc aaacattgtt aactcctcgc 7560
gatgtctaac tgtcttgaaa acgtccttag aaatacttat accggtcaag atcacgagtg 7620
tattccaaat aattaatttc acctacatcg atgacagagg tgtcaactta aacatccata 7 680
25 gcttcacaat caagacttca aatgttttga tgcactagaa agcaaaatca gtaaccttta 7740
ctatgatcat atatcacaca cgaatggtgc agctgttagt gtaacaccac gtgttgagat 7800
ttgagaaagc aggcccaaat caatgcatta ttgtagctcc atttcactat atcaagtaat 7860
aatagtaatt tatatatatc gtagcagcga acatgtacca ttagattaaa atatgaaagg 7920
ctcagattca ttgcagttct ttagtgtgca cttgcaatat cgaagtgcac cctgatctca 7980
35 atccatcaca catgcacaca gactgttcat gtcatcgctg atgctgagtt ggtcgtgaaa 8040
tcggacgatt ccacgacggc aagtacagac acacgtcgat tgccggcaac cgcaagcaag 8100
tgcagtgcag ggtgcaagtg cagcagggcc cttggaaacg aagtcggaga gagaccatcc 8160
gcccatgcca tgtccatgtc cgtgtgtgtg cgctcgctgc tgttgtctct ttctgagctg 8220
gtactagtaa taaaaactag cccgaggatt attgcaagaa caaaaggtaa gcagcatctt 8280
45 gcagagcata ctatcaccca agctcttaaa gctgtcgggg aaaagggacc ctacgttact 834 0
cagatacata cggatacgcg atacgtcgat acggggatac gacattttcc ggatacgaca 8400
ttttccaaaa aaaacaagga tacggggata cgtatatata tatatatata tatattgaaa 84 60
acacacaaaa aaaattaagg aaattacatt aatatatatt aaaaatacaa aaaaaataag 8520
gagcttttat aaagaaaaag cgatataata ctagtattag tgtagccgat tccatatcaa 8580
55 tattttgcaa ttttcttttc tataagcaat tcaaattaac aagcgattaa gatcccaaaa 8640
actacatatt aatagttcaa tcatataact cttgatgact ttgcatcaac attagcagcc 8700
gcactaacca gtaaccacta gaattgctag atgcactagc acttgtatct aacaaaaacg 87 60
atagtacttt gtcctaagaa aaacaagaaa ggcccaacag attcaagcaa gaaatgttca 8820
aagagcatgg atttacccgg ccaggcactc aagcaaacaa tgaaaaagct ccttgctttg 8880
65 atgttgccag cggccagcct gccaccggcc tccgctatgc ccggcaacgg tcgtggcctc 8940
cgaggttggc ggcgaaggag atgcgccacc gcccagccgc ggcagctctt ccgtctcgcg 9000
gagaggacgt tgtggcccgc gcacggcaac caagcgcgct gctgcagccg cgtctctggt 9060
ggcatcgccg ggcacgcacg agagacagcc atcaggatgg gagcgtatga ggcggcgcat 9120
5 ccctgatgcg agcgaagacg gaggcacgtc gcggccgtat cgctggcata tctcgattta 9180
ttttgttttt ttaaatcgcg aatatgtggg atacgtacgg aatatgtatc ggaacatatc 9240
cgatatgtat ccgtatccgt tgccgtatca gatacggata cgtcgctctg tagccgtacc 9300
aggataacgt tgagttaggg acctaccttc agaaaatata tattcatgga tgctagtaca 9360
atccagagta gtgacttcaa aagctgaaga tctgagcttt ttgtaccgct aacaaactca 9420
15 gtttttttta aggctgtgtt tagtttctga gattagggag aagtttgggg aaagttggta 9480
aattagaaaa aaagttggga gtttatttaa gtatgaaagt tttgaatgtg atgtgatgga 9540
aagttgagag tttgggggaa gtttggtgtg aactaaatag ggcctaattt gttttagcat 9600
cccgtgaaac atttttgcta tttctatagg ccttgtttag ttccaaactt tttcttcaaa 9660
ctttcaactt ttccatcaca tcgttccaat ttcaaccaaa cttctaattt tggcgtgaac 9720
25 caaacttctc aattttctgt gtaacttttg gtctcggtta ttggatatcc tgatgcatca 9780
tgcattgact gtacatgtca taggtcttct attcattact agtacaatat acaggttttt 9840
tttgggataa acttggatgc tttgttcagc atctgccttt tctgtcttga ctcttggtac 9900
cgcttgtgaa catgtcgaca tgttgttcct gctgtttttt tttccttttc attttgaggc 9960
atgcgtcact aacttatgtt cgagtccatt tttcagcatt 10000
<210> 4
<211> 870
<212> ДНК
<213> Oryza sativa
<400> 4
atggggcgcg cgccgtgctg cgacaaggcg agcgtgaagc gggggccgtg gtcgccggag 60
gaggacgagc agctgcggag ctacgtccag agccacggca tcggcggcaa ctggatcgcg 120
ctcccgcaga aagcagggct caaccgctgc ggcaagagct gcaggctccg gtggctcaac 180
tacctgaggc cggacatcaa gcacggcggc tacaccgagc aggaggacca catcatctgc 240
50 tcgctctaca actcgattgg aagcaggtgg tccatcatcg cgtcgaagct ccccggccgg 300
actgacaacg acgtcaagaa ctactggaac accaagctca agaagaaagc catgggcgcc 360
gtgcagccgc gcgccgccgc ctcggcgccg agccaatgca cgtcgtcagc gatggcgccg 420
gcgctctcgc cggcctcctc gtccgtcacc agctcgagcg gcgacgcctg cttcgccgcc 4 80
gccgccacca ccaccaccac catgtacccg ccaccgacga cgccgccgca gcagcagttc 540
60 atccgcttcg acgcaccacc cgcggcggcg gcggcggcat ccccgaccga cctcgcgccc 600
gtgccaccac cggccaccgt cacggcggac ggcgacggcg gctgggcgtc cgacgccttg 660
tccctcgacg acgtgttcct: cggcgagctc acggccggcg agccgctgtt cccttacgcc 720
gagctgttca gcggcttcgc cggcgcggcg ccggacagca aggccacctt ggagctctcg 780
gcgtgctact tcccgaacat ggcggagatg tgggcggcct ccgaccacgc ctacgccaag 840
ccacagggtc tctgcaacac cctgacatag
<210> 5
<211> 289
<212> БЕЛОК
<213> Oryza sativa
<400> 5
Met Gly Arg Ala Pro Cys Cys Asp Lys Ala Ser Val Lys Arg Gly Pro
15 10 15
Trp Ser Pro Glu Glu Asp Glu Gin Leu Arg Ser Tyr Val Gin Ser His
20 25 30
Gly lie Gly Gly Asn Trp He Ala Leu Pro Gin Lys Ala Gly Leu Asn
35 40 45
Arg Cys Gly Lys Ser Cys Arg Leu Arg Trp Leu Asn Tyr Leu Arg Pro
50 55 60
Asp He Lys His Gly Gly Tyr Thr Glu Gin Glu Asp His He He Cys
65 70 75 80
Ser Leu Tyr Asn Ser He Gly Ser Arg Trp Ser He He Ala Ser Lys
85 90 95
Leu Pro Gly Arg Thr Asp Asn Asp Val Lys Asn Tyr Trp Asn Thr Lys
100 105 110
Leu Lys Lys Lys Ala Met Gly Ala Val Gin Pro Arg Ala Ala Ala Ser
115 120 125
Ala Pro Ser Gin Cys Thr Ser Ser Ala Met Ala Pro Ala Leu Ser Pro
130 135 140
Ala Ser Ser Ser Val Thr Ser Ser Ser Gly Asp Ala Cys Phe Ala Ala
145 150 155 160
Ala Ala Thr Thr Thr Thr Thr Met Tyr Pro Pro Pro Thr Thr Pro Pro
165 170 175
Gin Gin Gin Phe He Arg Phe Asp Ala Pro Pro Ala Ala Ala Ala Ala
180 185 190
Ala Ser Pro Thr Asp Leu Ala Pro Val Pro Pro Pro Ala Thr Val Thr
195 200 205
Ala Asp Gly Asp Gly Gly Trp Ala Ser Asp Ala Leu Ser Leu Asp Asp
210 215 220
Val Phe Leu Gly Glu Leu Thr Ala Gly Glu Pro Leu Phe Pro Tyr Ala
225 230 235 240
Glu Leu Phe Ser Gly Phe Ala Gly Ala Ala Pro Asp Ser Lys Ala Thr
245 250 255
Leu Glu Leu Ser Ala Cys Tyr Phe Pro Asn Met Ala Glu Met Trp Ala
260 265 270
Ala Ser Asp His Ala Tyr Ala Lys Pro Gin Gly Leu Cys Asn Thr Leu
275 280 285
Thr
<210> 6
<211> 289
<212> БЕЛОК
<213> Sorghum bicolor
<400> 6
Met Gly Arg Ala Pro Cys Cys Asp Lys Ala Ser Val Lys Arg Gly Pro
15 10 15
Trp Ser Pro Glu Glu Asp Glu Gin Leu Arg Ser Tyr Val Gin Arg Asn
20 25 30
Gly He Gly Gly Asn Trp He Ala Leu Pro Gin Lys Ala Gly Leu Asn
35 40 45
Arg Cys Gly Lys Ser Cys Arg Leu Arg Trp Leu Asn Tyr Leu Arg Pro
50 55 60
Asp He Lys His Gly Gly Tyr Thr Glu Glu Glu Asp Arg He He Trp
65 70 75 80
Ser Leu Tyr Ser Ser He Gly Ser Arg Trp Ser He He Ala Ser Lys
85 90 95
Leu Pro Gly Arg Thr Asp Asn Asp Val Lys Asn Tyr Trp Asn Thr Lys
100 105 110
Leu Lys Lys Lys Ala Met Ala Met Ala Ala Ala Ala Gly Leu Ser Ala
115 120 125
Ser Ser Ser Gly Gly Gly Ala Phe Ala Ala Ala Ala Ala Pro Ala Thr
130 135 140
Pro Thr Pro Pro Ala Leu Ser Pro Ala Ser Ser Ser Val Thr Ser Ser
145 150 155 160
Ser Gly Asp Val Arg Phe Gly Ala Ala Tyr Thr Glu Pro Gin Pro Gin
165 170 175
Pro Gin His Pro Gly Gly Leu He Arg Phe Asp Ala Pro Arg Thr Glu
180 185 190
Leu Ala Pro Val Pro Pro Ala Val Gly Ala Gin Leu Asp Gly Ala Trp
195 200 205
Ser Thr Pro Val Ala Pro Ala Leu Asp Gly Gly Asp Val Phe Leu Pro
210 215 220
Glu Leu He Gly Gly Gly Glu Gin Leu Phe Pro Tyr Gly Gly Asp Phe
225 230 235 240
Phe Gly Gly Leu Leu Gin Asp Ser Arg Ala Leu Glu Gin Leu Ser Ala
245 250 255
Cys Tyr Phe Pro Asn Met Ala Glu He Trp Gly Ala Thr Ala Ala Val
260 265 270
Ala Ala Pro Asp Gly Asn Cys Lys Pro Pro Gly Leu Cys Asn Thr Leu
275 280 285
Thr
<210> 7
<211> 262
<212> БЕЛОК
<213> Zea mays
<400> 7
Met Gly Arg Ala Pro Cys Cys Asp Lys Ala Ser Val Lys Arg Gly Pro
15 10 15
Trp Ser Pro Glu Glu Asp Glu Gin Leu Arg Ser Tyr Val Gin Leu Asn
20 25 30
Gly He Gly Gly Asn Trp He Ala Leu Pro Gin Lys Ala Gly Leu Asn
35 40 45
Arg Cys Gly Lys Ser Cys Arg Leu Arg Trp Leu Asn Tyr Leu Arg Pro
50 55 60
Asn He Lys His Gly Gly Tyr Thr Asp Glu Glu Asp Arg He He Trp
65 70 75 80
Ser Leu Tyr Ser Ser He Gly Ser Arg Trp Ser lie He Ala Ser Lys
85 90 95
Leu Pro Gly Arg Thr Asp Asn Asp Val Lys Asn Tyr Trp Asn Thr Lys
100 105 110
Leu Lys Lys Lys Ala Met Ala Ala Ser Ser Ser Gly Ala Ala Phe Ala
115 120 125
Ala Pro Ala Thr Pro Ala Leu Ser Pro Ala Ser Ser Cys Val Thr Ser
130 135 140
Ser Ser Ser Gly Asp Val Arg Leu Gly Ala Ala Tyr Thr Glu Pro Pro
145 150 155 160
Pro Pro Arg Gin His Ala Gly Leu Val Arg Ser Asp Ala Pro Arg Thr
165 170 175
Glu Leu Ala Pro Val Pro Ala Val Ala His Leu Asp Gly Ala Cys Trp
180 185 190
Pro Ala Ala Ala Ala Leu Asp Val Leu Leu Pro Glu Leu Gly Gly Glu
195 200 205
Gin Leu Phe Pro Tyr Gly Tyr Gly Asp Phe Phe Gly Gly Leu Gin Asp
210 215 220
Arg Ala Leu Glu Gin Gin Leu Ser Ser Cys Tyr Phe Pro Asn Val Ala
225 230 235 240
Glu He Trp Gly Ala Ala Ala Val Ala Pro Asp Gly Lys Pro Pro Gly
245 250 255
Leu Cys Asn Arg Leu Thr 260
<210> 8
<211> 259
<212> БЕЛОК
<213> Vitis vinifera
<400> 8
Met Gly Arg Ala Pro Cys Cys Asp Lys Ala Asn Val Lys Arg Gly Pro
15 10 15
Trp Ser Pro Glu Glu Asp Ala Thr Leu Arg Asn Tyr Val Gin Thr His
20 25 30
Gly He Gly Gly Asn Trp He Ala Leu Pro Arg Lys Ala Gly Leu Arg
35 40 45
Arg Cys Gly Lys Ser Cys Arg Leu Arg Trp Leu Asn Tyr Leu Arg Pro
50 55 60
Asp He Lys His Gly Gly Phe Thr Glu Glu Glu Asp Lys Val He Cys
65 70 75 80
Ala He Tyr Asn Gin Met Gly Ser Arg Trp Ser Val He Ala Ser Gin
85 90 95
Leu Pro Gly Arg Thr Asp Asn Asp Val Lys Asn Tyr Trp Asn Thr Lys
100 105 110
Leu Lys Lys Lys Leu Ala Lys Phe His Ser Asn Gly Asn Ala Ala Asn
115 120 125
Asn Pro Asn Pro Phe Ser Ser Ala Pro Pro Pro Thr Ala Ala Pro Met
130 135 140
Pro Val Thr Glu Ala Tyr Arg His Gly Phe Pro Pro Leu Leu Thr Gin
145 150 155 160
Gly Tyr Thr Gly Thr Ser Asn Asn Met Gly Val Ser Glu Phe Gly Ala
165 170 175
Ser Ser Asn Asn Gly His Asn Val Phe He Ser Asp Gin Gly Gly Leu
180 185 190
Ser Thr Asp His Ala Thr Gly He Ser Tyr Val Ser Tyr Leu Pro Gly
195 200 205
Thr Arg Gly Gly Glu Asp Asp Gly Val Leu Met Asp Phe Gly Met Gly
210 215 220
Asn Leu Pro Tyr Asp He He Ser Gly Phe Trp Phe Gin Glu Lys Asp
225 230 235 240
Ser Thr Glu Val Thr Pro Gly His Asp Gin Ser Arg Phe Leu Leu He
