Патентная документация ЕАПВ

 
Запрос :  ea201390206a*\id

больше ...
Термины запроса в документе


Полный текст патента

(57) Реферат / Формула:

В настоящем изобретении предложены стабильные водные составы, включающие полипептид бГ-КСФ или его вариант, буферное вещество и вспомогательное вещество, причем состав, по существу, не содержит полиоксиэтилен (20) сорбитанмонолаурат. В настоящем изобретении также предложены способы применения лиофилизированной или порошкообразной формы состава, а также способы получения состава.


Евразийское (21) 201390206 (13) A1
патентное
ведомство
(12) ОПИСАНИЕ ИЗОБРЕТЕНИЯ К ЕВРАЗИЙСКОЙ ЗАЯВКЕ
(43) Дата публикации заявки 2013.09.30
(22) Дата подачи заявки
2011.09.22
(51) Int. Cl.
A61K38/19 (2006.01) C07K14/535 (2006.01) A61P29/00 (2006.01)
(54) СОСТАВЫ ДЛЯ БЫЧЬЕГО ГРАНУЛОЦИТАРНОГО КОЛОНИЕСТИМУЛИРУЮЩЕГО ФАКТОРА И ЕГО ВАРИАНТОВ
(31) 61/385,629
(32) 2010.09.23
(33) US
(86) PCT/US2011/052692
(87) WO 2012/040421 2012.03.29
(71) Заявитель:
ЭЛИ ЛИЛЛИ ЭНД КОМПАНИ (US)
(72) Изобретатель:
Давагнино Хуан, Кха Кейтрин Нган, Клотц Алан Воскамп (US)
(74) Представитель: Лыу Т.Н. (RU)
(57) В настоящем изобретении предложены стабильные водные составы, включающие полипептид бГ-КСФ или его вариант, буферное вещество и вспомогательное вещество, причем состав, по существу, не содержит полиоксиэтилен (20) сорби-танмонолаурат. В настоящем изобретении также предложены способы применения лиофилизиро-ванной или порошкообразной формы состава, а также способы получения состава.
СОСТАВЫ ДЛЯ БЫЧЬЕГО ГРАНУЛОЦИТАРНОГО КОЛОНИЕСТИМУЛИРУЮЩЕГО ФАКТОРА И ЕГО ВАРИАНТОВ
Гранулоцитарный колониестимулирующий фактор (Г-КСФ) является членом суперсемейства генов гормонов роста. Г-КСФ стимулирует пролиферацию специфических клеток-предшественников костного мозга и их дифференцировку в гранулоциты. Кроме того, Г-КСФ является мощным стимулятором пролиферации и созревания нейтрофилов in vivo (Cohen et al., Proc. Natl. Acad. Sci. 1987; 84: 2484-2488; see also Heidari et al., Vet. Immol. Imunopathol. 2001; 81:45-57). Г-КСФ также способен индуцировать функциональную активацию или "праймирование" зрелых нейтрофилов in vitro (Weisbart, R. H. et al, Annals of Internal Medicine 1989; 110:297-303). Было показано, что Г-КСФ праймирует гранулоциты человека, повышает высвобождение супероксид-радикала, стимулированное хемотаксическим пептидом N-формил-метионил-лейцил-фенилаланином (S. Kitagawa, et al, Biochem. Biophys. Res. Commun. 1987; 144:1143-1146, и С. F. Nathan, Blood 1989; 74:301-306) и активирует IgA-опосредованный фагоцитоз в нейтрофилах человека (Weisbart, R. Н., et al, Nature 1988; 332: 647-649).
Обнаружено, что Г-КСФ можно применять в лечении состояний, при которых полезно увеличение количества нейтрофилов. Г-КСФ также можно применять в виде монотерапии или в комбинации с другими соединениями (такими, как другие цитокины) для выращивания или размножения клеток в культуре, например, для трансплантатов костного мозга.
Были описаны методики клонирования кДНК и экспрессии рекомбинантного Г-КСФ человека (чГ-КСФ), при этом рекомбинантный чГ-КСФ демонстрирует большую часть, если не все, биологические свойства природной молекулы (Souza, L. et al., Science 232, 61-65 (1986)). Анализ последовательности кДНК и клонов геномной ДНК позволил предсказать аминокислотную последовательность фактора и выявил, что белок содержит 204 аминокислоты с сигнальной последовательностью, состоящей из 30 аминокислот. Зрелый белок содержит 174 аминокислоты и не обладает центрами для потенциального N-связанного гликозилирования, но имеет несколько центров для возможного О-связанного гликозилирования.
Фармацевтические препараты, содержащие чГ-КСФ, известны в данной области техники и включают многочисленные составы. Например, различные составы чГ-КСФ описаны в Piedmonte et al., Advanced Drug Delivery Reviews, 60: 50-58 (2008), Herman et al, Formulation, Characterization, and Stability of Protein Drugs, Rodney Pearlman and
Y. John Wang, eds., Plenum Press, New York (1996), в патенте США №5919757 Michaelis et al., и патенте США №6908610 Sato et al. Традиционно в составы чГ-КСФ включают поверхностно-активные вещества, которые могут защитить чГ-КСФ от потенциально дестабилизирующих условий, возникающих на границе раздела фаз, от поверхностей, возникающих в ходе приготовления, а также против изменения его конформационной стабильности.
Также были описаны способы клонирования кДНК и экспрессии рекомбинантного бычьего Г-КСФ (6Г-КСФ). Например, в патенте США №5849883 раскрыты полинуклеотидная и полипептидная последовательности зрелого 6Г-КСФ, а также описан способ клонирования, выделения и очистки полипептида и его аналогов. Зрелый 6Г-КСФ содержит 174 аминокислоты и имеет 82% гомологии с чГ-КСФ. В работе Heidari et al., упомянутой выше, описан способ экспрессии и очистки 6Г-КСФ, а также его биологические активности.
Введение 6Г-КСФ крупному рогатому скоту может обеспечить терапевтические преимущества. Соответственно, для того чтобы использовать терапевтический потенциал 6Г-КСФ, нужен фармацевтический состав, содержащий 6Г-КСФ. Тем не менее, фармацевтические составы 6Г-КСФ, разработанные в соответствии с традиционными способами, известными в данной области техники, приводят к возникновению нежелательных свойств препарата, таких как агрегация и дестабилизация 6Г-КСФ полипептида и/или состава.
Таким образом, существует потребность в стабильном фармацевтическом составе 6Г-КСФ с заданными свойствами, такими как минимальная агрегации и дестабилизирующие свойства продукта. Соответственно, согласно настоящему изобретению предложены стабильные водные фармацевтические составы, содержащие полипептид 6Г-КСФ или его вариант, которые обладают желаемыми свойствами, а также обеспечивают соответствующие преимущества.
В настоящем изобретении предложены стабильные водные составы, включающие полипептид 6Г-КСФ или его вариант, буферное вещество и вспомогательное вещество, причем указанный состав по существу не содержит полиоксиэтилен (20) сорбитанмонолаурата. В настоящем изобретении также предложены способы применения состава в лиофилизированной или порошкообразной форме, а также способ приготовления состава.
Стабильные водные составы бычьего гранулоцитарного
колониестимулирующего фактора ("6Г-КСФ") согласно настоящему изобретению содержат полипептид 6Г-КСФ или его вариант. В настоящей заявке "бычий
полипептид Г-КСФ" (называемый также "полипептид 6Г-КСФ", "бычий Г-КСФ" или "6Г-КСФ") и его варианты будут включать полипептиды и белки, которые имеют по меньшей мере один вид биологической активности КСФ, аналоги 6Г-КСФ, мутированные варианте 6Г-КСФ, модифицированный гликозилированный 6Г-КСФ, конъюгированный с ПЭГ 6Г-КСФ, изоформы 6Г-КСФ, миметики 6Г-КСФ, фрагменты 6Г-КСФ, гибридные белки 6Г-КСФ, рекомбинантные белки, олигомеры и мультимеры, гомологи, варианты с различными типами гликозилирования, варианты, сплайс-варианты и их мутеины, независимо от их биологической активности, а также независимо от способа их синтеза или изготовления, включая, но не ограничиваясь перечисленными: рекомбинантные (независимо от того из каких видов ДНК, например, кДНК, геномной ДНК, синтетической ДНК или других форм нуклеиновых кислот, получен препарат), in vitro, in vivo, микроинъекции молекул нуклеиновой кислоты, синтетические, трансгенные и ген-активирующие способы. Кроме того, термин "полипептид 6Г-КСФ или его вариант" включает полипептиды 6Г-КСФ, содержащие одну или несколько аминокислотных замен, добавлений или делеций. Примеры аналогов бычьего Г-КСФ приведены в патенте США №5849883. Последовательность зрелого полипептида 6Г-КСФ, составляющая 174 аминокислоты в длину, приведена ниже:
TPLGPARSLPQSFLLKCLEQVRKIQADGAELQERLCAAHKL CHPEELMLLRHSLGIPQAPLSSCSSQSLQLTSCLNQLHGGLF LYQGLLQALAGISPELAPTLDTLQLDVTDFATNIWLQMEDL GAAPAVQPTQGAMPTFTSAFQRRAGGVLVASQLHRFLELAY RGLRYLАЕР
Далее, последовательность полипептида 6Г-КСФ с начальным метиониновым аминокислотным остатком приведена ниже:
MTPLGPARSLPQSFLLKCLEQVRKIQADGAELQERLCAAHK LCHPEELMLLRHSLGIPQAPLSSCSSQSLQLTSCLNQLHGGL FLYQGLLQALAGISPELAPTLDTLQLDVTDFATNIWLQMED LGAAPAVQPTQGAMPTFTSAFQRRAGGVLVASQLHRFLELA YRGLRYLАЕР
Были описаны замены аминокислот в самых разнообразных положениях последовательности 6Г-КСФ. Термин "полипептид 6Г-КСФ или его вариант" охватывает замены, включая, но не ограничиваясь, теми, которые модулируют фармацевтическую стабильность, повышают активность агониста, увеличивают устойчивость к действию протеаз, превращают полипептид в антагонист и т.д.
Термин "полипептид 6Г-КСФ или его вариант" также включает гликозилированные формы 6Г-КСФ, включая, но не ограничиваясь перечисленнми: полипептиды, гликозилированные по любому положению аминокислоты, N-связанные гликозилированные формы полипептида или О-связанные гликозилированные формы полипептида. Варианты, содержащие однокуклеотидные замены, также рассматриваются как биологически активные варианты полипептида 6Г-КСФ. Варианты, содержащие однокуклеотидные замены, также рассматриваются как биологически активные варианты 6Г-КСФ. Кроме того, включены сплайс-варианты. Термин "полипептид 6Г-КСФ или его вариант" также включает 6Г-КСФ гетеродимеры, гомодимеры, гетеромультимеры или гомомультимеры любого одного или нескольких 6Г-КСФ или любого другого полипептида, белка, углевода, полимера, низкомолекулярного соединения, линкера, лиганда или другой активной молекулы любого типа, связанные с помощью химических средств или экспрессированные в виде рекомбинантного белка (см., например, патенты США № 6261550, 6166183, 6204247, 6261550 и 6017876), а также полипептидные аналоги, содержащие, например, конкретные делеции или иные изменения, но сохраняющие биологическую активность (см., например, патенты США № 6261550, 6004548 и 6632426). Полипептиды 6Г-КСФ и их варианты описаны, например, в заявке на патент США 12/507237 (в настоящее время публикация патентной заявки США 2010/0035812) и приведены в настоящей заявке в качестве ссылки. Согласно некоторым вариантам реализации изобретения одна или несколько некодируемых в природе аминокислот встроены в одной или нескольких позициях в последовательности 6Г-КСФ, включая 8, 62, 69, 125, 133, 136 и любую их комбинацию (зрелый полипептид 6Г-КСФ или соответствующие аминокислоты в полипептиде 6Г-КСФ с начальным метиониновым аминокислотным остатком). Согласно некоторым вариантам реализации изобретения неприродная аминокислота пара-ацетилфенилаланин (pAF) заменяет природную аминокислоту в одной из следующих позиций: S8, S62, L69, G125, Т133, А136 и любой их комбинации (зрелый полипептид 6Г-КСФ или соответствующие аминокислоты в полипептиде 6Г-КСФ с начальным метиониновым аминокислотным остатком).
Согласно одному варианту реализации изобретения полипептид 6Г-КСФ или его вариант представляет собой бГ-КСФ-SSpAF, который имеет последовательность: MTPLGPARSLPQSFLLKCLEQVRKIQADGAELQERLCAAHK LCHPEELMLLRHSLGIPQAPLSSCSSQSLQLTSCLNQLHGGL FLYQGLLQALAGISPELAPTLDTLQLDVTDFATNIWLQMED
LGAAPAVQPTQGAMPTFTSAFQRRAGGVLVASQLHRFLELA YRGLRYLАЕР
в которой одна аминокислота заменена на пара-ацетилфенилаланин в положении
S8.
Согласно одному варианту реализации изобретения полипептид 6Г-КСФ или его вариант представляет собой 6r-KCO-S62pAF, который имеет последовательность: MTPLGPARSLPQSFLLKCLEQVRKIQADGAELQERLCAAHK LCHPEELMLLRHSLGIPQAPLSSCSSQSLQLTSCLNQLHGGL FLYQGLLQALAGISPELAPTLDTLQLDVTDFATNIWLQMED LGAAPAVQPTQGAMPTFTSAFQRRAGGVLVASQLHRFLELA YRGLRYLАЕР
в которой одна аминокислота заменена на пара-ацетилфенилаланин в положении
S62.
Согласно одному варианту реализации изобретения полипептид 6Г-КСФ или его вариант представляет собой 6r-KCO-L69pAF, который имеет последовательность: MTPLGPARSLPQSFLLKCLEQVRKIQADGAELQERLCAAHK LCHPEELMLLRHSLGIPQAPLSSCSSQSLQLTSCLNQLHGGL FLYQGLLQALAGISPELAPTLDTLQLDVTDFATNIWLQMED LGAAPAVQPTQGAMPTFTSAFQRRAGGVLVASQLHRFLELA YRGLRYLАЕР
в которой одна аминокислота заменена на пара-ацетилфенилаланин в положении
L69.
Согласно одному варианту реализации изобретения полипептид 6Г-КСФ или его вариант представляет собой 6r-KCO-G125pAF, который имеет последовательность: MTPLGPARSLPQSFLLKCLEQVRKIQADGAELQERLCAAHK LCHPEELMLLRHSLGIPQAPLSSCSSQSLQLTSCLNQLHGGL FLYQGLLQALAGISPELAPTLDTLQLDVTDFATNIWLQMED LGAAPAVQPTQGAMPTFTSAFQRRAGGVLVASQLHRFLELA YRGLRYLАЕР
в которой одна аминокислота заменена на пара-ацетилфенилаланин в положении G125.
Согласно одному варианту реализации изобретения полипептид 6Г-КСФ или его вариант представляют собой 6r-KCO-T133pAF, который имеет последовательность:
MTPLGPARSLPQSFLLKCLEQVRKIQADGAELQERLCAAHK LCHPEELMLLRHSLGIPQAPLSSCSSQSLQLTSCLNQLHGGL FLYQGLLQALAGISPELAPTLDTLQLDVTDFATNIWLQMED LGAAPAVQPTQGAMPTFTSAFQRRAGGVLVASQLHRFLELA YRGLRYLAEP
в которой одна аминокислота заменена на пара-ацетилфенилаланин в положении
Т133.
Согласно одному варианту реализации изобретения полипептид 6Г-КСФ или его вариант представляет собой 6r-KCO-A136pAF, который имеет последовательность: MTPLGPARSLPQSFLLKCLEQVRKIQADGAELQERLCAAHK LCHPEELMLLRHSLGIPQAPLSSCSSQSLQLTSCLNQLHGGL FLYQGLLQALAGISPELAPTLDTLQLDVTDFATNIWLQMED LGAAPAVQPTQGAMPTFTSAFQRRAGGVLVASQLHRFLELA YRGLRYLАЕР
в которой одна аминокислота заменена на пара-ацетилфенилаланин в положении А136.
Состав согласно настоящему изобретению может включать полипептид 6Г-КСФ или его вариант, который связан с линкером, полимером или биологически активной молекулой. Линкеры, полимеры и биологически активные молекулы описаны в заявке на патент США 12/507237 (в настоящее время публикация патентной заявки США 2010/0035812). В настоящей заявке термин "связь" или "линкер" используется для обозначения группы или связей, которые обычно образуются в результате химической реакции и обычно представляют собой ковалентные связи. Гидролитически стабильные связи - это связи, которые по существу стабильны в воде и не реагируют с водой при используемых значениях рН, включая, но не ограничиваясь физиологическими условиями в течение длительного периода времени, возможно, даже в течение неопределенного срока. Гидролитически нестабильные или разлагаемые связи - это связи, которые разлагаются в воде или в водном растворе, включая, например, кровь. Ферментативно нестабильные или разлагаемые связи - это связи, которые могут разрушаться одним или несколькими ферментами. Для специалиста в соответствующей области техники очевидно, что ПЭГ и родственные полимеры могут включать разлагаемые связи в основной цепи полимера или в линкерной группе между основной цепью полимера и одной или несколькими концевыми функциональными группами молекулы полимера. Например, эфирные связи, образованные в результате реакции ПЭГ-карбоновых кислот или
активированных ПЭГ-карбоновых кислот со спиртовыми группами на биологически активных агентах, обычно гидролизуются в физиологических условиях для высвобождения агента. Другие гидролитически разлагаемые связи включают, но не ограничиваются, карбонатные связи; иминные связи, образующиеся в результате реакции аминов и альдегидов; фосфоэфирные связи, образующиеся при взаимодействии спирта с фосфатной группой; гидразонные связи, которые являются продуктом реакции гидразида и альдегида, ацетальные связи, которые являются продуктом реакции альдегида и спирта; ортоэфирные связи, которые являются продуктом реакции формиата и спирта; пептидные связи, образованные аминогруппой, включая, группу на конце полимера, такого как ПЭГ, и карбоксильной группой пептидов, но не ограничиваясь ей, и олигонуклеотидные связи, образованные фосфорамидитной группой, включая группу на конце полимера, а также 5'-ОН группу олигонуклеотида, но не ограничиваясь ей.
Согласно некоторым вариантам реализации полипептид 6Г-КСФ или его вариант связан с водорастворимым полимером. В настоящей заявке термин "водорастворимый полимер" относится к любому полимеру, который является растворимым в водных растворах. Связь водорастворимых полимеров с полипептидом 6Г-КСФ или его вариантом может привести к изменениям, которые включают, но не ограничиваются перечисленными: увеличенный или измененный период полужизни в сыворотке, увеличенный или измененный терапевтический период полужизни по отношению к исходной форме, измененную иммуногенность, измененные физические характеристики ассоциации, такие как агрегация и формирование мультимеров, измененное связывание с рецептором, измененное связывание с одним или несколькими партнерами связывания, а также измененную димеризацию или мультимеризацию рецептора. Водорастворимый полимер может иметь или не иметь собственной биологической активности и может быть использован в качестве ликера для связывания 6Г-КСФ с другими веществами, включая один или несколько полипептидов 6Г-КСФ или его вариантов, или одну или несколько биологически активных молекул, но не ограничиваясь ими. Подходящие полимеры включают, но не ограничиваются, полиэтиленгликоль, пропиональдегид полиэтиленгликоля, производные моно-С1-С10 алкокси или их арилокси (описаны в патенте США №5252714), монометокси-полиэтиленгликоль, поливинилпирролидон, поливиниловый спирт, полиаминокислоты, дивиниловый эфир малеинового ангидрида, N-(2-гидроксипропил)-метакриламид, декстран, производные декстрана, включая сульфат декстрана, полипропиленгликоль, сополимер полипропиленоксид/этиленоксид,
полиоксиэтилированный полиол, гепарин, гепариновые группы, полисахариды, олигосахариды, гликаны, целлюлозу и производные целлюлозы, включая, но не ограничиваясь, метилцеллюлозу и карбоксиметилцеллюлозу, крахмал и производные крахмала, полипептиды, полиалкиленгликоль и его производные, сополимеры полиалкиленгликолей и их производные, этиловый эфир поливинилового спирта, а также альфа-бета-поли[(2-гидроксиэтил)-ОЬ-аспартамид, и т.п. или их смеси. Примеры таких водорастворимых полимеров включают полиэтиленгликоль и сывороточный альбумин,, но не ограничиваются ими. В патентах WO 03/074087 и WO 03/074088 описана конъюгация белков или небольших молекул с гидроксиалкил крахмалом (HAS). Примеры гидроксиалкил крахмалов, включают гидроксиэтил крахмал, но не ограничиваются им. Конъюгаты гидроксиалкил крахмала и другой молекулы, например, могут включать ковалентную связь между концевыми альдегидными группами гидроксиалкил крахмала и реактивными группами другой молекулы.