245 250 255
Asp Gly Asn
<210> 9 <211> 302 <212> БЕЛОК
<213> Populus trichocarps <400> 9
Met Gly Arg Ala Pro Cys Cys Asp Lys Ala Asn Val Lys Arg Gly Pro
15 10 15
Trp Ser Pro Glu Glu Asp Ala Thr Leu Lys Ser Tyr Leu Glu Thr His
20 25 30
Gly Thr Gly Gly Asn Trp He Ala Leu Pro Gin Lys Ala Gly Leu Lys
35 40 45
Arg Cys Gly Lys Ser Cys Arg Leu Arg Trp Leu Asn Tyr Leu Arg Pro
50 55 60
Asp He Lys His Gly Gly Phe Thr Glu Glu Glu Asp Asn He He Cys
65 70 75 80
Thr Leu Tyr Ser Gin Met Gly Ser Arg Trp Ser Leu He Ala Ala Gin
85 90 95
Leu Pro Gly Arg Thr Asp Asn Asp Val Lys Asn Tyr Trp Asn Thr Lys
100 105 110
Leu Lys Lys Lys He Leu Ala Gly Lys He Ser Leu Thr He Lys Asn
115 .. 120 125
Asn Pro He Asn Ala Pro Val Asn Val Ala Asn He Pro Ala He Pro
130 135 140
Cys Ser Thr Ser Pro He Leu Tyr Val Pro Lys Ala Glu Thr Glu Ser
145 150 155 160
Ser Val Thr Phe Ser Asp His Tyr Ser Leu Thr Gin He Ser Gly Thr
165 170 175
Leu Pro Ala Leu Ser Asp He Gly Tyr Glu Pro He He Asn Ser Thr
180 185 190
Ala Gin Asn Leu Ser Pro Asn Gin Phe Gin Phe Ser Ser Phe Pro Gly
195 200 205
Val He Asp Met Ser Glu Phe Ser Met Asn Ser Thr His He Val Ser
210 215 220
Pro Ser Gin Glu Gly Ser Ser He Ser Asp Ser Ser Ser Leu Ala Met
225 230 235 240
Asp Asn Lys Gly Leu Ser Val Pro Ser Thr Asn Gly Gly Leu Glu Asp
245 250 255
Val Gly He Phe Met Asp Ser Glu Pro Gly Phe Pro Ser Asp Phe Phe
260 265 270
Asn Gly Leu Leu Leu Gin Asp Lys Ala Ser Glu Val Ala Thr Asn Cys
275 280 285
Tyr Gin Tyr Phe Ala Gly Phe Gly Tyr Val Asp He Lys Pro
290 295 300
<210> 10
<211> 348
<212> БЕЛОК
<213> Malus x domestica
<400> 10
Met Gly Arg Ala Pro Cys Cys Asp Lys Ala Asn Val Lys Lys Gly Pro
15 10 15
Trp Ser Pro Glu Glu Asp Ser Lys Leu Lys Glu Tyr He Glu Lys Tyr
20 25 30
Gly Thr Gly Gly Asn Trp He Ala Leu Pro Gin Lys Ala Gly Leu Lys
35 40 45
Arg Cys Gly Lys Ser Cys Arg Leu Arg Trp Leu Asn Tyr Leu Arg Pro
50 55 60
Asn He Lys His Gly Glu Phe Ser Asp Glu Glu Asp Arg He He Cys
65 70 75 80
Ser Leu Phe Ala Ser He Gly Ser Arg Trp Ser Val He Ala Ala Gin
85 90 95
Leu Pro Gly Arg Thr Asp Asn Asp He Lys Asn Tyr Trp Asn Thr Lys
100 105 110
Leu Lys Lys Lys Leu Met Gly Met His Met Gly Pro Pro Arg Pro His
115 120 125
Asn His His Lys Asn Leu Leu Lys Pro Pro Pro Phe Pro Ser Ser Ser
130 135 140
His His Asn Tyr Gin Asn Gin Pro Leu He Pro Ser Glu Pro Leu Ser
145 150 155 160
Ser Leu Tyr Lys Asp Leu Ser Asn Tyr Asn Arg Ser Phe Leu Gly Phe
165 170 175
Glu Ala Pro Val Pro Leu Pro Pro Gin Val Ser Leu Thr Ser Asn Asn
180 185 190
Phe Ser Asn He Ser Thr Asn Ser Ser He Phe Gin Thr Leu Asn Tyr
195 200 205
Pro Ala Gly Val Lys Glu Asn Asn Asn Asn Asn Thr Leu Leu Val Phe
210 215 220
Gly Ser Glu Gly Ser Cys Ser Thr Ser Ser Asp Gly Ser Cys Asn Asn
225 230 235 240
Gin He Ser Tyr Asp Tyr Cys Ser Arg Ser Glu He Asn Asn He Asn
245 250 255
Gin Glu Glu Met Gly Phe Asp His Gin Gly Phe Met Met Leu Asn Tyr
260 265 270
Gly Asn Gin Trp Thr Glu Arg Pro Asn Gly Phe Tyr Phe Gly Ser Glu
275 280 285
Asn Asn Thr Leu Glu Phe Thr Asp Leu Asp Glu Asp Val Lys Gin Gin
290 295 300
Leu He Ser Thr Arg Ser Lys Asn Asn Tyr Asn Asn Asn Thr He He
305 310 315 320
Asn Glu Ser Ser Lys Ser Asn Ser Phe Leu Phe Asn Val Asn Glu Ser
325 330 335
Lys Thr Glu Asp Asp Glu Lys Val Met Tyr Phe Tvr 340 345
<210> 11
<211> 193
<212> БЕЛОК
<213> Glycine max
<400> 11
Met Gly Arg Ala Pro Cys Cys Asp Lys Ala Asn Val Lys Lys Gly Pro
15 10 15
Trp Ser Pro Glu Glu Asp Ala Lys Leu Lys Ser Tyr He Glu Gin His
20 25 30
Gly Thr Gly Gly Asn Trp He Ala Leu Pro Gin Lys He Gly Leu Lys
35 40 45
Arg Cys Gly Lys Ser Cys Arg Leu Lys Trp Leu Asn Tyr Leu Arg Pro
50 55 60
Asn He Lys His Gly Gly Phe Ser Glu Glu Glu Asp Asn He He Cys
65 70 75 80
Ser Leu Tyr Val Ser He Gly Ser Arg Trp Ser He He Ala Ala Gin
85 90 95
Leu Pro Gly Arg Thr Asp Asn Asp He Lys Asn Tyr Trp Asn Thr Arg
100 105 110
Leu Lys Lys Lys Leu Leu Gly Lys Gin Arg Lys Glu Gin Gin Ala Gin
115 120 125
Ala Arg Arg Val Ser Asn Asn Gin Gin Lys Gin Asp Val Lys Arg Glu
130 135 140
Thr Glu Asn Leu He Val Ala Ser Glu Val Met He Asn Gin Val Pro
145 150 155 160
Tyr Trp Ser Ser Ser Glu Phe Ser Ser Val Pro Met Pro Val Thr Asn
165 170 175
Ala Ser Ser Phe Gin His Tyr Gly Leu Asn Asn Gin Thr Ser Leu Arg
180 185 190
Ala
<210> 12
<211> 313
<212> БЕЛОК
<213> Daucus carota
<400> 12
Met Gly Arg Ala Pro Cys Cys Asp Lys Ala Ser Val Lys Arg Gly Pro
15 10 15
Trp Ser Pro Glu Glu Asp Gin Lys Leu Lys Asp Tyr He Glu Lys His
20 25 30
Gly Thr Gly Gly Asn Trp He Ala Leu Pro Gin Lys Ala Gly Leu Arg
35 40 45
Arg Cys Gly Lys Ser Cys Arg Leu Arg Trp Leu Asn Tyr Leu Arg Pro
50 55 60
Asn He Lys His Gly Glu Phe Ser Asp Asp Glu Asp Arg He He Cys
65 70 75 80
Thr Leu Phe Ala Asn He Gly Ser Arg Trp Ser He He Ala Gly Gin
85 90 95
Leu Pro Gly Arg Thr Asp Asn Asp He Lys Asn Tyr Trp Asn Thr Lys
100 105 110
Leu Lys Lys Lys Leu Leu Met Ser Ser Leu Met Leu Pro Asn Pro Phe
115 120 125
Val Arg Pro Pro Asn Asn He Asn Asn Tyr Gin Gin Tyr Leu Leu Ser
130 135 140
Ser Pro Ser Pro Ser Ser Tyr Ser Ser Pro Leu Pro Pro Thr Leu Arg
145 150 155 160
Leu Cys Asp Asn Asn Tyr Pro Thr Leu Gly Ala Ser Arg Ser Phe Thr
165 170 175
Ser Glu Gly Phe Ser Asn He Ser Thr Asn Leu Phe Asn He Gin Pro
180 185 190
Gin Asp Gin Gly Leu Gly Pro Met Gin Asn Tyr Gin Glu Lys Glu Ser
195 200 205
Pro Leu He Met Phe Gly Gly Ala Gly Asp Asp Gin Gin Ala Ala Ser
210 215 220
Ser Ser Ser Tyr Asp Glu His Phe Met Met Phe Ser Asn Cys Gly Met
225 230 235 240
Asn Asn He Ser Asp Gin Gin Lys Gin Val Asn Leu Gly Val Ser Ser
245 250 255
Gly Asp His Glu He Val Ser Asn Val Leu Asp Gin Tyr Asn Met Ser
260 265 270
Cys Val Glu Glu He Lys Gin Leu He Ser Thr Thr Asn Leu Ser Cys
275 280 285
Asn Ser Asn Leu Ser Phe Phe Val Asp Glu Asn Lys Thr Val Arg Ser
290 295 300
Glu Glu Glu Lys Val Leu Met Tyr Tyr 305 310
<210> 13 <211> 333 <212> БЕЛОК
<213> Arabidopsis thaliana <400> 13
Met Gly Arg Ala Pro Cys Cys Asp Lys Ala Asn Val Lys Lys Gly Pro
15 10 15
Trp Ser Pro Glu Glu Asp Val Lys Leu Lys Asp Tyr He Asp Lys Tyr
20 25 30
Gly Thr Gly Gly Asn Trp He Ala Leu Pro Gin Lys He Gly Leu Lys
35 40 45
Arg Cys Gly Lys Ser Cys Arg Leu Arg Trp Leu Asn Tyr Leu Arg Pro
50 55 60
Asn He Lys His Gly Gly Phe Ser Glu Glu Glu Asp Arg He He Leu
65 70 75 80
Ser Leu Tyr He Ser He Gly Ser Arg Trp Ser He He Ala Ala Gin
85 90 95
Leu Pro Gly Arg Thr Asp Asn Asp He Lys Asn Tyr Trp Asn Thr Lys
100 105 110
Leu Lys Lys Lys Leu Leu Gly Arg Gin Lys Gin Met Asn Arg Gin Asp
115 120 125
Ser He Thr Asp Ser Thr Glu Asn Asn Leu Ser Asn Asn Asn Asn Asn
130 135 140
Lys Ser Pro Gin Asn Leu Ser Asn Ser Ala Leu Glu Arg Leu Gin Leu
145 150 155 160
His Met Gin Leu Gin Asn Leu Gin Ser Pro Phe Ser Ser Phe Tyr Asn
165 170 175
Asn Pro He Leu Trp Pro Lys Leu His Pro Leu Leu Gin Ser Thr Thr
180 185 190
Thr Asn Gin Asn Pro Lys Leu Ala Ser Gin Glu Ser Phe His Pro Leu
195 200 205
Gly Val Asn Val Asp His Gin His Asn Asn Thr Lys Leu Ala Gin He
210 215 220
Asn Asn Gly Ala Ser Ser Leu Tyr Ser Glu Asn Val Glu Gin Ser Gin
225 230 235 240
Asn Pro Ala His Glu Phe Gin Pro Asn Phe Gly Phe Ser Gin Asp Leu
245 250 255
Arg Leu Asp Asn His Asn Met Asp Phe Met Asn Arg Gly Val Ser Lys
260 265 270
Glu Leu Phe Gin Val Gly Asn Glu Phe Glu Leu Thr Asn Gly Ser Ser
275 280 285
Trp Trp Ser Glu Glu Val Glu Leu Glu Arg Lys Thr Thr Ser Ser Ser
290 295 300
Ser Trp Gly Ser Ala Ser Val Leu Asp Gin Thr Thr Glu Gly Met Val
305 310 315 320
Met Leu Gin Asp Tyr Ala Gin Met Ser Tyr His Ser Val 325 330
<210> 14 <211> 870 <212> ДНК
<213> Sorghum bicolor <400> 14
atggggcgcg cgccgtgctg cgacaaggcg agcgtgaagc ggggaccctg gtcgcctgag gaggacgagc agctgcggag ctacgtccag cgcaacggca tcggcggcaa ctggatcgcc ctgccgcaga aagcaggcct gaaccggtgc ggcaagagct gccggctgcg gtggctcaac
tacctgcggc cggacatcaa gcacgggggc tacaccgagg aggaggaccg gatcatctgg 240
tcgctctaca gctccatcgg cagcaggtgg tccatcatcg cgtccaagct cccgggccgg 300
accgacaacg acgtcaagaa ctactggaac accaagctca agaagaaggc catggccatg 360
gcggcggcgg ccggcctcag cgccagtagc agcggaggag gagccttcgc ggcggcggcg 420
gcgcccgcca cgccgacgcc gccggcgctc tcgcccgcct cctcgtccgt caccagctcc 4 80
agcggcgacg tgcgcttcgg cgcggcgtac acggaaccac aaccgcagcc gcagcacccc 540
ggcgggctca tacgcttcga cgcgccgcgg acggagctcg cgcccgtgcc gccggcagtg 600
15 ggagcgcagc tggacggcgc ctggtcgacg cccgtggcgc cggcgctgga cggcggggac 660
gtgttcctgc ccgagctcat cggcggcggc gagcagctgt tcccgtacgg cggcgacttc 720
ttcggcgggc tgctgcagga cagcagggcc ctggagcagc tctcggcgtg ctacttcccc 780
aacatggccg agatatgggg cgccaccgct gccgtcgccg cccccgacgg caactgcaag 840
ccgccgggtc tctgcaacac cctgacatag 870
<210> 15 <211> 789 <212> ДНК <213> Zea mays
<400> 15
atgggccgcg cgccgtgctg cgacaaggcg agcgtgaagc gggggccctg gtcgcccgag 60
gaggacgagc agctgcggag ctacgtccag ctgaacggca tcggcggcaa ctggatcgcc 120
ctgccgcaga aagcagggct gaaccggtgt ggcaagagtt gccggctgcg gtggctcaac 180
tacctgcggc cgaacatcaa gcacggcggc tacaccgacg aggaggaccg gatcatttgg 240
40 tcgctctaca gctccatcgg cagcaggtgg tcgatcatcg cgtccaagct ccccggccgg 300
accgataacg acgtcaagaa ctactggaac accaagctca agaagaaggc catggcggcc 360
agtagcagcg gagcagcctt cgcggcgccc gccacgccgg cgctctcgcc cgcctcctcg 420
tgcgtcacca gctcctccag cggcgacgtg cgcctcggcg cagcgtacac ggagccgccg 480
ccgcctcggc agcacgcggg gctcgtacgc tctgacgctc cgcggacgga gctcgcgccc 54 0
50 gtgccggcag tcgcgcacct ggacggcgcc tgctggccgg ccgcggcggc gctggacgtg 600
ctcctgcccg agctcggcgg cgagcagctg ttcccgtacg ggtacggcga cttcttcggc 660
gggctgcagg acagggccct ggagcagcag ctctcgtcgt gctacttccc caacgtggcc 720
gagatatggg gcgccgctgc cgtcgccccc gacggcaagc cgccgggtct ctgcaacagg 780
ctgacgtag 789
<210> 16 <211> 909 <212> ДНК