Согласно некоторым вариантам реализации изобретения водорастворимый полимер представляет собой полиэтиленгликолевый фрагмент. Согласно некоторым вариантам реализации изобретения полиэтиленгликолевый фрагмент имеет молекулярную массу приблизительно от 0,1 кДа до 100 кДа. Согласно другому варианту водорастворимый полимер имеет молекулярную массу приблизительно от 0,1 кДа до 50 кДа. Согласно некоторым вариантам реализации изобретения водорастворимый полимер имеет молекулярную массу приблизительно от 10 кДа до 30 кДа. Согласно другому варианту водорастворимый полимер имеет молекулярную массу приблизительно от 15 кДа до 25 кДа. В еще одном варианте реализации водорастворимый полимер имеет молекулярную массу приблизительно 20 кДа. Для специалиста в данной области техники будет очевидно, что водорастворимый полимер с молекулярной массой "приблизительно 20 кДа" включает полимеры с вариациями молекулярной массы примерно на 15 % (т.е. от 17 кДа до 23 кДа) на основании технических характеристик и полидисперсии фрагмента.
Согласно одному варианту реализации полипептид 6Г-КСФ или его вариант представляет собой 6r-KCO-S8pAF, который имеет последовательность: MTPLGPARSLPQSFLLKCLEQVRKIQADGAELQERLCAAHK LCHPEELMLLRHSLGIPQAPLSSCSSQSLQLTSCLNQLHGGL FLYQGLLQALAGISPELAPTLDTLQLDVTDFATNIWLQMED LGAAPAVQPTQGAMPTFTSAFQRRAGGVLVASQLHRFLELA YRGLRYLАЕР
в которой одна аминокислота в положении S8 заменена на пара-ацетилфенилаланин (pAF), который связан с полиэтиленгликолевым фрагментом. Например, если полиэтиленгликолевый фрагмент имел молекулярную массу около 20 кДа, полипептид 6Г-КСФ или его вариант согласно этому варианту реализации изобретения мог быть идентифицирован как "6r-KC Согласно одному варианту реализации полипептид 6Г-КСФ или его вариант представляет собой 6r-KCO-S62pAF, который имеет последовательность:
MTPLGPARSLPQSFLLKCLEQVRKIQADGAELQERLCAA HKLCHPEELMLLRHSLGIPQAPLSSCSSQSLQLTSCLNQLHG GLFLYQGLLQALAGISPELAPTLDTLQLDVTDFATNIWLQM EDLGAAPAVQPTQGAMPTFTSAFQRRAGGVLVASQLHRFLE LAYRGLRYLАЕР
в которой одна аминокислота в положении S62 заменена на пара-ацетилфенилаланин (pAF), который связан с полиэтиленгликолевым фрагментом. Например, если полиэтиленгликолевый фрагмент имел молекулярную массу около 20 кДа, полипептид 6Г-КСФ или его вариант согласно этому варианту реализации изобретения мог быть идентифицирован как "6r-KCO-S62pAF-20K ПЭГ", что указывает на то, что полиэтиленгликолевый фрагмент массой 20 кДа связан с заменой pAF в положение S62.
Согласно одному варианту реализации изобретения полипептид 6Г-КСФ или его вариант представляет собой 6r-KCO-L69pAF, который имеет последовательность: MTPLGPARSLPQSFLLKCLEQVRKIQADGAELQERLCAAHK LCHPEELMLLRHSLGIPQAPLSSCSSQSLQLTSCLNQLHGGL FLYQGLLQALAGISPELAPTLDTLQLDVTDFATNIWLQMED LGAAPAVQPTQGAMPTFTSAFQRRAGGVLVASQLHRFLELA YRGLRYLАЕР
в которой одна аминокислота в положении L69 заменена на пара-ацетилфенилаланин (pAF), который связан с полиэтиленгликолевым фрагментом. Например, если полиэтиленгликолевый фрагмент имел молекулярную массу около 20 кДа, полипептид 6Г-КСФ или его вариант согласно этому варианту реализации изобретения мог быть идентифицирован как "6r-KCO-L69pAF-20K ПЭГ", это свидетельствует о том, что полиэтиленгликолевый фрагмент массой 20 кДа связан с заменой pAF в положение LS69.
Согласно одному варианту реализации изобретения полипептид 6Г-КСФ или его вариант представляет собой 6r-KCO-G125pAF, который имеет последовательность: MTPLGPARSLPQSFLLKCLEQVRKIQADGAELQERLCAAHK LCHPEELMLLRHSLGIPQAPLSSCSSQSLQLTSCLNQLHGGL FLYQGLLQALAGISPELAPTLDTLQLDVTDFATNIWLQMED LGAAPAVQPTQGAMPTFTSAFQRRAGGVLVASQLHRFLELA YRGLRYLАЕР
в которой одна аминокислота в положении G125 заменена на пара-ацетилфенилаланин (pAF), который связан с полиэтиленгликолевым фрагментом. Например, если полиэтиленгликолевый фрагмент имел молекулярную массу около 20 кДа, полипептид 6Г-КСФ или его вариант согласно этому варианту реализации изобретения мог быть идентифицирован как "6r-KCO-S125pAF-20K ПЭГ", это свидетельствует о том, что полиэтиленгликолевый фрагмент массой 20 кДа связан с заменой pAF в положение G125.
Согласно одному варианту реализации изобретения полипептид 6Г-КСФ или его вариант представляет собой 6r-KCO-T133pAF, который имеет последовательность: MTPLGPARSLPQSFLLKCLEQVRKIQADGAELQERLCAAHK LCHPEELMLLRHSLGIPQAPLSSCSSQSLQLTSCLNQLHGGL FLYQGLLQALAGISPELAPTLDTLQLDVTDFATNIWLQMED LGAAPAVQPTQGAMPTFTSAFQRRAGGVLVASQLHRFLELA YRGLRYLАЕР
в которой одна аминокислота в положении Т133 заменена на пара-ацетилфенилаланин (pAF), который связан с полиэтиленгликолевым фрагментом. Например, если полиэтиленгликолевый фрагмент имел молекулярную массу около 20 кДа, полипептид 6Г-КСФ или его вариант согласно этому варианту реализации изобретения мог быть идентифицирован как "бГ-КСФ-Т133рАР-20К ПЭГ", это свидетельствует о том, что полиэтиленгликолевый фрагмент массой 20 кДа связан с заменой pAF в положение Т133.
Согласно одному варианту реализации изобретения полипептид 6Г-КСФ или его вариант представляет собой бГ-КСФ-А136рАР, который имеет последовательность: MTPLGPARSLPQSFLLKCLEQVRKIQADGAELQERLCAAHK LCHPEELMLLRHSLGIPQAPLSSCSSQSLQLTSCLNQLHGGL FLYQGLLQALAGISPELAPTLDTLQLDVTDFATNIWLQMED LGAAPAVQPTQGAMPTFTSAFQRRAGGVLVASQLHRFLELA YRGLRYLАЕР
в которой одна аминокислота в положении А136 заменена на пара-ацетилфенилаланин (pAF), который связан с полиэтиленгликолевым фрагментом. Например, если полиэтиленгликолевый фрагмент имел молекулярную массу около 20 кДа, полипептид 6Г-КСФ или его вариант согласно этому варианту реализации изобретения мог быть идентифицирован как "бГ-КСФ-А136рАБ-20К ПЭГ", это свидетельствует о том, что полиэтиленгликолевый фрагмент массой 20 кДа связан с заменой pAF в положение А136.
В настоящей заявке термины "стабильность" и "стабильный" применительно к составу, содержащему полипептид 6Г-КСФ или его вариант, относятся к термическому и химическому разворачиванию, агрегации, деградации, денатурации, фрагментации или дестабилизации полипептида 6Г-КСФ или его варианта в конкретных условиях производства, приготовления, транспортировки и хранения. Согласно настоящему изобретению "стабильный" состав поддерживает структурную целостность, что приводит к сохранению биологической активности, предпочтительно более чем на 80 %, 85 %, 90 %, 95 %, 98 %, 99 % или 99,5 % в конкретных условиях производства, приготовления, транспортировки и хранения. Стабильность состава может быть оценена по степени агрегации, депегилирования, деградации, денатурации или фрагментации способами, известными специалистам в данной области и описанными далее в настоящей заявке.
В настоящей заявке термин "водный" применительно к составу, содержащему полипептид 6Г-КСФ или его вариант, относится к воде, одному или нескольким водорастворимым органическим растворителям или их смеси. В настоящей заявке термин "органический растворитель" используется в общепринятом смысле для обозначения жидких органических соединений, как правило, мономерного органического вещества в виде жидкости, предпочтительно относительно невязкой жидкости, молекулярная структура которой содержит атомы водорода, атомы углерода и возможно другие атомы, и которая способна растворять твердые вещества, газы или жидкости.
Фармацевтические составы согласно изобретению могут содержать фармацевтически приемлемый носитель. Фармацевтически приемлемые носители частично определяются конкретной композицией, которую вводят, а также конкретным способом введения композиции (см., например, Remington's Pharmaceutical Sciences, 17th ed. 1985)). Подходящие фармацевтически приемлемые носители включают, но не ограничиваются перечисленными: буферы и вспомогательные вещества, например, содержащие нормальный солевой раствор,
буферный раствор, декстрозу, воду, глицерин, этанол и/или их комбинации. Подходящие носители могут включать буферные вещества, содержащие сукцинат, фосфат, борат, HEPES, цитрат, гистидин, имидазол, ацетат, бикарбонат натрия, и другие органические кислоты. Подходящие носители могут быть представлены вспомогательными веществами, содержащими многоатомные сахарные спирты, аминокислоты, такие как аргинин, лизин, глицин, глутамин, аспарагин, гистидин, аланин, орнитин, лейцин, фенилаланин, глутаминовая кислота, треонин и др., органические сахара или сахарные спирты, такие как лактоза, трегалоза, стахиоза, маннит, сорбит, ксилит, рибит, миоинозитол, галактит, глицерин и т.п. , в том числе циклические спирты, такие как инозит; полиэтиленгликоль; полиаминокислоты; серосодержащие восстановители, такие как мочевина, глутатион, тиоктовая кислота, тиогликолят натрия, тиоглицерин, а-монотиоглицерин и тиосульфат натрия; низкомолекулярные полипептиды (т.е. <10 остатков); белки, такие как человеческий сывороточный альбумин, бычий сывороточный альбумин, желатин или иммуноглобулины; гидрофильные полимеры, такие как поливинилпирролидон; моносахариды, такие как ксилоза, манноза, фруктоза и глюкоза, дисахариды, такие как лактоза, мальтоза и сахароза; трисахариды, такие как раффиноза, а также полисахариды, такие как декстран.
В соответствии с настоящим изобретением в качестве буферных веществ могут быть использованы цитрат, гистидин, малеат, сукцинат, фосфат или их комбинации. Согласно некоторым вариантам реализации изобретения цитрат или сукцинат применяются в качестве буферных веществ в стабильных водных составах. Согласно некоторым вариантам реализации изобретения буферное вещество имеет молярность от приблизительно 10 мМ до прблизительно 50 мМ. Согласно одному варианту реализации изобретения буферное вещество имеет молярность приблизительно 30 мМ. Буферные вещества могут присутствовать в виде соответствующей свободной кислоты или в виде солей щелочных и щелочноземельных металлов или аммония. Помимо этого состав может содержать другие дополнительные фармацевтические вспомогательные вещества. Последовательность добавления различных вспомогательных веществ или активного вещества в процессе производства жидких фармацевтических составов в значительной степени зависит от стабилизирующего влияния при хранении, которое найдено согласно изобретению, и определяется по усмотрению специалиста в данной области.
Согласно настоящему изобретению в качестве вспомогательных веществ могут быть использованы хлорид натрия, трегалоза, сорбит, аргинин или их комбинации.
Согласно одному из вариантов реализации изобретения вспомогательное вещество представляет собой аргинин. Согласно некоторым вариантам реализации изобретения аргинин имеет молярность от приблизительно 100 мМ до приблизительно 500 мМ. Согласно другим вариантам реализации изобретения аргинин имеет молярность от приблизительно 200 до приблизительно 300 мМ. Согласно некоторым вариантам реализации изобретения аргинин имеет молярность приблизительно 250 мМ.
Традиционно фармацевтические составы белков включают поверхностно-активные вещества (ПАВ). Включение поверхностно-активных веществ может защитить белки от потенциально дестабилизирующих условий, возникающих на границе раздела фаз, от поверхностей, которые возникают в процессе производства, а также от изменения их термодинамической конформационной стабильности. Поверхностно-активные вещества хорошо известны в данной области техники, например, поверхностно-активные вещества на основе полисорбата. Одним из примеров ПАВ на основе полисорбата является полиоксиэтилен 20 сорбитанмонолаурат, также известный под торговой маркой Твин-20 (Tween20(r)). Тем не менее, исследования состава 6Г-КСФ, содержащего следовые количества полиоксиэтилен 20 сорбитанмонолаурата, показывают, что после 5 дней инкубации при 25 °С количество агрегатов увеличится до 3,2 % (по данным эксклюзионной хроматографии). Таким образом, составы согласно настоящему изобретению по существу не содержат поверхностно-активного вещества, в частности, полисорбата и/или полиоксиэтилен (20) сорбитанмонолаурата. В настоящей заявке термин "по существу не содержащий" поверхностно-активное вещество, полисорбат и/или полиоксиэтилен (20) сорбитанмонолаурат" относится к составу, содержащему менее 0,033 %, менее 0,001 %, менее 0,0005 %, менее 0,0003 % или менее 0,0001 % поверхностно-активного вещества, полисорбата и/или полиоксиэтилена (20) сорбитанмонолаурата. Согласно настоящему изобретению состав по существу не содержат поверхностно-активное вещество, полисорбат и/или полиоксиэтилен (20) сорбитанмонолаурат, что позволяет получить стабильный состав с заданными свойствами, такими как минимальная агрегация препарата и минимальная дестабилизация и, при необходимости, сниженное депегилирование.
В настоящей заявке термин "биологически активная молекула" означает любое вещество, которое может повлиять на любые физические или биохимические свойства биологической системы, пути, молекулы или взаимодействия, относящегося к организму, включая, но не ограничиваясь перечисленными: вирусы, бактерии, бактериофаги, транспозоны, прионы, насекомых, грибы, растения, животных и
человека. В частности, в настоящей заявке биологически активные молекулы включают любые вещества, предназначенные для диагностики, терапии, облегчения, лечения или профилактики заболевания у человека или животных, в других случаях для улучшения физического или психического самочувствия человека или животных, но не ограничиваются ими. Примеры биологически активных молекул включают, но не ограничиваются перечисленными: пептиды, белки, ферменты, низкомолекулярные лекарственные препараты, вакцины, иммуногены, сильнодействующие наркотики, слабые наркотики, углеводы, неорганические атомы или молекулы, красители, липиды, нуклеозиды, радионуклиды, олигонуклеотиды, анатоксины, токсины, прокариотические и эукариотические клетки, вирусы, полисахариды, нуклеиновые кислоты и их фрагменты, полученные или произошедшие от вирусов, бактерий, насекомых, животных или любых других клеток или типов клеток, липосомы, микрочастицы и мицеллы.
Фармацевтические составы согласно настоящему изобретению включают составы, которые помимо полипептида 6Г-КСФ или его варианта возможно содержат один или несколько других активных ингредиентов. В настоящей заявке термин "активный ингредиент" или "терапевтический ингредиент" относится к терапевтически активному соединению, а также к любым его пролекарственным формам и фармацевтически приемлемым солям, гидратам и сольватам соединения и пролекарствам. Другие активные ингредиенты могут быть объединены с полипептидом 6Г-КСФ или его вариантом и могут быть введены как отдельно, так и в одном фармацевтическом составе. Количество других активных ингредиентов, которые будут вводить, может быть легко определено специалистом в данной области техники на основании терапии 6Г-КСФ.
Фармацевтические составы согласно настоящего изобретению включают составы, которые помимо полипептида 6Г-КСФ или его варианта также возможно содержат один или несколько других неактивных ингредиентов. В настоящей заявке термин "неактивный ингредиент" относится к терапевтически неактивному соединению, а также любым его пролекарственным формам и фармацевтически приемлемым солям, гидратам и сольватам соединения и пролекарствам. Другие неактивные ингредиенты могут быть объединены с полипептидом 6Г-КСФ или его вариантом и могут быть введены как отдельно, так и в этом же фармацевтическом составе. Количество других активных ингредиентов, которые будут вводить, может быть легко определено специалистом в данной области техники на основании терапии 6Г-КСФ.
Количество полипептида 6Г-КСФ или его варианта в стабильных водных составах является достаточным для достижения терапевтического эффекта. В настоящей заявке термин "терапевтически эффективное количество" относится к количеству, которое приводит к желаемой пользе для животного и включает введение с целью лечения и профилактики. Количество будет варьировать для разных людей, и будет зависеть от ряда факторов, включая общее физическое состояние пациента и основную причину состояния, которое лечат. Количество полипептида 6Г-КСФ или его варианта, использованное для терапии, дает приемлемую частоту изменений и сохраняет заданный терапевтический ответ на значимом уровне. Терапевтически эффективное количество композиций согласно настоящему изобретению может быть легко установлено специалистом в данной области техники с использованием общедоступных материалов и методик. Например, количество полипептида 6Г-КСФ или его варианта может присутствовать в составе в концентрации приблизительно от 0,5 до 12 г/л, предпочтительно приблизительно 5 г/л.
В соответствии с настоящим изобретением стабильные водные составы полипептида 6Г-КСФ или его варианта могут быть приготовлены при различных значениях рН. Согласно некоторым вариантам реализации изобретения стабильный водный состав может иметь значение рН от приблизительно 5,7 до приблизительно 6,6. Согласно одному варианту реализации изобретения стабильный водный состав имеет рН от приблизительно 6,0 до приблизительно 6,3. Заданное значение рН состава доводят путем добавления оснований, таких как гидроксиды щелочных и щелочноземельных металлов или гидроксид аммония. Для корректировки рН предпочтительно использовать гидроксид натрия. Установление заданной величины рН в принципе может быть достигнуто путем добавления основных растворов. В целом, могут быть использованы соли сильных оснований со слабой кислотой, например, ацетат натрия, цитрат натрия, гидрофосфат динатрия или гидрофосфат дикалия или карбонат натрия. Если фармацевтический раствор вспомогательного вещества имеет основное значение рН, оно регулируется путем титрования кислотой до тех пор, пока не будет достигнуто заданное значение рН 4-5 или 7-8. В качестве кислот используются физиологически переносимые неорганические или органические кислоты, например, соляная кислота, фосфорная кислота, уксусная кислота, лимонная кислота, или обычные растворы веществ с кислым рН. В связи с этим некоторые примеры веществ представляют собой соли сильных кислот со слабыми основаниями, такие как, например, дигидрофосфат натрия или дигидрофосфат калия.
Как показано в приведенных ниже примерах составы 6Г-КСФ согласно настоящему изобретению имеют заданную низкую концентрацию агрегатов полипептида 6Г-КСФ или его варианта при неблагоприятных условиях хранения и условиях ускоренного старения. В настоящей заявке неблагоприятные условия хранения оценивают после инкубации образцов состава при 25 °С в течение 5 дней. В настоящей заявке ускоренное старение оценивают после инкубации образцов состава при 40 °С в течение 1 дня. Для целей настоящего изобретения условия хранения также могут быть исследованы при других температурах и сроках инкубации. Например, условия хранения могут быть исследованы после инкубации образцов состава при 25 °С в течение 28 дней или после инкубации образцов состава при 40 °С в течение 3 дней.
Концентрацию агрегатов полипептида 6Г-КСФ или его варианта исследуют после инкубации в неблагоприятных условиях хранения и условиях ускоренного старения. Согласно некоторым вариантам реализации составы полипептида 6Г-КСФ в соответствии с настоящим изобретением имеют концентрацию агрегатов полипептида 6Г-КСФ или его варианта ниже приблизительно 2,1 % (масс/масс.) в неблагоприятных условиях хранения. Согласно другим вариантам реализации изобретения составы полипептида 6Г-КСФ в соответствии с настоящим изобретением имеют концентрацию агрегатов полипептида 6Г-КСФ или его варианта ниже приблизительно 1,5 % (масс/масс. %) в неблагоприятных условиях хранения. Согласно некоторым вариантам реализации составы пептида 6Г-КСФ в соответствии с настоящим изобретением имеют концентрацию агрегатов полипептида 6Г-КСФ или его варианта ниже приблизительно 1,5 % (масс./масс. %) в условиях ускоренного старения. Согласно другим вариантам реализации изобретения составы полипептида 6Г-КСФ в соответствии с настоящим изобретением имеют концентрацию агрегатов полипептида 6Г-КСФ или его варианта ниже приблизительно 1,5 % (масс./масс. %) в условиях ускоренного старения.