<213> Populus trichocarps <400> 16
atggggagag ctccttgttg tgacaaagca aacgtgaaaa gaggaccatg gtctcctgag 60
gaagatgcca ctctcaaaag ctaccttgag actcatggca ctggtggtaa ctggattgct 120
ttgcctcaaa aagctggcct taagcgatgc ggcaagagct gccggttacg atggcttaat 180
tatctcagac cagacatcaa acatggaggc tttactgaag aagaagacaa catcatatgc 24 0
actctctata gtcaaatggg aagcagatgg tctctcatag ctgctcaact gcctggaaga 300
actgacaacg atgtgaaaaa ttactggaac accaaattga aaaagaagat tcttgcggga 360
aaaataagcc tcacaatcaa gaacaaccct atcaatgccc ccgttaacgt tgctaatatt 420
cctgccattc cctgctcaac atctcctatt ctttatgtcc ctaaagctga aaccgaaagt 480
15 tctgtcacct tctccgatca ttattcatta actcaaattt caggaacatt gcctgcctta 540
tctgatattg gttatgaacc tattatcaat agcactgccc agaacttgag tccaaaccaa 600
ttccaatttt ctagtttccc tggggtcatt gacatgtctg aattttcaat gaacagtact 660
cacattgttt ctccatctca agaaggttcg agcatttcag attcctcttc acttgctatg 720
gataacaagg gtctctcagt gcctagtact aacggtggtc ttgaggatgt tgggatattt 780
25 atggattccg aacctggttt tcctagtgat tttttcaatg gccttttgct tcaagacaaa 84 0
gctagtgaag tggccactaa ttgctaccaa tattttgctg gttttggcta tgttgatatt 900
aagccgtaa 909
<210> 17 <211> 1047 <212> ДНК 35 <213> Malus x domestica
<400> 17
atggggaggg ctccttgttg tgacaaagca aacgtgaaga agggaccatg gtcaccagaa 60
40 gaagattcaa agctaaaaga gtacatagag aagtatggga ctggtgggaa ttggattgct 120
ctcccacaga aagctggtct gaagagatgt gggaaaagct gcagattgag atggcttaac 180
tatctgaggc caaacatcaa acatggagaa ttctctgatg aggaagacag gataatatgc 240
agcctctttg ctagtattgg aagcaggtgg tcagttatag ctgctcagct gccaggcagg 300
actgacaacg atatcaagaa ctactggaac accaagctca agaagaagct catggggatg 360
50 catatgggtc ctcctcgacc tcacaaccac cataaaaatt tactaaagcc tcccccattt 420
ccttcttcct ctcatcacaa ttaccaaaac caaccattaa ttccatctga acctctatcg 480
tcgctgtaca aagacctaag caattacaac agatctttct tagggtttga agcgccagtg 540
ccattgccac cacaagtttc gctgacgtcc aataatttct caaacatttc caccaactct 600
tctatttttc aaaccctaaa ttacccagct ggagtgaagg aaaataacaa taataatacc 660
ctcctcgtgt ttggaagtga agggagttgc agtacttcgt ctgatggaag ctgtaataat 720
cagatcagct atgactactg cagcagatca gagattaata acatcaacca agaagaaatg 780
65 ggttttgatc atcagggctt catgatgctt aactatggca accaatggac cgaaaggcca 840
aatgggtttt attttggatc agaaaacaac acattagaat ttactgatct ggacgaagat 900
gttaagcagc agctgattag tactagaagt aaaaataatt ataataataa tactattata 960 aatgagtcct ctaagtctaa cagcttttta ttcaatgtta atgaaagcaa gacagaagat 1020 5 gatgagaagg tcatgtattt ctactga 1047
<210> 18
<211> 582
10 <212> ДНК
<213> Glycine max
<400> 18
atgggaagag ctccttgctg tgacaaagcc aacgtgaaga aaggtccatg gtcacctgaa 60
gaagatgcca aactcaagtc ttatattgag cagcatggca ctggtggaaa ctggattgcc 120
ttgccccaga aaataggcct taagaggtgt gggaaaagct gtcgtcttaa atggctgaat 180
20 tatcttcgcc caaacatcaa acatgggggt ttctcagaag aagaagacaa catcatctgc 24 0
agcctctatg ttagtattgg aagcaggtgg tcaattatag cagcacagtt acccgggcgc 300
acagacaatg atataaagaa ctattggaac actaggctga agaagaagct ccttggcaaa 360
caaaggaagg agcaacaggc tcaagctcgc cgagtcagca acaaccagca gaagcaagat 420
gtcaaaagag aaaccgagaa tttgatagtg gcttctgaag tcatgatcaa tcaagttccc 480
30 tattggtctt cttcagagtt ttcttctgtg cctatgccag tgaccaatgc ttcttcattt 54 0
caacactatg gtctgaacaa tcaaacatct ctcagagcat ga 582
35 <210> 19
<211> 942
<212> ДНК
<213> Daucus carota
40 <400> 19
atggggagag ctccttgctg tgacaaggca agtgtaaaga gagggccatg gtcacctgaa 60
gaagatcaga agctaaaaga ctatatagag aagcatggga ctggaggaaa ctggattgct 120
45 ctaccacaaa aggctggtct tagaagatgt gggaaaagct gcagattaag atggctcaac 180
tatctcaggc ctaacattaa acatggagaa ttttcagatg atgaagatag gatcatatgc 240
accctctttg ccaatattqg gagcaggtgg tcaataatag caggtcagtt accagggagg 300
actgacaatg atatcaagaa ctactggaac accaagctca agaagaaact cctcatgtct 360
tcattaatgc tccctaatcc ttttgttagg cctcctaata atattaataa ctaccaacaa 420
55 tacctattat catcaccatc tccttcttca tattcctccc cattgcctcc aacattgaga 480
ctttgtgaca acaattaccc aaccctaggt gcttctaggt cattcacaag tgagggcttc 540
tcaaatattt caacaaacct ctttaatatc cagcctcaag atcagggttt gggtcccatg 600
caaaattatc aagagaaaga atcacctctc attatgtttg gaggggcagg tgatgatcag 660
caagctgcta gctctagttc ttatgatgaa catttcatga tgttctccaa ctgtgggatg 720
aataatattt ctgatcaaca gaagcaagta aatcttggtg tgtctagtgg tgatcatgag 780 attgttagca atgtactgga tcagtataac atgagctgtg ttgaggagat taagcaactg 840
attagcacta ctaatctgtc atgtaattct aatctgagtt tctttgttga tgaaaacaag 900 acagtgagaa gtgaggagga gaaagtgttg atgtactact ga 942
<210> 20 <211> 1002 <212> ДНК 10 <213> Arabidopsis thaliana
<400> 20
atgggaagag ctccatgctg cgacaaggca aacgtgaaga aaggaccatg gtcaccggaa 60
15 gaagatgtga agctcaagga ttacatcgac aaatatggca ctggtggcaa ctggatcgca 120
ctgcctcaga aaattgggct gaagagatgt ggtaagagtt gcagactgag atggcttaat 180
tacttaagac caaacatcaa acatggtggt ttttctgagg aagaagatag aatcatcttg 240
agtctctaca ttagcattgg aagccggtgg tccataattg cagctcagct tcctggaagg 300
actgacaatg atatcaagaa ttattggaac acaaaactga agaagaaact tctaggaaga 360
25 cagaaacaaa tgaatcgtca agactccata accgattcta ctgagaacaa cctcagcaac 420
aataacaaca ataagagtcc tcagaatctg agcaattcgg cactggagag gctccagctt 480
cacatgcagc ttcagaatct acagagccct ttctctagtt tctacaacaa ccctatcttg 540
tggcccaagc ttcatccatt gctccagagc actacaacta atcaaaaccc taagcttgca 600
tctcaagaaa gcttccaccc tttaggagtt aacgttgatc atcagcacaa caataccaag 660
35 ctagctcaga taaacaatgg agcctcttct ctctattcgg agaacgtaga gcaatcccaa 720
aaccctgctc atgaatttca acctaatttc ggtttttcac aggaccttcg attagataat 780
cataacatgg actttatgaa cagaggggtt tctaaagaac tgtttcaagt gggcaacgag 840
tttgagctaa cgaacggttc gagttggtgg tcagaggaag tggaactaga gaggaaaacg 900
acgtcgtcga gttcttgggg gtcagcttct gtgcttgatc agacaactga gggaatggtt 960
45 atgcttcaag attacgctca gatgagctac cacagtgttt aa 1002
<210> 21
<211> 29
50 <212> ДНК
<213> Искусственная
<220>
<223> ПЦР праймер <400> 21
tggtgaggag gattgtgcaa ggatccgcg 29
60 <210> 22
<211> 29
<212> ДНК
<213> Искусственная
65 <220>
<223> ПЦР праймер
<400> 22
ccggaattct tgcacaatcc tcctcacca 29
<210> 23
<211> 21
<212> ДНК
<213> Искусственная
<220>
10 <223> ПЦР праймер
<400> 23
cgtcaagaac tactggaaca с 21
<210> 24
<211> 20
<212> ДНК
<213> Искусственная
<220>
<223> ПЦР праймер
<400> 24
25 ccatgttcgg gaagtagcac 20
<210> 25
<211> 25
30 <212> ДНК
<213> Искусственная
<220>
<223> ПЦР праймер <400> 25
cgcggatcca tggggcgcgc gccgt 25
40 <210> 26
<211> 34
<212> ДНК
<213> Искусственная
45 <220>
<223> ПЦР праймер
<400> 26
cccaagcttt gtcagggtgt tgcagagacc ctgt 34
<210> 27
<211> 26
<212> ДНК
55 <213> Искусственная
<220>
<223> ПЦР праймер
60 <400> 27
cacctgcggt gaatggaaga cgtttg 26
<210> 28
65 <211> 28
<212> ДНК
<213> Искусственная
<220>
<223> ПЦР праймер <400> 28
tgctcaaagc agaagagatc tgaatgag
<210> 29
<211> 29
<212> ДНК
<213> Искусственная
<220>
<223> ПЦР праймер
<400> 29
caccgacgga ggaagtagtg tggaaccat
<210> 30
<211> 17
<212> ДНК
<213> Искусственная
<220>
<223> ПЦР праймер
<400> 30
tggtggtagg gtgcggc
<210> 31
<211> 27
<212> ДНК
<213> Искусственная
<220>
<223> ПЦР праймер
<400> 31
cacccagatc aaatgtcaaa aggggcg
<210> 32
<211> 22
<212> ДНК
<213> Искусственная
<220>
<223> ПЦР праймер
<400> 32
cttgcctgcc gagctatcaa сс
<210> 33
<211> 17
<212> ДНК
<213> Искусственная
<220>
<223> ПЦР праймер
<400> 33
atggggcgcg cgccgtg
<210> 34
<211> 24
<212> ДНК
<213> Искусственная
<220>
<223> ПЦР праймер
<400> 34
ctatgtcagg gtgttgcaga gacc 24
<210> 35 <211> 2144 <212> ДНК 15 <213> Oryza sativa
<400> 35
gagaaactac cagaatgccc gtatgttgca acacgatttt aattaattaa agaaaatatc 60
20 attaatctat tattataatc ttttaattca attgatgtag atatttgttc ctgacttgtg 120
gattttttta gtctcacact ctcccttttt tttctttctc atgggagtgg tcgatatgtg 180
cagcgtctaa caccacatgt cctttttctt cgaaaaaaga gttctccctt ataactttta 240
taaggagtat agatagtttg cattccttgc ttgctgcttt ttttatagat ataatttgca 300
tttccttgtt gcactgatca ttagctcatt agttcatccc atgaggacat gatgacagta 360
30 tgacactacc cagaatgatt atttttcact taatatttgg agatttatct cgacgtcact 420
gggtggcata taagggatgc gacaaacact ccatatcaat cgaggaattt cctctcgtct 480
tgaattatga ctgatcatga cttgtcatta gagaagttaa agaaaaagat gggacttatc 540
aggagagact aaaaaaagag tagccctacg agtagtttag tgtgttttgc catactacca 600
tgtgatggtg atgtcaaaaa catggggctc gcgtaaccgc aaaactaagg ctgtcccaga 660
40 cacactaatc aaaagcattc gaatttagaa ctcctataat ttgttagttt gtttaatcac 720
tctttgtgtc tcatgatgat tcatgcttgc ataattgcat acacttctcg actctaagct 780
tggaccacac aacccgtaca taggacgaaa ccgaaagcat cacccaaaaa aaaaaaaact 840
aatgtgcccc tctttagcat gtcagaataa tatggaaaag gcgtcgagca gaaacaaata 900
tgtcaagagt ttgacaaacc tgacaactgc caatgcagcc aatgagccaa gcagcaactt 960
50 gttgatggct ggtaggcttt cccattatat tctggcaaaa actttgcttc catttttcta 1020
ttgacgacga tgagttcgcc gattccggcc gggccggctc agcttttctc cttcggctag 1080
cgtttggacg cacacttttg agagaatcga aacacggaga gaagtgctcc gatgcatgac 1140
acctcctttt ccacgtactt aacgccaaag ggaaacaatg atatgcagtg aacacaaagg 1200
gattgaccct gcccaggatc atcaatacac gttgaggctt cttcgtgtgt gaaagcatgg 1260
60 ctaactcgtc tggtcaaagg caaaattgct gctatcctaa aacaaatagt actaggataa 1320
ataaatgaaa gggctaatat aacactcgca cacacgcgag acgacaaaat ggagagctag 1380
cacacacgat agggacggct cgacggtagg ggaggaggaa taatgcaggc aggatgttac 1440
tatggccacg tttagttggt tagtgtgaca aaaaattttt aaaagtatac agacatacat 1500
aatatatatt taaagtatta aaggtagact aataacaaaa taaattacag atttcacata 1560
taaactgtga
ggtgaattta
ttaagtttaa
ttaatccttc
attagcaaat
gtttactgta
1620
gcatcacatt
gtcaaatcat
ggcgtaatta
gactcaaaag
attcgtttcg
caatttacat
1680
gcaaactgtg
caattggttt
ttttccatat
ttaatgcttc
atatatgtat
tcaaatattt
1740
gatgtgacgg
aattttttaa
agtttaaatt
caaatatttg
atgtgacgga
attttttaaa
1800
gtttgaaggg
aaataaacac
ggcctatggc
gcaaaattgt
actacaaact
ccctttcgcg
1860
agacgagaga
atgcaacgcc
gtgccgctct
ggcggctggg
gcccaaccgc
gaaaggcaat
1920
ccatccctct
ctctccccgt
cgcgtaaggc
cgctataaat
caacccgtcg
cgggttgcat
1980
tgcatcggtc
ggtctcggtc
gctgccgtcc
ctgtgcttgg
agtagacacg
agccggtgac
2040
gcgcatatcg
tcttctgctc
gagatcgatc
gatcgatcgc
ttggttggtt
gctgcgactg
2100
cgagggaggc
cgcgggtggt
gaggaggatt
gtgcaaaaaa
aatg
2144
ФОРМУЛА ИЗОБРЕТЕНИЯ
1. Способ повышения выносливости к тепловому стрессу у трансгенного растения, части растения или растительной клетки, причем способ включает введение одной или нескольких выделенных нуклеиновых кислот, кодирующих (i) глутаминсинтетазу 1;2 (GS1;2), (ii) глутаматдекарбоксилазу 3 (GAD3), (iii) глутаминамидотрансферазу класса I (GAT1) или любую их комбинацию, в растение, часть растения или растительную клетку с получением трансгенного растения, части растения или растительной клетки, которые экспрессируют одну или несколько выделенных нуклеиновых кислот, для выработки GS1;2, GAD3, GAT1 или любой их комбинации, приводя таким образом к повышению выносливости к тепловому стрессу у трансгенного растения, части растения или растительной клетки по сравнению с контролем.
2. Способ по п. 1, отличающийся тем, что одна или несколько выделенных нуклеиновых кислот кодируют GS1;2, GAD3 и GAT1.
3. Способ по п. 1 или п. 2, отличающийся тем, что способ дополнительно включает введение выделенной нуклеиновой кислоты, кодирующей полипептид MYB55, в растение, часть растения или растительную клетку.
4. Способ по любому из пп. 1-3, отличающийся тем, что одна или несколько выделенных нуклеиновых кислот содержатся в одной или нескольких кассетах экспрессии, которые содержат одну или несколько выделенных нуклеиновых кислот в функциональной связи с одним или несколькими промоторами, которые функционируют в растительной клетке.
5. Способ по п. 4, отличающийся тем, что одна или несколько кассет экспрессии содержат селектируемый маркер.
6. Способ по любому из пп. 1-5, отличающийся тем, что способ дополнительно включает воздействие на клетку, часть клетки или растительную клетку тепловым стрессом.
7. Способ по п. 6, отличающийся тем, что на растение, часть растения или растительная клетка воздействуют тепловым стрессом во время вегетативной стадии роста.
8. Способ по любому из пп. 1-7, отличающийся тем, что повышенная выносливость к тепловому стрессу приводит к повышенной урожайности по сравнению с контролем.
9. Способ по любому из пп. 1-8, отличающийся тем, что трансгенное растение, часть растения или растительная клетка содержат одну или несколько выделенных нуклеиновых кислот в своем геноме.
10. Способ по любому из пп. 1-9, отличающийся тем, что способ включает:
(a) введение одной или нескольких выделенных нуклеиновых кислот в растительную клетку с получением трансгенной растительной клетки; и
(b) регенерацию трансгенного растения из трансгенной растительной клетки из (а), где трансгенное растение содержит в своем геноме одну или несколько выделенных нуклеиновых кислот и характеризуется повышенной выносливостью к тепловому стрессу.
11. Способ по любому из пп. 1-9, отличающийся тем, что способ включает:
(a) введение одной или нескольких выделенных нуклеиновых кислот в растительную клетку с получением трансгенной растительной клетки;
(b) регенерацию трансгенного растения из трансгенной растительной клетки из (а), где трансгенное растение содержит в своем геноме одну или несколько выделенных нуклеиновых кислот; и
(c) отбор трансгенного растения, характеризующегося повышенной выносливостью к тепловому стрессу, из множества трансгенных растений из (Ь).
12. Способ повышения содержания аминокислот в трансгенном растении, части растения или растительной клетке, причем способ включает введение выделенной нуклеиновой кислоты, кодирующей полипептид MYB55, в растение, часть растения или растительную клетку с получением трансгенного растения,
12.
части растения или растительной клетки, которые экспрессируют выделенную нуклеиновую кислоту, для выработки полипептида MYB55, приводя к повышенному содержанию аминокислот в трансгенном растении, части растения или растительной клетке по сравнению с контролем.
13. Способ по п. 12, отличающийся тем, что содержание глутаминовой кислоты, аргинина, гамма-аминомасляной кислоты (GABA), пролина или любой их комбинации повышено у трансгенного растения, части растения или растительной клетки.
14. Способ по п. 12 или п. 13, отличающийся тем, что выделенная нуклеиновая кислота содержится в кассете экспрессии, которая содержит выделенную нуклеиновую кислоту в функциональной связи с промотором, который функционирует в растительной клетке.
15. Способ по п. 4, отличающийся тем, что кассета экспрессии содержит селектируемый маркер.
16. Способ по любому из пп. 12-15, отличающийся тем, что повышенное содержание аминокислот присутствует в листе, влагалище листа, корне трансгенного растения или части растения или любой их комбинации, или в трансгенном растении или части растения, которое регенерировано из трансгенной растительной клетки.
17. Способ по любому из пп. 12-16, отличающийся тем, что трансгенное растение, часть растения или растительная клетка содержит выделенную нуклеиновую кислоту в своем геноме.
18. Способ по любому из пп. 12-17, отличающийся тем, что способ включает:
(a) введение выделенной нуклеиновой кислоты в растительную клетку с получением трансгенной растительной клетки; и
(b) регенерацию трансгенного растения из трансгенной растительной клетки из (а), где трансгенное растение содержит в своем геноме выделенную
(a)
нуклеиновую кислоту и характеризуется повышенным содержанием аминокислот.
19. Способ по любому из пп. 12-17, отличающийся тем, что способ включает:
(a) введение выделенной нуклеиновой кислоты в растительную клетку с получением трансгенной растительной клетки;
(b) регенерацию трансгенного растения из трансгенной растительной клетки из (а), где трансгенное растение содержит в своем геноме выделенную нуклеиновую кислоту; и
(c) отбор трансгенного растения, характеризующегося повышенным содержанием аминокислот, из множества трансгенных растений из (Ь).
20. Способ по любому из пп. 17-19, отличающийся тем, что способ также включает получение растения-потомка, происходящего из трансгенного растения, где растение-потомок содержит в своем геноме выделенную нуклеиновую кислоту и характеризуется повышенным содержанием аминокислот.
21. Способ по любому из пп. 12-20, отличающийся тем, что выделенная нуклеиновая кислота содержит:
(a) нуклеотидную последовательность, которая кодирует аминокислотную последовательность с любым из SEQ ID NO: 5-13; или
(b) нуклеотидную последовательность, которая кодирует аминокислотную последовательность, которая по меньшей мере на 95% сходна с аминокислотной последовательностью с любым из SEQ ID NO: 5-13 и обеспечивает повышенную выносливость к тепловому стрессу у трансгенного растения, экспрессирующего ее.
22. Способ по любому из пп. 12-21, отличающийся тем, что выделенная нуклеиновая кислота содержит нуклеотидную последовательность, которая кодирует аминокислотную последовательность с SEQ IDTJO: 5.
23. Способ по любому из пп. 12-22, отличающийся тем, что выделенная нуклеиновая кислота содержит нуклеотидную последовательность,
22.
кодирующую полипептид MYB44, причем нуклеотидная последовательность выбрана из группы, состоящей из:
(a) нуклеотидной последовательности с любым из SEQ ID NO: 4 или SEQ ID NO: 14-20;
(b) нуклеотидной последовательности, которая по меньшей мере на 95% идентична нуклеотидной последовательности с любым из SEQ ID NO: 4 или SEQ ID NO: 14-20 и обеспечивает повышенную выносливость к тепловому стрессу у трансгенного растения, экспрессирующего ее;
(c) нуклеотидной последовательности, которая гибридизируется с полной комплементарной цепью нуклеотидной последовательности с любым из SEQ ID NO: 4 или SEQ ID NO: 14-20 в жестких условиях, включающих жесткость отмывки 50% формамидом с 5х раствором Денхардта, 0,5% SDS и 1х SSPE при 42°С, и обеспечивает повышенную выносливость к тепловому стрессу трансгенному растению, экспрессирующему ее; или
(d) нуклеотидной последовательности, которая отличается от нуклеотидной последовательности из любого из (а)-(с) из-за вырожденности генетического кода.
24. Способ по любому из пп. 12-23, отличающийся тем, что нуклеотидной последовательностью является последовательность с SEQ ID NO: 4 или нуклеотиды 4062-5126 в SEQ ID NO: 3.
25. Способ по любому из пп. 1-24, отличающийся тем, что введение производят посредством трансформации, опосредованной бактериями, трансформации бомбардировкой частиц, трансформации, опосредованной кальция фосфатом, трансформации, опосредованной циклодекстрином, электропорации, трансформации, опосредованной липосомами, трансформации, опосредованной наночастицами, трансформации, опосредованной полимерами, доставки нуклеиновой кислоты, опосредованной вирусами, доставки нуклеиновой кислоты, опосредованной нитевидными кристаллами, микроинъекции, ультразвуковой обработки, инфильтрации, трансформации, опосредованной полиэтиленгликолем, или их комбинации.
24.
26. Способ по любому из пп. 1-25, отличающийся тем, что растение является однодольным растением.
27. Способ по любому из пп. 1-25, отличающийся тем, что растение является двудольным растением.
28. Способ по любому из пп. 1-27, отличающийся тем, что растением является рис, маис, пшеница, ячмень, сорго, овес, рожь, сахарный тростник, соя или Arabidopsis.