Кроме того, для оценки стабильности состава согласно настоящему изобретению могут быть использованы исследования с применением принудительного перемешивания или замораживания-оттаивания. Например, исследование с принудительным перемешиванием может включать смешивание образца состава в стеклянном стакане на заданной скорости, например 60 оборотов в минуту, с помощью магнитной мешалки. Для того чтобы определить характеристики образца состав необходимо было перемешивать в течение определенного периода времени, например, два часа. Цикл замораживания-оттаивания мог включать замораживание
образца состава в течение 1 часа при температуре около -75 °С и оттаивания при комнатной температуре в течение приблизительно 1 часа до исчезновения льда.
Более того, как показано в приведенных ниже примерах, составы 6Г-КСФ согласно настоящему изобретению могут демонстрировать желаемые свойства в отношении дестабилизации и/или депегилирования полипептида 6Г-КСФ или его варианта в неблагоприятных условиях хранения и в условиях ускоренного старения. В настоящей заявке термин "депегилирование" может относиться к стабильности присоединения пегилированных фрагментов, связанных с полипептидом 6Г-КСФ или его вариантом, независимо от того, остаются ли указанные пегилированные фрагменты связанными с полипептидом с течением времени, например, при хранении в водном растворе, или же они начинают отделяться, например, в результате гидролиза сложноэфирной связи.
Согласно некоторым вариантам реализации изобретения стабильные водные составы полипептида 6Г-КСФ или его варианта могут быть приготовлены на основе цитрата в качестве буферного вещества и аргинина в качестве вспомогательного вещества. Согласно одному варианту реализации водный состав может быть приготовлен с использованием моногидрата лимонной кислоты (Fisher, С/6200/60 или эквивалентной) в качестве буферного вещества и L-аргинина (Sigma, А8094 или эквивалентный) в качестве вспомогательного вещества. Водный состав может быть приготовлен путем добавления 1,6±0,1 г моногидрата лимонной кислоты и 10,9±0,1 г L-аргинина к 200 мл воды высокого качества. После этого с помощью соляной кислоты доводят рН до 6,0±0,1, полученная смесь может быть разбавлена до 250 мл, используя воду высокого качества. Полученный состав может содержать 30 мМ цитрата, 250 мМ аргинина и полипептид 6Г-КСФ или его вариант при рН 6,0.
Водные препараты в соответствии с настоящим изобретением могут быть использованы для получения лиофилизатов с помощью стандартных способов лиофилизации или порошков. Препараты в соответствии с настоящим изобретением получают путем растворения лиофилизата в воде или других водных растворах. Термин "лиофилизация", также известный как сублимационная сушка, обозначает общераспространенную методику для представления белка, которая используется для удаления воды из представляющего интерес белкового препарата. Лиофилизация представляет собой процесс, при котором материал для высушивания сначала замораживают, а затем лед или замороженный растворитель удаляют сублимацией в вакуумной среде. В состав до лиофилизации может быть включено вспомогательное вещество для повышения устойчивости в процессе сублимационной сушки и/или для
повышения стабильности лиофилизированного продукта при хранении. Например, см. Pikal, М. Biopharm. 3(9)26-30 (1990) and Arakawa et al. Pharm. Res. 8(3):285-291 (1991).
Сушка фармацевтических ингредиентов распылением также известна специалистам в данной области техники. Например, см. Broadhead, J. et al., "The Spray Drying of Pharmaceuticals)) в Drug Dev. Ind. Pharm, 18 (11 & 12), 1169-1206 (1992). Помимо низкомолекулярных фармацевтических препаратов сушке распылением подвергался и ряд биологических материалов, в том числе: ферменты, сыворотки, плазма, микроорганизмы и дрожжи. Распылительная сушка является полезной методикой, так как с ее помощью жидкий фармацевтический препарат можно превратить в мелкодисперсный, безпыльный или агломерированный порошок за одну стадию. Основной метод состоит из следующих четырех стадий: а) распыление подаваемого раствора с образованием спрея, б) контакт спрея с воздухом, в) сушка спрея, и г) разделение высушенного продукта и сушильного воздуха. Например, патенты США №6235710 и 6001800 описывают получение рекомбинантного эритропоэтина методом распылительной сушки.
Способы применения состава, содержащего полипептид 6Г-КСФ или его вариант, также включены в настоящее изобретение. 6Г-КСФ обладает рядом видов биологической активности, включая, но не ограничиваясь перечисленными: связывание с его рецептором, которое приводит к димеризации рецепторов, стимуляцию выработки нейтрофилов и стимуляцию пролиферации и дифференцировки клеток. Примеры некоторых видов биологической активности гранулоцитарного колониестимулирующего фактора и 6Г-КСФ описаны выше, а также в патентах США №6676947, 6579525, 6531121, 6521245, 6489293, 6368854, 6316254, 6268336, 6239109, 6165283, 5986047, 5830851, 5043156 и 5773569. Составы, содержащие полипептид 6Г-КСФ или его вариант, согласно настоящему изобретению, можно применять в лечении или предотвращении широкого спектра заболеваний. "Предотвращение" относится к снижению вероятности того, что реципиент препарата будет страдать или у него разовьется любое из патологических состояний, описанных здесь, и включает профилактическое введение. Термин "предотвращение" применим, в частности, к пациенту, который восприимчив к конкретному патологическому состоянию. Термин "лечение" относится к изменению заболевания или состояния и к предотвращению, обращению клинических эффектов заболевания, или смягчению дальнейшего прогрессирования или облегчению симптомов, связанных с заболеванием или состоянием.
Введение Г-КСФ-содержащих продуктов приводит к выработке лейкоцитов. Таким образом, введение состава, содержащего полипептид 6Г-КСФ или его вариант, согласно настоящему изобретению, может быть полезно для предотвращения инфекции у животных, которые находятся под угрозой заражения. Состав, содержащий полипептид 6Г-КСФ или его вариант, согласно настоящему изобретению, можно вводить инфицированным животным. Инфекции, которые можно лечить с помощью состава, содержащего полипептид 6Г-КСФ или его вариант, согласно настоящему изобретению, включаютмастит и транспортную лихорадку, но не ограничиваются ими. Состав, содержащий полипептид 6Г-КСФ или его вариант, согласно настоящему изобретению, возможно вводят животному, например, на протяжении от двух недель до одного дня до родов и, при необходимости, дополнительное введение могло быть сделано в день родов или в течение одной недели после родов. Согласно некоторым вариантам реализации животное, которому вводят препарат, содержащий полипептид 6Г-КСФ или его вариант согласно настоящему изобретению, это корова, и рождение называют "отел". Согласно одному варианту реализации состав, содержащий полипептид 6Г-КСФ или его вариант согласно настоящему изобретению, может быть введен тельным коровам для профилактики мастита.
Согласно настоящему изобретению состав, содержащий полипептид 6Г-КСФ или
его вариант, может быть введен любым обычным способом, который подходит для
белка или пептида, включая, но не ограничиваясь, парентерально, например,
посредством инъекций, включая, подкожные или внутривенные или любые другие
формы инъекций или инфузий, но не ограничиваясь ими. Составы, содержащие
полипептид 6Г-КСФ или его вариант, могут быть введены рядом способов, включая,
пероральный, внутривенный, внутрибрюшинный, внутримышечный,
трансдермальный, подкожный, местный, подъязычный, внутрисосудистый, интрамаммарный или ректальный способ, но не ограничиваясь ими. Составы, содержащие полипептид 6Г-КСФ или его вариант, могут быть введены с использованием липосом. Такие способы введения и соответствующие составы широко известны специалистам в данной области. Составы, содержащие полипептид 6Г-КСФ или его вариант, отдельно или в комбинации с другими подходящими компонентами, также могут быть приготовлены в виде аэрозольных составов (например, они могут быть "распылены") для введения путем ингаляции. Аэрозольные составы могут быть помещены в приемлемый газ-вытеснитель,
находящийся под давлением, такой как дихлордифторметан, пропан, азот и тому подобное.
Составы, содержащие полипептид 6Г-КСФ или его вариант, подходящие для парентерального введения, такого как, например, внутрисуставное (в суставы), внутривенное, внутримышечное, внутрикожное, внутрибрюшинное и подкожное, включают водные и неводные, изотонические стерильные растворы для инъекций, которые могут содержать антиоксиданты, буферы, бактериостатические препараты, а также растворенные вещества, которые делают состав изотоническим в отношении крови предполагаемого реципиента, водные и неводные стерильные суспензии, которые могут включать суспендирующие агенты, растворители, загустители, стабилизаторы и консерванты. Составы, содержащие полипептид 6Г-КСФ или его вариант, могут быть представлены в одноразовых или многоразовых герметичных контейнерах, таких как ампулы и флаконы. Составы, содержащие полипептид 6Г-КСФ или его вариант, также могут быть представлены в шприцах, таких как предварительно заполненные шприцы.
Состав согласно настоящему изобретению можно вводить парентерально и внутривенно. В частности, пути введения, используемые для лекарственных препаратов на основе гомологов природных аминокислот (включая, но не ограничиваясь, способы, которые обычно используют для эритропоетина, гормона роста, Г-КСФ, ГМ-КСФ, интерферонов, интерлейкинов, антител, факторы роста фибробластов, и/или любых других фармацевтически доставляемых белков), наряду с составами, используемыми в настоящее время, обеспечивают возможные способы введения и составы, содержащие полипептид 6Г-КСФ или его вариант согласно настоящему изобретению.
Согласно некоторым вариантам реализации состав по настоящему изобретению содержит полипептид 6Г-КСФ или его вариант в количестве от приблизительно 0,5 до приблизительно 12 г/л. В контексте настоящего изобретения вводимая животному доза достаточна для обеспечения полезного терапевтического ответа у животного с течением времени или другой соответствующей активности в зависимости от применения. Доза определяется эффективностью конкретного вектора или состава, а также активностью, стабильностью или периодом полужизни в сыворотке применяесого полипептида, который содержит некодируемую в природе аминокислоту, и состоянием животного, а также массой или площадью поверхности тела животного, которого лечат. Размер дозы определяется также наличием,
характером и степенью любых нежелательных явлений, которые сопровождают введение конкретного вектора, состава и т.п. , у конкретного животного.
В контексте настоящего изобретения введенная животному доза должна быть достаточной для обеспечения полезного терапевтического ответа у пациента с течением времени. В целом, общее фармацевтически эффективное количество полипептида 6Г-КСФ или его варианта согласно настоящему изобретению, введенное парентерально в расчете на одну дозу, составляет от 0,01 приблизительно мкг/кг/сут. до приблизительно 100 мкг/кг/сут., или от приблизительно 0,05 мг/кг до приблизительно 1 мг/кг массы тела животного, хотя доза выбирает в зависимости от терапевтических показаний. Кроме того, фармацевтически эффективное количество полипептида 6Г-КСФ или его варианта согласно настоящему изобретению, вводимого парентерально, в расчете на одну дозу, составляет от приблизительно 1 мг до приблизительно 25 мг или от приблизительно 5 мг до приблизительно 20 мг. Например, фармацевтически эффективное количество полипептида 6Г-КСФ или его варианта согласно настоящему изобретению, вводимого парентерально, в расчете на одну дозу, может быть приблизительно 14 мг. Частоту дозирования также выбирают на основании терапевтических показаний.
Фармацевтически эффективное количество полипептида 6Г-КСФ или его варианта можно вводить животным в виде однократной дозы или в составе схемы многократного дозирования. Например, полипептид 6Г-КСФ или его вариант может быть введен в составе схемы многократного дозирования, где схема включает по меньшей мере два режима дозирования. Согласно одному варианту реализации изобретения схема многократного дозирования состоит из двух режимов дозирования.
Согласно одному варианту реализации изобретения схема многократного дозирования включает первую дозу, которую вводят животному в период от 1 дня до 14 дней до родов, и вторую дозу, которую вводят животному в период примерно от 4 дней до 7 дней после родов. Согласно другому варианту реализации изобретения схема многократного дозирования включает первую дозу, которую вводят животному приблизительно за 7 дней до родов, и вторую дозу, которую вводят животному в день родов.
В настоящей заявке также предложены следующие варианты реализации:
1. Стабильный водный состав, содержащий полипептид 6Г-КСФ или его вариант,
буферное вещество и вспомогательное вещество, причем указанный состав по
существу не содержит полиоксиэтилен (20) сорбитанмонолаурат.
2. Состав по 1, отличающийся тем, что полипептид 6Г-КСФ или его вариант связан с ликером, полимером или биологически активной молекулой.
3. Состав по п. 1 или п. 2, отличающийся тем, что полипептид 6Г-КСФ или его вариант связан с водорастворимым полимером.
4. Состав по п. 3, отличающийся тем, что водорастворимый полимер содержит полиэтиленгликолевый фрагмент.
5. Состав по п. 3 или 4, отличающийся тем, что водорастворимый полимер имеет молекулярную массу от приблизительно 0,1 кДа до приблизительно 100 кДа.
6. Состав по любому из пп. 3-5, отличающийся тем, что водорастворимый полимер имеет молекулярную массу от приблизительно 0,1 кДа до приблизительно 50 кДа.
7. Состав по любому из пп. 3-6, отличающийся тем, что водорастворимый полимер имеет молекулярную массу приблизительно 20 кДа.
8. Состав по любому из пп. 1-7, отличающийся тем, что полипептид 6Г-КСФ или его вариант представляет собой бГ-КСФ-Т133рАГ-20К ПЭГ.
9. Состав по любому из пп. 1-8, отличающийся тем, что полипептид 6Г-КСФ или его вариант присутствует в количестве от приблизительно 0,5 до приблизительно 12 г/л.
10. Состав по любому из пп. 1-9, отличающийся тем, что полипептид 6Г-КСФ или его вариант присутствует в количестве приблизительно 5 г/л.
11. Состав по любому из пп. 1-10, отличающийся тем, что буферное вещество представляет собой цитрат, гистидин, малеат, сукцинат, фосфат или их комбинацию.
12. Состав по любому из пп. 1-11, отличающийся тем, что буферное вещество представляет собой цитрат или сукцинат.
13. Состав по любому из пп. 1-12, отличающийся тем, что буферное вещество представляет собой цитрат.
14. Состав по любому из пп. 1-12, отличающийся тем, что буферное вещество представляет собой сукцинат.
15. Состав по любому из пп. 1-14, отличающийся тем, что буферное вещество имеет молярность от приблизительно 10 до приблизительно 50 мМ.
16. Состав по любому из пп. 1-15, отличающийся тем, что буферное вещество имеет молярность приблизительно 30 мМ.
17. Состав по любому из пп. 1-16, отличающийся тем, что вспомогательное вещество представляет собой хлорид натрия, трегалозу, сорбит, аргинин или их комбинацию.
10.
18. Состав по любому из пп. 1-17, отличающийся тем, что вспомогательное вещество представляет собой аргинин.
19. Состав по п. 18, отличающийся тем, что аргинин имеет молярность от приблизительно 100 мМ до приблизительно 500 мМ.
20. Состав по п. 18 или п. 19, отличающийся тем, что аргинин имеет молярность от приблизительно 200 мМ до приблизительно 300 мМ.
21. Состав по любому из пп. 18-20, отличающийся тем, что аргинин имеет молярность приблизительно 250 мМ.
22. Состав по любому из пп. 1-21, отличающийся тем, что рН состава составляет от приблизительно 5,7 до приблизительно 6,6.
23. Состав по любому из пп. 1-22, отличающийся тем, что рН состава составляет от приблизительно 6,0 до приблизительно 6,3.
24. Состав по любому из пп. 1-23, отличающийся тем, что средняя концентрация агрегатов полипептида 6Г-КСФ или его варианта в составе ниже приблизительно 2,1 % масс/масс, после пятидневного периода инкубации в неблагоприятных условиях хранения.
25. Состав по любому из пп. 1-24, отличающийся тем, что средняя концентрация агрегатов полипептида 6Г-КСФ или его варианта в составе ниже приблизительно 1,5 % масс./масс, после однодневного периода инкубации в условиях ускоренного старения.
26. Состав по любому из пп. 1-25, возможно включающий один или более других терапевтических ингредиентов.
27. Лиофилизат или порошок состава по любому из пп. 1-26.
28. Водный раствор, полученный путем растворения лиофилизата или порошка по п. 27 в воде.
29. Способ приготовления состава по любому из пп. 1-26, включающий
получение стабильного водного раствора, содержащего полипептид 6Г-КСФ или его
вариант, буферное вещество и вспомогательное вещество, причем указанный состав
по существу не содержит полиоксиэтилен (20) сорбитанмонолаурат.
30. Способ лечения животного, имеющего заболевание, модулируемое 6Г-КСФ, включающий введение указанному животному терапевтически эффективного количества состава по любому из пп. 1-26.
31. Способ по п. 30, отличающийся тем, что указанное заболевание представляет собой инфекцию.
30.
32. Способ по п. 31, отличающийся тем, что инфекция представляет собой мастит, и указанное животное является тельной коровой.
33. Стабильный водный состав, содержащий полипептид 6Г-КСФ или его вариант, цитратный или сукцинатный буфер, аргинин и возможно противоион для аргинина.
34. Состав по п. 33, отличающийся тем, что указанный состав по существу не содержит поверхностно-активное вещества, содержащего полисорбат.
35. Состав по п. 33 или п. 34, отличающийся тем, что полипептид 6Г-КСФ или его вариант связан с линкером, полимером или биологически активной молекулой.
36. Состав по пп. 33-35, отличающийся тем, что полипептид 6Г-КСФ или его вариант связан с водорастворимым полимером.
37. Состав по п. 36, отличающийся тем, что водорастворимый полимер содержит полиэтиленгликолевый фрагмент.
38. Состав по п. 36 или п. 37, отличающийся тем, что водорастворимый полимер имеет молекулярную массу от приблизительно 0,1 кДа до приблизительно 100 кДа.
39. Состав по любому из пп. 36-38, отличающийся тем, что водорастворимый полимер имеет молекулярную массу от приблизительно 0,1 кДа до приблизительно 50 кДа.
40. Состав по любому из пп. 36-39, отличающийся тем, что водорастворимый полимер имеет молекулярную массу приблизительно 20 кДа.
41. Состав по любому из пп. 34-40, отличающийся тем, что указанное поверхностно-активное вещество, содержащее полисорбат, представляет собой полиоксиэтиленовое производное монолаурата натрия.
42. Состав по любому из пп. 34-41, отличающийся тем, что указанное поверхностно-активное вещество, содержащее полисорбат, представляет собой полиоксиэтилен (20) сорбитанмонолаурат.
43. Состав по любому из пп. 33-42, отличающийся тем, что полипептид 6Г-КСФ или его вариант представляет собой бГ-КСФ-Т133рАБ-20К ПЭГ.
44. Состав по п. 43, отличающийся тем, что полипептид бГ-КСФ-Т133рАБ-20К ПЭГ присутствует в количестве от приблизительно 0,5 до приблизительно 12 г/л, цитратный буфер имеет молярность приблизительно 30 мМ, аргинин имеет молярность приблизительно 250 мМ, причем рН состава приблизительно равен 6,0.
45. Состав по п. 43 или п. 44, отличающийся тем, что средняя концентрация агрегатов бГ-КСФ-Т133рАГ-20К ПЭГ в составе ниже приблизительно 1,6% масс/масс, после инкубации в течение 28 дней при температуре 25 °С.
43.
46. Состав по любому из пп. 43-45, отличающийся тем, что средняя концентрация агрегатов 6r-KCO-T133pAF-20K ПЭГ в составе ниже приблизительно 2,8 % масс/масс, после инкубации в течение 3 дней при температуре 40 °С.
47. Состав по любому из пп. 43-46, отличающийся тем, что средняя концентрация агрегатов 6r-KCO-T133pAF-20K ПЭГ в составе составляет приблизительно 1,6% масс/масс, или меньше после исследования с принудительным перемешиванием.
48. Состав по любому из пп. 43-47, отличающийся тем, что средняя концентрация агрегатов 6r-KCO-T133pAF-20K ПЭГ в составе ниже приблизительно 1,6% масс/масс, после пяти циклов замораживания-оттаивания.
49. Состав по любому из пп. 33-48, отличающийся тем, что противоион для аргинина представляет собой хлорид или сульфат.
50. Состав по любому из пп. 33-49, возможно включающий один или более других терапевтических ингредиентов.
51. Лиофилизат или порошок состава по любому из пп. 33-50.
52. Водный раствор, полученный путем растворения лиофилизата или порошка по п. 51 в воде.
53. Способ приготовления состава по любому из пп. 33-50, включающий получение стабильного водного раствора, содержащего полипептид 6Г-КСФ или его вариант, цитратный буфер, аргинин и возможно противоион для аргинина.
54. Способ по п. 53, отличающийся тем, что состав по существу не содержит поверхностно-активное вещество, содержащее полисорбат.
55. Способ по п. 53 или п. 54, отличающийся тем, что полипептид 6Г-КСФ или его вариант представляет собой 6r-KCO-T133pAF-20K ПЭГ.