29. Трансгенное растение, часть растения или растительная клетка, полученная способом по любому из пп. 1-10, или способом по любому из пп. 2528 в зависимости от любого из пп. 1-10, где трансгенное растение, часть растения или растительная клетка характеризуются повышенной выносливостью к тепловому стрессу.
30. Трансгенное растение, часть растения или растительная клетка, полученная способом по любому из пп. 12-24, или способом по любому из
пп. 25-28 в зависимости от любого из пп. 12-25, где трансгенное растение, часть растения или растительная клетка характеризуются повышенным содержанием аминокислот.
100% 90% 80% 70% 60% 50% 40%
L~ I till
Gryza_sativa Sorghum_bicolor Zea_mays Vitis yinifera Populus_ tiiehocaipa Malus x domestica Daueiis_carota C51ycine_max Ambidops isthaliana
86%
77%
75%
58%
55°/ 54 48%
48%
Фиг. 1A
(SEQ ID NO:1):
gaaactaccagaatgcccgtatgttgGaacaogattteaattaattaaagaaaatatc
attaafcctattattat;aatcttttaattcaattgatqtaqatatttgttoctqacttgtg
qatttttttagtcfccacactctcccttttttttctttetcatggqaqtqgtcqatatgtq
cagcqtctaacaccacatqtcctttttcttcqaaaaaaqaqttctcccttataactttta
taaqqagtatagatagtttqcattocttgcttgctqcfcttttttatagatataatttgca
fcttccfatgttgcactgatcattagctcattaqttcatcccatgagqacatgatgacaqta
tqacaotaoccagaatqattabttttcacttaatatttqqaqatttatctoqacgtcact
qggtgqcatataaqqqatqcgacaaacactccatatcaatcgaqgaatttcctctcqtct
tgaattatgactgatcatgacttgtcattagaqaagttaaagaaaaagatqggacttatc
aggaqagaotaaaaaaagagtagccctacgagtagtttagtgtgttttgccatactacca
cgtqatqqtqatgtcaaaaacatqggqctcqcqtaaccqcaaaactaaggctgtcccaga
cacaotaatcaaaaqcattcgaatttagaactoctataat-ctqttagtttgtttaatcac
tctttqtqtctcatqatqattoatqcttqcataattgcatacacttcteqactctaaqct
tggaccacacaaoccqtacataqgaogaaaccqaaagcatcacccaaaaaaaaaaaaact
aatqtqcccctctttaqcatgtcaqaataatatqqaaaaqqcgtciqagcaqaaacaaata
tgtcaagagtttgacaaacc-tgacaactgccaatgcaqccaatqaqccaagcagcaactt
qttgatggctggtaqqctttcccattatattctqqcaaaaactttgcttcoattttfccta
ttgacgacgatgagttcgccgattccgqocgggcogqotcaqcttttctccttcgqctaq
cgtttgqacgcacactbttqaqagaatcqaaacacggaqaqaagtgotcogatqoatqac
acotccttbtccacgtacttaacgooaaaggqaaacaatgatatgoagtqaacacaaaqg
qattgaccatgoccaqgatoatoaatacacqttgaggettcttcgtgtgtqaaaqcatqq
otaaotcqtctqqtcaaaqqcaaaattqctqctatcctaaaacaaatagtactaggataa
ataaatgaaagggctaatataacactcqcacacacgcgaqacqacaaaatqqagagctag
cacacacgataqggacgqctcgacgqtaggggaggaqgaataatgcaggcaggatgbtac
tatggccacgtttagttggttagtgtgacaaaaaatttttaaaaqtatacaqacataoat
aatatatatttaaagtattaaaqqtaqactaataacaaaataaattacaqatttcacata
taaactgtgaqqtgaatttattaagtttaattaatccttcattaqcaaatgtttactgta
gcatcacattgtcaaatcatqgcgtaattagactoaaaaqattcqtttcqcaatttacat
qcaaaotgtqcaattqqtttttttccatatttaatgcttcatatatgtattcaaatattt
gatgtgacggaattttttaaagtttaaattcaaatatttqatqtgacgqaattttttaaa
gtttgaagggaaataaaoacgqcctatqqcgcaaaattgtactacaaactccctttcqcg
aqacgaqagaatgcaaoqccgtqccgot.ctgqcqqctqqgqcccaaccqcqaaaggcaat
ccatcoctctctctccocgtcgcgtaaggoogctataaatcaacGcgtcgcgggttgoat
tgcaticqgt.cggtctcggtcqetgccgtccGtqtgcttqqaqtagacaogagccggtgac
qcgcatatcqtottctqotcgagatcgatcgatcqatcgcttggttggttqctgcgactg
oqagqgaqqccqcgggtggtgaggaqqattgtqcaa
(SEQ ID NO:2):
gatttggatgaacttgggttgcatttgggctttctatatgggcctgaatttgaatttcct
tgggaLgcaaaatbctctcgaggaaaaaagtaoaccgaaggtccctcaacttggcatcga
gttacaaaatcgtccccaaaccacaaaaccggataeaacgcatccccaaaattataaaac
cagtgcatactgatcccggttttagcfcgacatggcggctgactcagcgtggaacccacgt
gggccccatatgtcaggatgccacgtcggccagcctctcccttcctttcctgtcccctcc
tttcgtctcgacttgttaggatgcaacgtcatcagcagggcggccggcggtggggagggg
gttgccagggtgagaggtccgacggccggcgggcgatgcggcggcggoaacgtggcggct
gagac gtgcgagtgtcgtggcggagagggcggaggcggtagctgcggcggagaggcgatggcggc
ggatgogagcgtcgtggcggagaggaggcggcggcggcggctgccacgcgggagggcagg
ccgaaggcgacggcgtgggcgagcgtggaggcacgcgacggcgaggctgccgctccgccc
gtcgc"tcttctctctcaggtttctcctcgtctgggtgggcaggtcggccggcgggttgg
gaaggaagggaaggggttggggtgatggcttgctggagctgcttcggctgcagccggtcg
atcgcagcaggaggcgaggtccggctgccggagccgttccagctgccggcgcccttgccc
agctagccgcatggtctagggacttgttcgctttcatcgttcttcgaattctctccccgt
ttcttcgtgtactgtttaattggttcttaatctgctcataaattaatcgtcgtcatctat
ggcGtggattgccggatagtatctttgtgcttgtaaattttcagcggctatgcgagagct
cgtgccaaatttgatatgcgagagttttgttgtttgtttcgccggcgaccgagcaggacg
ggtcGgggcaccggagcgacaggcaccgcgcgccgtcgcccaccgccacgcggaaacgac
cggtgatgcggcagccgcaccggGctgccggaggaccgggcaaatggtgggcgaagcggg
caacgacgcgggccggagtggccggccggcggtgggaaggcacgctgcgggagaggaagg
ggctgcggcggcaggggcgcagaaggtcaggccgcaccggcaggcggctgtcgacatcga
ccatttagagggcagagagaggacaagaacggggagaggagagagcggaggcggatggcg
ccgacggggagcgggatqgggatagcaaggccgtcatcgccgtcgtcgtccatggcgtgg
ggaggccgcctccgctccgcctgtcgcctgcctgccgccgccgacccgcctgcccaccgg
ccgoGgaacctcctcctctcccgoctcgocccgtcggcttcctccccaaoccgtcggccg
gcctgcccacGcagacgaggtgaaagctgagagagaagaggggaaagagagagatgacgt
ggcatcctgacatgtgggtxccacgctgacatgtgggttccacgctgagtcagctgctac
gtcggaaaaaactgaggtcaaaaccgocgagggaactagtttgccctggttttgtaagtt
ggagga1:gcgttgt:at:ccggttttgcggttggaggacgattttgtaactegatgacaagt
tgagggaccttcggtgtactttttccttctctcgatgccactggattgggccggtttgga
ccaatttgcgtgcattttgagctttccatgtgggccgtagtttgcattcctttttttttt
gagaaacitaccagaatgcccgtatgttgoaacacgattttaattaattaaagaaaatatс
attaatctattattiataatcttttaattcaattgatgUagatatttgttcctgacttgtg
gatbtttttagtctcacactctcccttbtttttctttctcatgggagtggfccgatatgtg
cagogtctaacaccacatgbcctttttcttcgaaaaaaqagttctcccttataactttta
t.aaggagt.abagat.agtttgcattcctbgcttgctgctttttttatagatataatttgca
tttccttgttqcaotgatcatcageteaLLaqttcatocGatgaggacatqatgaGagLa tgacaotacccagaatgattatttttcaottaatattbggagatttatctcqacqtpact qggtgqcatataagggatqcqacaaacactccatatcaatcgaqgaatttcctctcqtct tqaattatqactqatcatqacttgtcattaqagaagttaaagaaaaagatggqacttatc aggagagactaaaaaaagagtagccctacgagtagtttagtgtqttttqccatactacca tgtgatqqtgatgtcaaaaacatqqqqctcqcqtaaccqcaaaactaaqqctgtcccaga cacactaatcaaaagcattcgaatttagaactcctataatttqttagtttgtttaatcac tctttqtgtctoatqatgattcatgcttgcataattgcataoacttctcqactctaaqct tggacoaoacaacccgtacataqgacgaaaccqaaagcatoaoccaaaaaaaaaaaaact aatqtgcccctctttagcatgtcagaataatatqgaaaaqgcqtcqagcaqaaacaaata tgtcaaqagtttgacaaacctgacaaotgocaatgcagocaatqagccaagcagcaactt gttgatqqctggtaqgctttoccattatattctggoaaaaactttgottcoatttttcta ttqacqacqatqaqttcqccqattocqqccggqccggctoagcttttctccttcgqctag cgtttqgacgcaoapttttqaqaqaatcqaaacacqqaqaqaaqtqctccgatgcatgac acctccttttccacqtaottaacgccaaagggaaacaatgatatqcagtqaacaoaaaqq gattgaccotgoccaqqatcatcaatacaaqfctqaqgcttottcqtqtqtqaaagcatqg ctaactcgtctgqtcaaaqgcaaaattqctqctatcctaaaacaaataqtactaqqataa ataaatgaaagggctaatataacactcgcacacacgogaqaogacaaaatggagagctag cacacacgatagggacggctcgacggtaqgggaggaggaataatqcagqcaggatgttac tatggocacgtttaqttggttaqtgtqacaaaaaatttttaaaaqtataoaqacatacat aatatatatttaaagtattaaaggtagactaataacaaaataaattacagatttcacata taaactqtgaggtgaatttattaagtttaattaatccttGattagcaaatgtttactgta qcatcaGattgtcaaatoatggcgtaattaqautcaaaagattcgtttcqcaatttacafc geaaactqtgcaattggtttttttocatatttaatgottcatatatgtattcaaatattt gatgtgacggaatttttt.aaagtttaaattcaaatatt.tgatqtgacggaattttttaaa qtttgaagggaaataaacacqqcctatggcgcaaaattgtactacaaactccctttogcg agacqagagaatgcaacgccqtqccgctctqqcggctqgqqoccaaccqcqaaaggoaat ocatCGctctctctccccqtcqcqtaaqqoogotataaatoaaocGqtcgcgggttgcat tgcatcggtcgqtotogqtcgctgoo.qtccctgtqcttggagtagacacqaqccqqtqac gcgcatatcgtcttctqctcqaqatcqatcqatcqatcqcttqqttqqttqctqcqactq cgagggaggccgcgggtggtgaggagga t tg tg caaaaaaa
(SEQ ID NO:3):