56. Способ лечения животного, которое имеет заболевание, модулируемое 6Г-КСФ, включающий введение указанному животному терапевтически эффективного количества состава по любому из пп. 33-50.
57. Способ по п. 56, отличающийся тем, что указанное заболевание представляет собой инфекцию.
58. Способ по п. 57, отличающийся тем, что указанная инфекция представляет собой мастит, и указанное животное является тельной коровой.
59. Стабильный водный состав, состоящий по существу из полипептида 6Г-КСФ или его варианта, цитратного или сукцинатного буфера, аргинина и возможно противоиона для аргинина.
60. Состав по п. 59, отличающийся тем, что состав по существу не содержит поверхностно-активное вещество.
43.
61. Состав по п. 59 или п. 60, отличающийся тем, что полипептид 6Г-КСФ или его вариант связан с линкером, полимером или биологически активной молекулой.
62. Состав по любому из пп. 59-61, отличающийся тем, что полипептид 6Г-КСФ или его вариант связан с водорастворимым полимером.
63. Состав по п. 62, отличающийся тем, что водорастворимый полимер содержит полиэтиленгликолевый фрагмент.
64. Состав по п. 62 или п. 63, отличающийся тем, что водорастворимый полимер имеет молекулярную массу от приблизительно 0,1 кДа до приблизительно 100 кДа.
65. Состав по любому из пп. 62-64, отличающийся тем, что водорастворимый полимер имеет молекулярную массу приблизительно от 0,1 кДа до 50 кДа.
66. Состав по любому из пп. 62-65, отличающийся тем, что водорастворимый полимер имеет молекулярную массу приблизительно 20 кДа.
67. Состав по любому из пп. 60-66, отличающийся тем, что указанное поверхностно-активное вещество представляет собой полисорбат.
68. Состав по любому из пп. 60-67, отличающийся тем, что указанное поверхностно-активное вещество представляет собой полиоксиэтиленовое производное монолаурата натрия.
69. Состав по любому из пп. 60-68, отличающийся тем, что указанное поверхностно-активное вещество представляет собой полиоксиэтилен (20) сорбитанмонолаурат.
70. Состав по любому из пп. 59-69, отличающийся тем, что полипептид 6Г-КСФ или его вариант представляет собой бГ-КСФ-Т133рАБ-20К ПЭГ.
71. Состав по п. 70, отличающийся тем, что полипептид бГ-КСФ-Т133рАБ-20К ПЭГ присутствует в количестве от приблизительно 0,5 до приблизительно 12 г/л, цитратный буфер имеет молярность примерно 30 мМ, аргинин имеет молярность примерно 250 мМ, причем состав имеет рН, равное приблизительно 6,0.
72. Состав по п. 70 или п. 71, отличающийся тем, что средняя концентрация агрегатов бГ-КСФ-Т133рАГ-20К ПЭГ в составе ниже приблизительно 1,6% масс/масс, после инкубации в течение 28 дней при температуре 25 °С.
73. Состав по любому из пп. 70-72, отличающийся тем, что средняя концентрация агрегатов бГ-КСФ-Т133рАГ-20К ПЭГ в составе ниже приблизительно 2,8 % масс/масс, после инкубации в течение 3 дней при температуре 40 °С.
74. Состав по любому из пп. 70-73, отличающийся тем, что средняя концентрация агрегатов бГ-КСФ-Т133рАГ-20К ПЭГ в составе ниже приблизительно 1,6% масс/масс, или меньше после исследования с принудительным перемешиванием.
70.
75. Состав по любому из пп. 70-74, отличающийся тем, что средняя концентрация агрегатов 6r-KCO-T133pAF-20K ПЭГ в составе ниже приблизительно 1,6% масс/масс, после пяти циклов замораживания-оттаивания.
76. Состав по любому из пп. 59-75, отличающийся тем, что противоион для аргинина представляет собой хлорид или сульфат.
77. Состав по любому из пп. 59-76, возможно содержащий один или более других терапевтических ингредиентов.
78. Лиофилизат или порошок состава по любому из пп. 59-77.
79. Водный раствор, полученный путем растворения лиофилизата или порошка по п. 78 в воде.
80. Способ приготовления состава по любому из пп. 59-77, включающий получение стабильного водного раствора, состоящего по существу из полипептида 6Г-КСФ или его варианта, цитратного буфера, аргинина и возможно противоиона для аргинина.
81. Способ по п. 80, отличающийся тем, что состав по существу не содержит поверхностно-активное вещество.
82. Способ по п. 80 или п. 81, отличающийся тем, что полипептид 6Г-КСФ или его вариант представляет собой 6r-KCO-T133pAF-20K ПЭГ.
83. Способ лечения животного, которое имеет заболевание, модулируемое 6Г-КСФ, включающий введение указанному животному терапевтически эффективного количества состава по любому из пп. 59-77.
84. Способ по п. 83, отличающийся тем, что указанное заболевание представляет собой инфекцию.
85. Способ по п. 84, отличающийся тем, что указанная инфекция представляет собой мастит, и указанное животное является тельной коровой.
86. Стабильный водный состав, состоящий по существу из 6r-KCO-T133pAF-20K ПЭГ, цитратный буфер, причем цитратный буфер имеет молярность примерно 30 мМ, аргинин, причем аргинин имеет молярность примерно 250 мМ, и возможно противоион для аргинина.
ПРИМЕР 1
Скрининговое исследование буферов и вспомогательных веществ
Содержащие 6Г-КСФ-Т133-20К ПЭГ составы, в основе которых отсутствует полиоксиэтилен (20) сорбитанмонолаурат, могут быть подвергнуты скринингу для оценки стабильности продукта с использованием нескольких буферов и вспомогательных веществ (хлорид натрия, трегалоза и аргинин). Заданное значение рН
для всех диализных буферов составляет 6,0. Для сравнения может быть приготовлен состав, содержащий 10 мМ фосфата, 180 мМ маннита и 60 мМ трегалозы с рН 6,0. Состав может быть исследован в отношении воздействия на агрегацию белков и депегилирование в присутствии и при отсутствии кислорода.
Образцы могут быть получены путем диализа 1 мл 6Г-КСФ-Т133-20К ПЭГ при температуре 2-8 °С для каждого состава. Концентрация белка в образцах после диализа может быть определена перед нормализацией концентрации белка до 5 мг/мл. После диализа и нормализации концентрации примерно 3x1 мл аликвоты объединенных образцов после диализа и разведения могут быть внесены 5 мл стеклянные флаконы. Для того чтобы получить данные для начальных условий один набор образцов может быть протестирован. Второй набор может храниться при температуре 25 °С/60 % относительной влажности в течение 5 дней до начала испытания. Третий набор образцов может быть дегазирован в лиофилизационной камере, закрытой в атмосфере инертного газа (азота), а затем его хранят при 25 °С/60 % относительной влажности в течение 5 дней до начала испытания. Если уровень агрегации, измеренный с помощью эксклюзионной хроматографии, составляет через 5 дней менее 2,0 %, то дегазированные и не дегазированные образцы могут быть проинкубированы при 40 °С в течение одного дня.
После пяти дней инкубации может быть измерена концентрация белка в каждом образце. В таблице 1 приведены концентрации белка.
10 мМ малеат, 0,ЗМ трегалозы
4,41
4,01
4,13
10 мМ малеата, 0,1 М аргинина
5,69
5,41
5,39
10 мМ сукцинат, 0,15 MNaCl
5,94
5,88
5,83
10 мМ сукцината, 0.3М трегалозы
5,57
5,79
5,66
10 мМ сукцината, 0,1 М аргинина
4,96
4,92
4,78
10 мМ фосфата, 0,15 MNaCl
5,20
5,18
5,03
10 мМ фосфата, 0,ЗМ трегалозы
5,13
5,30
5,24
10 мМ фосфата, 0,1 М аргинина
5,22
5,04
5,12
10 мМ фосфата 180 мМ манита, 60 мМ трегалозы
5,28
5,22
5,21
В таблице 2 приведены показатели рН для каждого образца.
исследованы с помощью эксклюзионной хроматографии. В таблице 3 приведены результаты эксклюзионной хроматографии, которые показывают, что уровни агрегации белков и депегилирования были сопоставимыми во всех образцах.
0,15 MNaCl
10 мМ
1,3
98,2
0,5
1,7
97,8
0,5
1,9
97,6
0,5
гистидина, 0.3М
трегалозы
10 мМ
1,3
98,1
0,6
1,3
98,1
0,7
1,5
97,8
0,6
гистидина, 0,1 М
аргинина
10 мМ малеата,
1,4
98,1
0,5
1,6
97,8
0,6
1,7
97,7
0,6
0,15 MNaCl
10 мМ малеата,
1,3
98,2
0,4
1,7
97,9
1,7
97,9
0,4
0,ЗМ трегалозы
10 мМ малеата,
1,3
98,2
0,6
1,3
98,1
0,6
1,4
97,9
0,6
0,1 М аргинина
10 мМ
1,4
98,1
0,5
1,6
97,8
0,6
1,9
97,5
0,5
сукцината, 0,15 MNaCl
10 мМ
1,3
98,3
0,4
1,7
97,9
1,9
97,7
0,4
сукцината, 0.3М
трегалозы
10 мМ
1,5
98,0
0,6
1,5
97,9
0,6
2,0
97,4
0,6
сукцината, 0,1 М
аргинина
10 мМ фосфата,
98,2
0,7
1,3
98,0
0,7
1,4
97,9
0,7
0,15 MNaCl
10 мМ фосфата,
98,4
0,5
1,7
97,8
0,6
1,8
97,6
0,6
0,ЗМ трегалозы
10 мМ фосфата,
98,2
0,6
1,3
98,1
0,7
1,5
97,8
0,7
0,1 М аргинина
10 мМ фосфата
1,2
98,3
0,5
2,0
97,5
0,5
2,1
97,4
0,5
180 мМ манита,
60 мМ трегалозы
инкубации).
В таблице 4 приведены результаты эксклюзионной хроматографии образцов, которые инкубировали при 40 °С в течение одного дня. Сравнение композиции агрегатов свидетельствует, что содержащие аргинин составы имели самый низкий уровень агрегации препарата. Кроме того, в скрининговом исследовании контрольный состав, содержащий 10 мМ фосфата, 180 мМ маннита и 60 мМ трегалозы при рН 6, имел самый высокий уровень агрегирования по сравнению со всеми другими составами.