gatttggatgaacttgggttgcatttgggctttctatatgggcctgaatttgaatttcct tgggatgcaaaattctctcgaggaaaaaagtacaccgaaggtccotcaacttggcatcga gttacaaaatcgtcccccaaccacaaaaccggatacaacgcatcceecaacttataaaac cagtgcatactgatcccggttttagctgacatggcggctgactcagcgtggaacccacgt gggccccatatgtcaggatgccacgtcggccagcctctcccttcctttcctgtcccctcc tttcgtctcgactegetaggatgcaacgtGatcagcagggcggccggoggtggggagggg gttgccagggtgagaggtcogacggccggogggogatgoggcggcggcaacgtggcggct gagacacgagagaaggggaaggoagcggaccagcgttgtggcggagaggcggcagcaggc gtgcgagtgtcgtggcggagagggcggaggcggtagctgcggcggagaggcgatggcggc ggatgcgagcgtcgtggcggagaggaggcggcggcggcggctgccacgcgggagggcagg ccgaaggogacggcgtgggcgagcgtggaggcacgcgacggcgaggcfcgccgctcegccc gtogcatcttctctctcaggtttct.cctcgtctgggtgggcaggtcggccggcgggttgg gaaggaagqgaaggggttggggtgatggettgctggagctgcttcggctgcagccggteg atcgcagcaggaggcgaggtccggctgc.cggagccgttccagotgccggcgcccttgccc agctagccgcatggtctagggacLtgttcgctttcatcgttcttcgaattctctcccogt ttcttcgtgtactgtttaattggttcttaatctgctcataaattaatcgtcgtcatctat ggcctggattgccggatagtatctttgtgcttgtaaattttcagcggctatgcgagaget cgtgccaaatttgatatgcgagagttttgttgtttgtttcgccggcgaccgagcaggacg ggtccgggcBccggagGgacaggcaccgcgcgGcgtcgcccaccgccacgcggaaacgac cggtgatgcggcagcagcaocggGctgccggaggaccgggcaaatggtgggcgaagcggg caacgacgcgggccggagtggccggccggcggtgggcaggcacgctgcgggagaggaagg ggctgcggcggoaggggcgcagaaggtcaggccgcaccggcaggcggctgtcgacatcga ccatttagagggcagagagaggacaagaacggggagaggagagagcggaggcggatggcg ccgacggggagcgggatggggatagcaaggccgtcatogocgtcgtcgtccatggcgfegg ggaggccgcctccgctccgcctgtcgcGtgcctgccgocgccgaaccgcctgcccaccgg ccgccgaacctcctcotctcccgcctcgccccgtcggcttcctccccaacccgteggocg gcctgcccacccagacgaggtgaaagctgagagagaagaggggaaagagagagatgacgx ggcatcatgacatgtgggttccacgctgacatgtgggttcoacgctgagtcagctgctac gtcggaaaaaactgaggtGaaaaccgccgagggacctagtttgccctggttttgtaagtt; ggaggatgcgttgtatccggttttgcggtLggaggacgattttgtaactcgatgacaagt tgagggacGtScggbgtactttttccttctctcgatgcGactggatUgggccggtttgga ccaatttgcgtgcattttgagctLtccatgtgggccgtagtttgcattcctttttttttt gagaaaotaocagaatgcccgtatgttgcaaoacqa.ttt'taattaattaaagaaaatatc attaatctattattataatcttttaattcaattqatgtagatatttgttcctgaGttgfeg gattttLbtaqbctcacactctcccttttttttctttotcatgggagtqqtcgatatgfcg caqcgtctaaoaccaoatgtcctttttcttcgaaaaaagagttctcccttataactttfca taaggagtataqatagtttqcattccttgcttgctgotttttttat.agatataatttgGa"
bttccttgttgcactgatcattagcbcattagbtqatcccatqaggacatgatgacagba tgacaotaoccagaatgatbabtttbcacbtaatattbggagattbatcbcqacgbcacb gggtggcabataagqqatqcgaeaaacacbccatatca.atcgaggaatttccbctcgbct tqaattabqactgatcabqacttgbcattaqaqaaqtbaaaqaaaaaqatqgqactbabc aqgagagactaaaaaaagagtagcectaoqagtaqtttagtgtgttttgcoatactacoa tgtgabggbqatgbcaaaaacabqqgqctcqogbaaccgcaaaactaaqgcbgbcccaga qaoaetaabcaaaaqcattGgaatttagaactccbataatttgttagttbgbttaatcac tctttqtqtctcatqatgattcatgcttgcataattqcatacacttctcqactctaaqct bggaccacacaacccgtacataqgacgaaaccgaaaqcabnacccaaaadaaaaaaaacb aabgbqcccctcbbbagcatqtcaqaataababqqaaaaggcgtcgagGagaaacaaata bgbcaagagbbtgaoaaacctgacaactgocaatgcagocaabgagocaagoagoaactt gttqatggctggtaqgctttcccattatattctqqcaaaaactttqcttccattttbcta ttqacgaogatgaqttogccgattocggccgggccggctcagcttttctccttcqqctaq cgtttggacgcacacttttgagagaatcgaaacacggagagaagtgctccgatgcatgac acctocttttccacgtacttaacqccaaagggaaacaatgatatgcagtgaacaoaaagg gattgaccctqcccaqqabcatcaataoacgttgagqctbctbcgbgbgtgaaagcabgg cbaactcqbcbggbcaaaqqcaaaatbqcbqcbafaccbaaaacaaataqtactaqqabaa ataaatgaaagggctaatataacactcgcacacacgcgagacqacaaaatggagagctag oacacacgatagggaGggctcgacggtaggggaggaggaataatgcaggcaggatgttac fcatqgcoacgbbtagtbgqttagtgtgacaaaaaatbtbbaaaagtatacagacabacat aatatatatttaaagtattaaaggtagactaataacaaaataaattacagatttcacata baaactgtgaggbgaabhbabbaagttbaatbaabcctbcattageaaabgbbbacbgba gcatGacabtgtcaaatcabggcgbaabbagacbcaaaagabbcgtttcgcaabtbacab gcaaactgtgcaattggbbttbttocatattbaatgcttoababatgtatbcaaatattt gatgtgacggaattbtttaaagtttaaattcaaatattbgatgtgacggaatttttbaaa gtttgaagggaaataaacacggccbatggcqcaaaattgbactacaaactccctttcqcq aqaogagagaatgcaacqccgtgccgctctqgcqgctqqgqcccaaccgcgaaagqcaat ccabccctctctcbccccgbcqcqbaaggccgctataaabcaacccgbcqcgggbtqcab tgcabcqgtcqqtctcqqtcqctgccqtcoctgbgcttqgaqtagacacgagccqgtgac qcqcababcqbctbctqcbcqaqabcgabcqatcgatcgcbtqqttqqtbqcbqcqacbq cgaqggaggccgcgggbggbgaggaggabtgtqcaaaaaaaATGGGGCGCGCGCCGTGCT GGGACAAGGGGAGCGTGAAGGGGGGGCCGTGGTCGCCGGAGGAGGACGAGCAGCTGCGGA GCTACGTCCAGAGCCACGGCATOGGCGGCAACTGGATCGCGCTCCCGCAGAAAGCAGGbc ggtattagbgcacbgcbcgtcgtcgtcgatgcbagccggtgatgaaacgccatgttbgta tgtgaattcbgabgbctgcgbgttcbcbbgtgtgatbcaggGCTCAACCGCTGCGGCAAG AGCTGCAGGCTCCGGTGGCTCAACrACCTGAGGCCGGACATCAAGCACGGCGGCTACACC GAGCAG <3AGGACCACATCATCTGCrCGCTCTACAACTCGArTGGAAGCAGGTGa tga t b b aagccggagatgaatabbtcbbttttcbttcacbgatccbgtbctgagbt.Gtt.gaaGbga
CtctgtttgcgtgcgttgccaggtgGTGCATGATCGCGTCGftAGCTCCCCGGCCGGACTG
AC^OTACGTCAAGAACTACTGGAACACCAAGCTCAAGAAGAAAGC№№GGCGCCGTGC
ASCGGCGCGCCGCCGCCTGGGGGGCGAGCGAATGCAraTCGTCAGGGRTGGGGCCGGCGC
TCTCGCCGGCCTCCTCGTCCGTCACCAGCTCGAGCGGCGACGCCrGCTTGGCCGCCGCCG
CCACeACCACCACCACCATGTACGCGCC^CCGACGACGCCGCCGCAGCAGCAGTTCATCC
GCTTCGACGCACCACCCGCGGCGGCGGCGGCGGCATCCCCGACCGACCtCGCGCCCGTGG
CACCACCGGCCACCGTCACGGCGGACGGCGACGGCGGCTGGGCGTCCGACGCCTTGTCCC
TCGACGACGTGTTCCTCGGCGAGCTCACGGCCGGCGAGCCGCTGTTCCCTTACGCCGAGC
TGTTCA(aCGGCTTCGCCGGCGCGGCGCCGGACAGCAAGGCCACCTTGGAGCTCTCGGCGT
GCTACTTCCCGAACATGGCGGAGATOTGGGCGGCCTCCGACCACGCCTACGCCAAGCCAC
AGGGTCTCTGCAACACCCTGACATAGgaggacacgctaaaacctocattgaattcttgcg
tagctgcgaacgcaacggcgatcgatcgatgcgtcgccactt.gctacfcagoataattctt
gotctcttttttttttcaatttttttctcttcttcgagtggcccattotctagctggcgt
tttctcgtgtattatgagtgatcgattattacatgtaaattaatccatagatgtatctgc
actgatceaaattctccagcgattacgcttgtcagttagtacgcgatccatccgttggct
tggctctccggtacaccggacaagttagcgcgtcccgaaaacgatacgcccctgtctgtc
tccctctcgccgagccgaagtcacttcacatgtacagtgtcacagtgaoaaatctgacga
gacgaaatgttaggtgaggcacaagaggttcagaagaacaacgtgtgcgagacatggacc
agttctcgtgcggcgcgcacgcacagfcgtcatggacttgacccgttccggttttcgaggg
ccaatggggaggagaggcgtgtggacggttttctgtcacgttacacgtaggagtattttt
tttcctctcatttLgtttttgatttttgcccggtggcaagttgatcctgatcgtatggcc
tagggggcctatgggccgtggatcacatggtaattgggtgtcattgtttatttgggtagt
ctoacttggggcatggatagtgtctctttgtaaagtgattgaagacttcaagtgcacgac
aaggacgagcctagttgaccctggaaatggagggaggstcggttt.cgaagaagcttcctt
gacaattgtcatgctcgtgatgggotctatacatatgatcagaggagacctctagttaaa
agtctctctaactaattactccaaaaaaaagtctctctaactttgctcattgtgggttta
tcaatgtctaggcaaattaaaaccatcaataataacatgttaacagtacttaccttgttg
gattttactagcttagtgtacgccagggatccacacattttccaggtcttcgtggtcggc
atgagaaaatccggcaaaagceaagtagaacaaggccaaaggatgggaaaaagccagtgc
aatcetccactgtagttttatttggaaagtagatgaatatggaLtttttttataaaaaac
aaacttttatttacatttgaaaacaaaccccaaaataacttattttacaaataaaccatt
tgUggagaaaacaacaggcaaggtccccttataacgttgcatttttteattttggtcttt
taagacaattgagtcgaaaaatoctatataattcaacctaggttataagcggcatctact
acacaacggtaatggcagaggattcacttccaaggtgtacatotatctggtttgtcaagc
aaatctttaatttcgttgcttgacattgtcttgcgagggatcaagtttcagttttggtta
aaaatatggcaccacattttttttacttgttcttaatcactottcccctatgcgattgtt
aGttttaQccatagttctctttatatagcgtgtattacccgtcaaGaacgaggcgtcfcgt
ggtgactttgccaatctccaagatfctaccggtccagccttcaaagatgctcataggggta
gggtttgtgtgcgtgcgttcataagggtgagggtgcgtgtgtgttgtgagtgtctgcgtt gtattgtgtagttctaaaaaaaacgtaattataaaaagacagtgcaattacgtagtaaat ataggtaatttattgtgtaaaaacgatttgataatatattttgaaaaatgtggtatgata aatatagGtagttccattaagttttagtccatgtttaacatatatttgtacctcgttcgt gtttccttcatacgcatagcagtaacttatgttttgcattttacaaagcagttacgatga gtaggtcattgtagctcatttacatatggagggttgtgattttgttagtaccttgacatt gactcaaagcggcacatctcggcatcaaaggtaggtggcaaaatgcattcgtcaaggaca aatagacaaacatgcattgatcgaatagtgccttcagagccgtggacttctgcgttatca gttcgttgaggtatctctttgatttgacatgagaaatggaccatgtgacagcaagaacga aatgcatggatgpagtgtcctaactggatagcttgctcctttcagaattaaaagctgctc acttgctagctcagataagtgteaagacatagtaaeagtgtcttcagactctgctttggt ttgttgctctaactgaagaattattgctcaecaaacggataagcatatgcacatgtatca gcaaccggcattcggttggaccagtactgacgoagattgcaaacattgttaactcctcgc gatgtctaactgtcttgaaaacgtccttagaaatacttataccggtcaagatcacgagtg tattccaaataatt.aatttcacctacatcgatgacagaggtgtcaacttaaacatccata gcttcacaatcaagacttcaaatgttttgatgcactagaaagcaaaatcagtaaccttta ctatgatcatatatcacacacgaatggtgcagctgttagtgtaacaccacgtgttgagat ttgagaaagcaggcccaaatcaatgcattattgtagctccatttcactatatcaagtaat aatagtaatttatatatatcgtagcagcgaacatgtaccattagattaaaatatgaaagg ctcagattcattgcagttctttagtgtgcacttgcaatatcgaagtgcaccctgatctca atccatcacacatgcacacagactgttcatgtcatcgctgatgctgagttggtcgtgaaa tcggacgattccacgaoggcaagtacagacacacgtcgattgcoggcaaccgcaagcaag tgcagtgcagggtgcaagtgcagcagggcccttggaaacgaagtcggagagagaccatcc gcccatgccatgtccatgtccgtgtgtgtgogctGgctgctgttgtctctttctgagctg gtactagtaataaaaactagcccgaggattattgcaagaacaaaaggtaagcagcatctt gcagagcatactatcacccaagctettaaagctgtcggggaaaagggaccctacgttact cagatacatacggataogcgatacgtcgatacggggatacgacattttccggatacgaca ttttccaaaaaaaaGaaggatacggggataGgtatatatatatatatatatatattgaaa acacaoaaaaaaaattaaggaaattacattaatatatattaaaaataoaaaaaaaataag gagcttt-tataaagaaaaagcgatataataotagtattagtgtagocgattccatatGaa tattttgcaattttcttttctataagcaattcaaattaaoaagcgattaagatcccaaaa actacacattaatagttcaatcatotaactcttgatgactttgcatcaacattagcagcc gcactaaocagtaaccactagaattgctagatgcactagcacttgtatotaaoaaaaacg atagtactttgtcct-.aagaaaaacaagaaaggoccaacagatUcaagcaagaaatgttca aagagcatggatttacccggccaggcactcaagoaaaeaatgaaaaagctccttgctttg atgttgccageggccagcctgGcaccggcctccgctatgcGcggcaaGggtcgtggcGtc cgaggttggcggcgaaggagatgcgocaocgcccagccgcggcagotcttccgtctcgcg gagaggacgttgtggoccgGgoacggcaaccaagGgcgcfcgctgcagqcgGgtctctggt
ggcatcgcqgggcacgcaegagagacagccatcaggatgggagcgtatgaggcggcgcat nccfcgatgcgagcgaagacggaggcacgtGgcggccgtatcgctggcatatctcgattta ttttgtttttt.taaatcgcgaatatgtgggatacgtaGggaatatgtatcggaacatatc cgatatgtatccgtatGcgttgocgtatcagatacggatacgtcgctctgtagccgtacc aggataacgttgagttagggacctaccttcagaaaatatatattcatggatgetagtaca atccagagtagtgacttcaaaagctgaagatctgagctttttgtaccgctadcaaactca gttttttfefcaaggctgtgtttagtttctgagattagggagaagtttggggaaagttggta aattagaaaaaaagttgggagtttatttaagtatgaaagttttgaatgtgatgtgatgga aagttgagagtttgggggaagtttggtgtgaaGtaaatagggcctaatttgttfetagcat cccgtgaaacatttttgctatttctataggGGttgtttaqttccaaactttttcttcaaa ctttG^acttttecatGaoatcgttccaatttcaaGoaaacttctaattttggcgtgaac caaaGttGfeeaafetttctgtgtaacttttggtctcggttattggatatcctgafegGatca tgcabtgaptgtaaatgtcataggtcttctattcattactagtacaatatacaggttttt tttgggataaaGttggatgctttgttcagcatctgccttttctgtcttgaotcttggtac cgcttgtgpacafegtcgacatgttgttoctgctgtttttttttccttttcalittegaggc atgcgtcaGtaacttatgttcgagtGcatttttcagcatt
(SEQ ID NO; 4):
ATGGGGCGCGCGCCGTGCTGCGACAAGGCGAGCGTGAAGCGGGGGCCX3TGGTCGCCGGAG GAGGACGAGCAGCTGCGGAGCTACGTCCAGAGGCACGGCATCGGCGGCAACTGGATCGCG CTCCCGCAGAAAGCAGGGCTCAACGGCTGCGGCAAGAGCTGCAGGCTCCGGTGGCTCAAC TACCTGAGGCCGGACATCAAGCACGGeGGCTACACCGAGCAGGAGGACCACATCAa'CTGC TCGCTCTACAACTCGATTGGAAGCAGGTGGTCCATCATCGCGTCGAAGGTCCCCGGCCGG ACTGACAACGACGTCAAGAACTACTGGAACACCAAGCTCAAGAAGAAAGGGATGGGCGCC GTGCAGCCGCGCGCCGCCGCCTCGGCGCCGAGCCAATGCACGTCGTCAGCGATGGCGCCG GCGCTCTCGCCGGCCTCCTCGTCCGTCACCAGCTCGAGCGGCGACGCCTGCTTCGCCGCC GCCGCCACCACCACCACCACCATGTACCCGCCACCGACGACGCCGCCGCAGCAGCAGTTC ATCCGCTTCGACGCACCACCCGCGGCGGCGGCGGCGGCATCCCCGACCGACCTCGCGCCC GTGCCACCACCGGCCACCGTCACGGCGGACGGCGACGGCGGCTGGGCGTCCGACGCCTTG TCCCTCGACGACGTGTTCCTCGGCGAGCTCACGGCCGGCGAGCCGCTGTTCCCTTACGCC GAGCTGTTCAGCGGCTTCGCCGGCGCGGCGCCGGACAGCAAGGCCACCTTGGAGCTCTCG GCGTCCTACTTCCCGAACATGGCGGAGA№TGGGCGGCCTCCGACCACGCCTA6 <3CCAAG CCACAGGGTCTCTGCAACACCCTGACATAG
(SEQ ID NO:5):
MGRAPCCDKASVKi?GlPWSPKSU"ebR^
VQPKAAASAPSQCTSSAMAPALS PASSSVTSSSGDAC FAAAATTTTTMY PPPT'TPPQQO. F IRFDAPPAAAAAASPTDMPVPPPATVTADGDGGWASDALSbDDVFLGEWAGEPI.E'PYA ELPSGFAGAAPDSKATLELSACYFPNMAEMWAASDHAYAKPQGIiCNTLT
GATTTITTTAGTCTCA^ СТАААШ\АТС &САС?ГХЖ^
CAGCm^AACACCACATGra^
TAAGGAGTATAGATAGTTTGCATTC^ ATIUZTCATATCTATCAM
ITIU^T &TTGCACTGATCAIT^^
AAAGGBACAAOGI^^ ГАСТХЖИГ
TGACACTACCCAGMTGATTATTTITCA^^ ACTGIGATGGGTCTIACTMTAA^
GGGira^TATMGGGATGCGACAAACACTC^ CCCACCGTATATTCCCTACGCTGTTTGTGAGCT
,fifrn-7,
АСТТАфА]?ГШЛАСте
Skn-1 TCA AQGAGAGACTAAm7AAAGAGTAGC(XTAOGA(^AOT TCCICTCTGATTTTTTTCTGATCa
АСАСгаОЖТАСАШТГТТ^
CACACTAATCAAMGCATTCGAATTm GTGTGATTAGTTTTCGTM(^^
TCTTTGTGTCTCATGATGAT^^ АСАЛАСЖЖАСТАСТАСТМСТА^
rJJE_t
TGGAJX^^MOXXTACATAG^ ACCTGGTGTGTTGGGCATGTATCCn^^
МТСТОСХГСЛОТТАОСАТСЖ^СААТМТ TTA(^CGGGGAGAAATCGTACAGTCTTATTATAOCTTTTC
MBS fima:
TGTCAAGAGTTTGACAAACCTGACAAC^ ACAGTTCTCAAACTGTITGG^
MeJa
Фиг. 2A
GTTGATGGCTGGTAGGCJTC^
CAACTACCGACCAT{XGAAA}3^
Me Ja 1щ QCC бокс
MCTGCI^TACIO^GCGGCTMGGCCGGCCCGGGCGAGTCGA
CCTTTGGACHIA^
GCAAACCTGGC^^GAAAACTCTOTAGCT^
, A6RE , ,M TGGASGAAAAGGTGCATGMTTGCGGTTT^
¦\V16OKC. GЈQ2GACCJ^^
CTAACTGGGAC &GGlXXTAGTAG^
СТМС10ЖЛШГСМА?ССАА^ GATTGAGCAGjfcCAGTT{l?C^
W бокс
ATAMTGAMGGGCTMTATAACACTCGCACAC^ TATTTACTTTOCGATTATATT^^
CA(^CACGATAGGGACGGCTCGACGGTAGGG(^GGAGGMTM^ GTGTGTGCTATOCCTGCCGAGCTGCCaa^
TATESGCCAOc?^ ATAOCGGTGCAAATCAACCM^
AATATATATTTMAGTA^ rTATATATAAfrTTTCate
DOF бокс , S/ш-?,
TAAACT^X^3GTGAATTTATTAAGTTTAATTM ATTTGAGACTCCACTTAMTAAriCAMTTM(tm)
CGTAGTGTAACAGTITAGITVX^
GCAAACTGTGCAATTGGITira CGiTTGACACGTTMCCAAAAAMGGTA^
MeJa MeJa GAT^GACd^TTTTTTAAAGTra
HSE DOF бокс HSE DOF бокс
CP ^CTTCCCTTTAITTGTGCCGGATACCGGGTTCT
DOF бокс
AGACGAGAGMTGCAACGCOGTGOCX3CTCG^^ TCra:TCTCraAOGITGC^
GCC бокс
Фиг. 2A (продолжение)
MaJa.
ACGTAGOCAGG^aGOC^GACGra MeJa
(M:GmTAGC^GAAGA0mGCra
***
CGAGGGAGGCDSCGGGTGGT^
GCTGCCTCCGOZGCCCACCACTCCTCCTATACACGl'l'ri'i'l'lTAC
Сайт
11ослсдавагельность(и)
Положенная) (относительно старт-тцоиа ATG)
MSE
TTAAAAAATT MAAMTTTT
-352;-391;-680
ABRE
GCCAGQT GACGTA CCACGTACT
-697;-990;-991
MeJa
TGACG
-100; -358; -397; -957; -1120; -1728
LTR
CCGAAA
-1167; -1331
Skn-l
GTCAT TACTG
-1638 ; -1783 ; -528; -1006; -1645; -1655 ; -1790
TGA
ССАТСПТП
-1619
GCC60KC
CGCGGA
-250
MBS бокс
CAACTG
-1218
W6OKC
TTGACC
-870; -939
DOF &OKG
АТГГСА
-345; -384; -591; -631
Фиг. 2A (продолжение)
геврон Эндосперм
Стадия ранней" тестообразного состояния семян
Стали* молочной спелости семян
Семя, дней 14 после нветенш
Семя, дней 7 посте цветения
Семя, дней 0 после Цветения Появление метелки (метелка)
Стадия трубкования метелки 15-20
Созревание (корень)
Зародыш
? 3> 5
О 2,5 -|
Щ 2,0 -й
Ш 1> 5 1
1,0 -
^ -.-AI'-J--
ас о,5
> 0,0
0 1 в 24
Количество часов при высокой температуре
Фиг. 5
100
Pills
* * • -i
3 <. .
115, *
OsMYB55-4 OsMYB55-11
Фиг. 6
Фиг. 7
s ю
.4 25
OsMYB554
OsMYB55.11
35 i 30 25
§ 15
10 -
OSMYB55-4 OSW1YB55-11
ФИГ. 11
Фиг. 12
160 ¦
О 4i
140-
5S S
120 ¦
100-
80 -
60-
Йч §2
40-
° Й о S
20 -
08MYB55-4
ш Контроль
? Высокая температура
OSMYB55-11
Фиг. 14
. 2,4-
lf 2,1 ,
|l 1,*-
§ 8 1 2 J S ? 0,9 •
2 &ffl
m Контроль
?Высокая температура
GSMYB5S-4
08МУВ55-11
Ш Контроль
?Высокая температура
OSMYB65-11
22 20 18 g 16 I 14 S 12 8. 10 8
5 4 2 0
8 Контроль
О Высокая температура
' 1
Г-Ж-
¦ 1
- |.-'
OsMVB55-4
OsMYB55-11
ФИГ. 15
Высокая температура в сравнении с контролем
OsMYB55 WT
OsMYBSS WT
Фиг. 16
(SEQ ID N0:6):
bKSRAPCCDKASVKRGPWSPEEPEQLRSYVQRHG^ YTEEEDRIlWSbYSSIGSRWSIIASKLPGRT^DV^W^
APATPTPPAbSPASSSVTSSSGDVRFGAAYTEPQPQPQHPGGLIRFDAPRTELAPVPPAVGAQLDGAWST PVAPALDGGPVFLPEblGGGEQLFPYGGDFFGGLLQPSRALEQLSACYFPNMAEIWGATAAVAAPDGNCK PPGLCNTLT
(SEQ ID N0:14):
ATGGGGCGCGCGCCGTGCTGCGACAAGGCGAGCGTGAAGCGGGGACCCTGGTCGCCTGAGGAGGACGAGC AGCTGCGGAGCTACGTCCAGCGCAACGGCATCGGCGGCAAC7GGATCGCCCTGCCGCAGAAAGCAGGCCT GAACCGGTGCGGCAAGAGCTGCCGGCTGCGGTGGCTCAACTACCTGCGGCCGGACATCAAGCACGGGGGC TACACCGAGGAGCSAGGACCGGATCATCTGGTCGCTCTACAGCTGCATCGGCAGCAGGTGGTCCATCATCG CGTCCAAGCTCCCGGGCCGGACCGACAACGACGTCAAGAACTACTGGAACACCAAGCTCAAGAAGAAGGG CATGGCCATGGC <;GCGGCGGCCGGCCTCAGCGCCAGTAGCAGCGGAGGAGGAGCCTTGGCGGCGGCGGCG GCGCCCGCCACGCCGACGCCGCCGGCGCTCTCGCCCGCCTCCTCGTCCGTCACCAGCTCCAGCGGCGACG TGCGCTTCGGCGCGGCGTACACGGAACCACAACCGCAGCCGCAGCACCCCGGCGGGCTCATACGCTTCGA CGCGCCGCGGACGGAGCTCGCGCCCGTGCCGCGGGCAGTGGGAGCGCAGCTGGACGGCGCCTGGTCGACG CCCGTGGCGCCGGCGCTGGACGGCGGGGACGTGTTGCTGCCCGAGCTCATCGGCGGCGGCGAGCAGCTGT TCCCGTAGGGCGSCGACTTCTTCGGCGGGCTGCTGCAGGACAGCAGGGCCCTGGAGCAGCTCTCGGCGTG
CIACTTCCCCAACATGGCCGAGATATGGGGCGCCACCGCTGCCGTCGCCGCCCCCGACGGCAACTGCAAG CCGCCGGGTCTCTGCAACACCCTGACATAG
(SEQ ID N0:7);
MGRAPCCDKASVKRGPWSPESDKQI.RSYVQLNGIGGNWIALPQKAGLNRCGKSCRLRWLNYLRPNIKHGG YTDEEDRIIWSLYSSIGSRWSIIASKLPGRTDNDVKNYKfNTKLKKKAMAASSSGAAFAAPATPALSPASS CVTSSSSGDVRbGAAYTEPPPPRQHAGLVRSDAPRTEIAPVPAVAHbDGACWPAAAALDVbbPELGGEQL FPYGYGDrPGGbQDRALEQQLSSCYFPNVAEIWGAAAVAPDGKPPGLCNRbT
(SEQ ID NO:15):
AK3GGCCGCGCGCCG243CTGCGACAJVGGCGAGCGTG
GCTGCGGAGCTACGTCCAGCTGAACGGCATCGGCGGCAACTGGATCGCCCTGCCGCAGAftAGCAGGGCTGA ACCGGTGTGGCAAGAGTTGCCGGCTGCGGI'GGCTCAACTACCTGCGGCCGAACATCAAGCACGGCGGCTAC ACCGACGAGGAGGACCGGATCATTTGGTCGCTCTACAGCTCCATCGGCAGCAGGTGGTCGATCATCGCGTC CAAGCTCCCCGGCCGGACCGATAACGACGTCAAGAACTACTGGAACACCAAGCTCAAGAAGAAGGCCATGG CGGCCAGTAGCAGCGGAGCAGCCTTCGCGGCGCCCGCCACGCCGGCGCTCTCGCCCGCCTCCTCGTGCGTC ACCAGCTCCTfiCAGCGGCGACGa'GCGCCTCGGCGCAGCGTACACGGAGCCGCGGCCGCCTCGGCAGCACGC GGGGCTCGTACGCTCTGACGCTCCGCGGACGGAGCTCGCGCCCGTGCCGGCAGTCGCGCACCTGGACGGCG CCTGCTGGCCGGCCGCGGCGGCGCTGGACGTGCTCCTGCCCGAGCTCGGCGGCGAGCAGCTGTTCCCGTAC GGG'rACGGCGAG'rTCTTGGGCGGGCTGCAGGACAGGGCCCTGGAGCAGCAGCTCTGGTCGTGCTACTTCCC CAACGTGGCCGAGATATGGGGCGCCGCTGCCGTCGCCCCCGACGGCAAGCCGCCGGGTCTCTGCAACAGGC TGACGTAG
(SEQ ID N0:8):
MGRAKCDKAWKRGPWSPE^^ FTEEEDKVICAIiT^QMGSRWSVXASQLPGRTDN AAPMPVTEAYRHGFPPLLT^yTGTSmMGVSSre^ GGEDDGVMDFGMGNLPYDIISGFWFQEKDSTEVTPGHDQSR№^
(SEQ ID NO:9):
MG№PeCDKANVKRGPWSPEEDATLKSYLETHGTGGNVnALPQKAGl,KRCGKSCRLRWI.NYLRPDIKHGG FTEEEDNIICTLYSQMGSRWSLIAAQLPGRTDNDVKNYWNTKLKKKIbAGKISLTIKNNPINAPVNVANI PAI PGSTSPILyVPKAETESSVTFSDttYiSLTQISGTLPALSDIGYEPI rNSTAQNLSPNQFQFSSPPGVI DMSE FSMNStHIVS PSQEGSSISDSSSLAMDNKGLSVPSTNGGLEDVGIFMDSEPGFPS DFFNGLLLQDK ASEVATNGYOYFAGFGYVDIKP
(SEQ ID N0:16):
ATGGGGAGAGCTCCTTOTTGTGACA^GCAAACGTG
CTCTCAAAAGCTACCTTGAGACTCATGGCM
TAAGeGATGCGGCAAGAGCTCCCGGTOAa^
TTTACTGAAGAAGAAGACAACATCATATGCACTCTCTATAG'TGAAATGGGAAGCAGATGGTCTCTCATAG CTGCTCAACTGCCTGGAAGAACTGACAACGATCTGAAAAATTACrGGAACACCAAATTGAAAAAGAAGAT TCTTGCGGGAAWiATAAGCCTCACAATCAAGAACAACCGTATCAATGCCCCCGTTAACGTTGCTAATATT CCTGCCATTCCCTGCTCAACATCTCCTATTCTTTATGTCCCTAAAGCTGAAACCGAAAGTTCTGTCACCT TCTCCGATCATTATTCATTAACTCAAATTTCAGGAACATTGCCTGCCTTATCTGATATTGGTTATGAACC TATTATCAATAGCACTGCCCAGAACTTGAGTCCAAACCAATTCCAATTTTCTAGTTTCCCTGGGGTCArT GACATGTCTGAATTTTCAATGAACAGTACTCACATTGTTTCTCCATCTCAAGAAGGTTCGAGCATTTCAG ATTCCTCTTCACTTGCTATGGATAACAAGGGTCTCTCAGTGCCTAGTACTAACGGTGGTCTTGAGGATGT TGGGATATTTATGGATTCCGAACCTGGTTTTCCTAGTGATTTTTTCAATGGCCTTTTGCTTCAAGACAAA GCTAGTGAAGTre'CCACTAATTGCTACCAATATTTTGCT^TTTTGGCTATGTTCATATTAAGGCGTAA
Фиг.ПЕ
(SEQ ID N0:10):
MGRAPCCDKANVKKGPWSPEEDSKLKEYIEKYGT
FSDEEDRIICSLFASIGSRWSVIAAQt.PGRT^
PSSSHMYQNGPi.IPSEPLSSbYKDbSN^
СУКЕЩШЫТЬ1УРС2ЕС8С8Та8ВС8СШ015УОУС8КЗЕГЫЫ.ГЫ0ЕЕМ6КПИ06РММЬЫУСЫ01"ТЕКР NGFYFGSENNTbEFTDLDEDVKCJQblSTRSKNNYNNNTIlNESSKSNSFLFNVNESKTEDDEKVMYPY
(SEQ ID N0:17):
ATGGGGAGGGCTCCTTGTTGTGACAAAGC!AAACG№A
AGCTAAAAGAGTA.CATAGAGAAGTATGGGACTGGTGGGAATTGGATTGCTCTCCCACAGAAAGCTGGTCT GAAGAGATGTGGGAAAAGCTGCAGATTGAGATGGCTTAACTATCTGAGGCCTU^ATCAAACATGGAGAA TTCTCTGATGAGGAAGACAGGATAATATGCAGCCTCTTTGCTAGTATTGGAAGCAGGTGGTCAGTTATAG CTGCTCAGCTGCCAGGCAGGACTGAC"ACGATATCAAGAACTACTGGAACACCAAGCTCAAGAAGAAGCT CATGGGGATGCATATGGGTCCTCCTCGACCTCACAACCACCATAAAAATTTACTAAAGCCTCCCCCATTT CCTTCTTCCTCTCATCACAATTACCAAAACCAACCATTAATTCCATCTGAACCTCTATCGTCGCTGTACA AAGACCTAAGCAATTACAACAGATCTTTCITAGGGTTTGAAGCGCCAGTGCCATTGCCACCACAAGTTTC GCTGACGTCCAATAATTTCTCAAACATTTCCACCAACTCTTCTATTTTTGAAACCCTAAATTACCCAGCT" ССАБТСААСБААААТААСААТААТААТАСССТССТССТСТТТССААБТСААСССАСТТССЛСТАСТ'ГССР CTGATGGAAGCTGTAATAATCAGATCAGCTATGACTACTGCAGCAGATCAGAGATTAATAACATGAACCA AGAAGAAATGGGT'L'TTGATCATCAGGGCTL'CATGATGCTTAACTATGGGAACGAATGGACCGAAAGGGCA AATGGGTTTTATO^TGGATCAGAAAACAACACATTAGAATTTACTGARCTGGACGAAGATGTL'AAGCAGC AGCTGATTAGTACTAGAAGTAAAAATAATTATAATAATAATACTATTATAAATGAGTCCTCTAAGTCTAA CAGCTTTTTATTC:AATGTTAATGAAAGCAAGACAGAAGATGATGAGAAGGTCATGTATTTCTACTGA
(SEQ ID NO: 11):
MGI^PCeDKANVKKGPWSPEED &KL^
FSEEEDNIIGSLyVSKSRWSIIAAQbBGRTDNDIKNXWNTRIJCKKLKKQRKEQQAQ VKRETENLIVASEVMINQVPywSSSEFSSVPMPVTNASSFQHyGLNNQTSLRA
(SEQ ID N0:18):
ATGGGAAGAGCTCCTTGCTGTGACAAAGCCU\ACGTGAAGAAAGGT^^
AACTCAAGTCTTATATTGAGCAGCATGGCACTGGTGGAAACTGGATTGCCTTGCCCCAGAAAATAGGCCT TAAGAGGTGTGGGAAAAGCTGTCGTCTTAAATGGCTGAATTATCTTCGCCCAAACATCAAACATGGGGGT TTCTCAGAAGAAGAAGACAACATCATCTGCAGCCTCTATGTTAGTATTGGAAGCAGGTGGTCAArTATAG CAGCACAGTTACCCGGGCGCACAGACAATGATATAAAGAACTATTGGAACACTAGGCTGAAGAAGAAGCT CCTTGGCAAACAAAGGAAGGAGCAACAGGCTCAAGCTCGCCGAGTCAGCAACAACCAGCAGAAGCAAGAT GTCAAAAGAGAAACCGAGAATTTGATAGTGGCTTCTGAAGTCATGATGAATCAAGTrGCCTATTGGTCTr CTTCAGAGTTTTCTTCTGTGCCTATGCCAGTGACCAATGCTTCTTCATTTCAACACTATGGTCTGAACAA TCAAACATCTCTCAGAGCATGA
(SEQIDNO:12):
MGRAPCCDKASVl^GPWSPEEDQ^
FSDDEDRIIGTbFANiGSRWSIIAGQLPGRTDNBlKNi'WNTKLKKKLLMS YUiSSPSPSSYSSPLPPfLRLCDNNYPTMASRS^ IMFGGAGDDQ.QAASSSSҐOTHF^FSNCG^ ISTTNLSCNSNLSFFVDBNKTVRSEEEKVIJMYY
(SEQ ID N0:19):
ATGGGGAGAGCTCCTTGCTGTGACAAGGCAAGTGrAAAGAGAGGGCCATGGTCAeCTGAAGAAGATCAGA AGCTAAAAGACTATATAGAGAAGCATGGGACTGGAGGAAACTGGATTGCTCTACCACAAAAGGCTGGTCT TAGAAGATGTGGGAAAAGCTGCAGATTAAGATGGCTCAACTATCTCAGGCCTAACATTAAACATGGAGAA TTTTCAGATGATGAAGATAGGATCATATGCACCCTCTTTGCCAATATTGGGAGCAGGTGGTCAATAATAG CAGGTCAGTTACCAGGGAGGACTGACAATGATATCAAGAACTACTGGAACACCAAGCTCAAGAAGAAACT CCTCATCTCTTCATTAATGCTCCCTAATCCTTTTGTTAGGCCTCCTAATAATATTAATAACTACCAACAA TACCTATTATCATCACCATCTCCTTCTTCATATTCCTCCCCATTGCCrCCAACATTGAGAC'ITTGTGACA ACAATTACCCAACCCTAGGTGCTTCTAGGTCATTCACAAGTGAGGGCTTCTCAAATATTTCAACAAACCT CTTTAATATCCAGCCTCAAGATCAGGGTTTGGGTCCCATGCAAAATTATCAAGAGAAAGAATCACCTCTC ATTATGTTTGGAGGGGCAGGTGATGATCAGCAAGCTGCTAGCTCTAGTTCTTATGATGAACATTTCATGA TGTTC'J'CCAACTGTGGGATGAATAATATTTCTGATCAACAGAAGCAAGTAAATCTTGGTGTGTCTAGTGG TGATCATGAGATTGTTAGCAATGTACTGGATCAGTATAACATGAGCTGTGTTGAGGAGATTAAGCAACTG ATTAGCACTACTAATCTGTCATGTAATTCTAATCTGAGTTTCTTTGTTGATGAAAACAAGACAGTGAGAA GTGAGGAGGAGftAAGTGfTGATGTAGTAGfGA
(SEQ ID N0:13):
MGPAPCCDKANVKKQPWSPEBDVKLKOYIDKyGTGGNWIALPCKIGLKRCGKSCRLW^LNyLRPNIKHGG FSEEBDRIILS^SIGSRWSIX &AGLFGRTWDIKN^
NNNNKSPQNLSNSALERLQbHMQLQNLQSPFSSFYNNPILWPKLHPLLQSTTTNQNPKLASQESFHFLGV NVDHQHNЬ№KrЛQINNGASSLYSENVEQSQNPAHEFQPNFGFSQDLRLDNHШDFMNRGVSKELFQVGNE FELTNGSSWWSEEVELERKTTSSSSWGSASVLDQTTEGMVMLQDYAQMSYHSV
(SEQ ID N0:20):
ATGGGAAGAGCTCCATGCTGCGACAAGGCAAACGTGAAGAAAGGACCATGGTCACCGGAAGAAGATGTGA AGCTCAAGGATTACATCGACAAATATGGCACTGGTGGCAACTGGATCGCACTGCCTCAGAAAATTGGGCT GAAGAGATGTGGTAAGAGTTGCAGACTGAGATGGCTTAATTACTTAAGACCAAACATCAAACATGGTGGT TTTTCTGAGGAAGAAGATAGAATCATCTTGAGTCTCTACATTAGCATTGGAAGCCGGTGGTCCATAA3TG CAGCTCAGCTTCCEGGAAGGACTGACAATGATATCAAGAATTATTGGAACACAAAACTGAAGAAGAAACT TCTAGGAAGACAGAAACAAATGAATCGTCAAGACTCCATAACCGATTCTACTGAGAACAACCTCAGGAAC AATAACAACAATAAGAGTCCTCAGAATCTG/iGCAATTCGGCACTGGAGAGGCTCCAGCTTCACATGSAGC TTCAGAATCTACAGAGCCCTTTCTCTAGTrTCTACAACAACCCTATCTTGrGGCCCAAGCTTCATCCATT GCTCCAGAGCACTACAAGTAATCAAAACCCTAAGCTTGGATCTCAAGAAAGGTTCCAGCCTTTAGGAGTT AACGTTGATCATCAGCACAACAATACCAAGCTAGCTCAGATAAACAATGGAGCCTCTTCTCTCTAfTCGG AGAACGTAGAGCAATCCCAAAACCCTGCTCATGAATTTCAACCTAATTTCGGTTTTTCACAGGACCaTCG ATTAGATAATCATAACATGGACTTTATGAACAGAGGGGTTTCTAAAGAACTGTTTCAAGTGGGCAACGAG TTTGAGGTAACGAACGGTTCGAGTTGGTGGTCAGAGGAAGTGGAACTAGAGAGGAAAACGACGTCGTCGA GTTCTTGGGGGTCAGCTTCTGTGCTTGATCAGACAACTCAGGGAATGGTTATGCTTCAAGATTACGCTCA GATGAGCTACCACAGTGTTTAA
100
100
102
101
102
103
104
105
107
107
108
108
109
112
112
120
120
121
121
122
122
123
123
124
124
124
124
126
126
127
127
128
128
Фиг. IB
Фиг. IB
Фиг. 1С
Фиг. 1С
Фиг. 1С (продолжение)
Фиг. 1С (продолжение)
Фиг. ID
Фиг. ID
Фиг. ID (продолжение)
Фиг. ID (продолжение)
Фиг. IE
Фиг. IE
Фиг. IF
Фиг. IF
Фиг. 3
Фиг. 3
Фиг. 3
Фиг. 3
Фиг. 3
Фиг. 3
Фиг. 17А
Фиг. 17А
Фиг. 17В
Фиг. 17В
Фиг. 17С
Фиг. 17С
Фиг. 17D
Фиг. 17D
Фиг. 17F
Фиг. 17F
Фиг. 17G
Фиг. 17G
Фиг. 17Н
Фиг. 17Н