10 мМ
6,0
93,8
0,2
5,9
93,9
0,2
гистидина, 0,15
MNaCl
10 мМ
8,4
91,5
0,1
9,3
90,6
0,1
гистидина, 0,3
М трегалозы
10 мМ
3,0
96,7
0,3
2,9
96,8
0,3
гистидина, 0,1
М аргинина
10 мМ малеата,
5,9
93,9
0,2
6,0
93,9
0,1
0,15 MNaCl
10 мМ малеата,
7,3
92,7
0,1
7,4
92,5
0,1
0,3 М
трегалозы
10 мМ малеата,
3,0
96,8
0,2
3,1
96,7
0,2
0,1 М аргинина
10 мМ
4,3
95,5
0,2
5,3
94,6
0,1
сукцината, 0,15 MNaCl
10 мМ
9,6
90,3
0,1
10,8
89,1
0,1
сукцината, 0,3
М трегалозы
10 мМ
2,1
97,6
0,3
2,6
97,2
0,2
сукцината, 0,1
М аргинина
10 мМ
5,9
94,0
0,2
5,9
93,9
0,1
фосфата, 0,15
MNaCl
10 мМ
16,0
84,0
0,0
18,2
81,8
0,0
фосфата, 0,3 М
трегалозы
10 мМ
4,5
95,2
0,2
3,8
96,0
0,2
фосфата, 0,1 М
аргинина
10 мМ фосфата
22,8
77,2
0,0
25,0
75,0
0,0
180 мМ
манита, 60 мМ
трегалозы
Результаты этого скринингового исследования показывают, что все составы на основе сукцината, гистидина, малета и цитрата без полиоксиэтилен (20) сорбитанмонолаурата имеют незначительное увеличение количества агрегатов (менее 1 % согласно данным эксклюзионной хроматографии) после пяти дней инкубации при температуре 25 °С. Кроме того, отсутствуют различия в стабильности белка для дегазированных и недегазированных образцов. Более того, результаты эксклюзионной хроматографии образцов, инкубированных в неблагоприятных условиях при 40 °С в течение одного дня, показывают, что содержащие 0,1 М аргинина составы меньше подвержены агрегации по сравнению с составами, содержащими такие вспомогательные вещества как хлорид натрия и трегалоза.
Пример 2
Влияние полиоксиэтилен (20) сорбитанмонолаурата на составы, содержащие
6Г-КСФ
Для того чтобы установить влияние полиоксиэтилен (20) сорбитанмонолаурата на будущие составы для исследований с принудительным перемешиванием может быть проведена оценка его воздействия на агрегацию. Образцы могут быть получены путем диализа 4 мл 6Г-КСФ-Т133-20К ПЭГ при температуре 2-8 °С в 10 мМ фосфата и 150 мМ NaCl при рН 6,0. После диализа к объединенной диализной фракции добавляют определенное количество 1 % раствора полиоксиэтилен (20) сорбитанмонолаурата, а затем разбавляют 10 мМ фосфата и 150 мМ NaCl с рН 6,0 до конечной концентрации белка 5 мг/мл. Образцы каждой композиции разделяют на 2x1 мл аликвоты и вносят в 1 мл стеклянные флаконы для получения двух наборов образцов. Один набор может храниться при температуре 2-8 °С и тестироваться в начальных условиях, в то время как второй набор может храниться при температуре 40 °С в течение одного дня.
В таблице 5 представлены комплексные данные, полученные с использованием эксклюзионной хроматографии, которые свидетельствуют о том, что уровень агрегирования увеличивается с повышением концентрации полиоксиэтилен (20) сорбитанмонолаурата. Анализа проб с помощью эксклюзионной хроматографии свидетельствует, что агрегация 6Г-КСФ-Т133-20К ПЭГ увеличивается с повышением концентрации полиоксиэтилен (20) сорбитанмонолаурата. В результате полиоксиэтилен (20) сорбитанмонолаурат может быть исключен из испытаний будущих составов для 6Г-КСФ-Т133-20К ПЭГ.
мМ NaCl, 0,05% Твин-20
Пример 3
Статистический план Бокса-Бенкена для изучения поверхности отклика (DOE №
Влияние различных концентраций аргинина наряду с другими ключевыми историческими параметрами состава может быть исследовано с целью определения основных эффектов, а также их взаимодействий. В дизайне эксперимента используют методологию расчёта на основе поверхности отклика, основанную на плане Бокса-Бенкена, где каждый числовой коэффициент изменяется как низкий, средний и высокий уровень. Кроме того, тип буфера может являться категорическим фактором. Сочетание параметров может быть повторено для цитрата и сукцината, каждое с тремя центральными точками. Значение рН может быть установлено на уровне 6,0 для всех условий. Для сравнения с полученными ранее результатами может быть включено контрольное условие, которое представляет собой раствор, содержащий 10 мМ фосфата, 150 мМ NaCl и 0,0033 % полиоксиэтилен (20) сорбитанмонолаурата при рН 6.
Все диализные буферы могут быть получены при рН 6,0±0,1. ПЭГ-бГ-КСФ может быть подвергнут диализу в 18 условиях, соответствующих различным буферам, приведенным в исследовании DOE №1. Выделение белка во время стадии диализа может составлять в целом > 78 % и, таким образом, является одинаковым в наборе образцов для диализа. После диализа концентрация белка в объединенной диализной фракции может быть откорректирована с использованием буфера для диализа до целевого значения, приведенного в плане Бокса-Бенкена для изучения поверхности отклика. В результате может быть получено 24 комбинации состава плюс три центральные точки для цитрата и три центральные точки для сукцината. Каждый состав можно разделить на 3 аликвоты xl мл, которые вносят в 1 мл стеклянные флаконы и получают три набора образцов: один набор может быть исследован для получения данных в начальных условиях и затем может храниться при температуре 28 °С, второй набор может храниться при температуре 25 °С в течение двух недель и третий набор может храниться при температуре 40 °С в течение одного дня.
Изменения концентрации продукта могут быть исследованы с целью оценки стабильности продукта. В таблице 6 приведены концентрации продукта в образцах до и после инкубации. Образцы, приготовленные в буфере, содержащем 10 мМ цитрата,
300 мМ аргинина (8 мг/мл) и 10 мМ сукцината, имеют самое большое увеличение (0,50,6 мг/мл), тогда как для всех других образцов разность меньше.
Для того чтобы оценить рН стабильность образцов могут быть исследованы изменения рН. Все образцы могут иметь рН в пределах от 6,0 до 6,3. В таблице 7 приведены значения рН и разность по отношению к нулевому моменту времени. Значения рН образцов являются стабильными на всем протяжении исследования DOE №1.
50 мМ сукцината, 100 мМ аргинина (5 мг/мл)
6,18
6,17
-0,01
50 мМ сукцината, 300 мМ аргинина (2 мг/мл)
6,22
6,19
-0,03
50 мМ сукцината, 300 мМ аргинина (8 мг/мл)
6,21
6,21
0,00
50 мМ сукцината, 500 мМ аргинина (5 мг/мл)
6,22
6,21
-0,01
10 мМ фосфата, 150 мМ NaCl
6,11
6,10
-0,01
Для того чтобы оценить стабильности белка с помощью эксклюзионной хроматографии могут быть исследованы изменения концентрации агрегатов, мономеров и уровня депегилирования. В таблицах 8, 9 и 10 приведено процентное содержание агрегатов, мономеров и уровень депегилирования в каждой композиции образца, соответственно.
хроматографии в исследовании DOE №1.
Образец
% Мономеров для цитрата
% Мономеров для сукцината
Начальны
После 1-
Разность
Начальные
После 1-
Разность
е условия
дневной инкубации при 40 °С
условия
дневной инкубации при 40 °С
Объединенная фракция NBJ0801-
98,7
Отсутствует
99,0
Отсутствует
04-04 до диализа
10 мМ буфера, 100
98,8
98,4
-0,4
97,9
98,6
-1,4
мМ аргинина (5 мг/мл)
10 мМ буфера, 300
98,8
98,7
-0,1
97,9
98,0
0,2
мМ аргинина (2 мг/мл)
10 мМ буфера, 300
98,9
98,6
-0,3
97,8
97,7
-ОД
мМ аргинина (8 мг/мл)
10 мМ буфера, 500
98,7
98,4
-0,3
97,9
97,8
-ОД
мМ аргинина (5 мг/мл)
30 мМ буфера, 100
98,6
98,5
-0,1
98,0
97,9
-од
мМ аргинина (2 мг/мл)
30 мМ буфера, 100
98,7
98,3
-0,4
98,1
96,9
-1,2
мМ аргинина (8 мг/мл)
30 мМ буфера, 300
98,7
98,6
-ОД
98,0
98,1
мМ аргинина (5 мг/мл) флакон А
30 мМ буфера, 300
98,8
98,5
-0,2
98,2
98,0
-0,2
мМ аргинина (5 мг/мл) флакон В
30 мМ буфера, 300
98,8
98,6
-0,2
98,2
98,1
-ОД
мМ аргинина (5 мг/мл) флакон С
30 мМ буфера, 500
98,7
98,5
-0,2
97,6
98,1
0,4
мМ аргинина (2 мг/мл)
30 мМ буфера, 500
98,7
98,4
-0,3
98,0
98,0
0,0
мМ аргинина (8
эксклюзионной хроматографии в исследовании DOE №1.
Образец
% Депегилирования для цитрата
% Депегилирования для сукцината
Начальны
После 1-
Разность
Начальные
После 1-
Разность
е условия
дневной инкубации при 40 °С
условия
дневной инкубации при 40 °С
Объединенная фракция NBJ0801-
0,2
Отсутствует
0,3
Отсутствует
04-04 до диализа
10 мМ буфера, 100
0,2
0,0
0,8
0,6
-0,3
мМ аргинина (5 мг/мл)
10 мМ буфера, 300
0,2
0,3
0,6
0,6
0,0
мМ аргинина (2 мг/мл)
10 мМ буфера, 300
0,2
0,3
1,0
0,8
-0,2
мМ аргинина (8 мг/мл)
10 мМ буфера, 500
0,2
0,3
1,0
0,8
-ОД
мМ аргинина (5 мг/мл)
30 мМ буфера, 100
0,2
0,2
0,0
0,4
0,4
0,0
мМ аргинина (2 мг/мл)
30 мМ буфера, 100
0,2
0,2
0,0
0,6
0,5
-ОД
мМ аргинина (8 мг/мл)
30 мМ буфера, 300
0,2
0,3
0,6
0,5
-од
мМ аргинина (5 мг/мл) флакон А
30 мМ буфера, 300
0,2
0,3
0,6
0,5
-од
мМ аргинина (5 мг/мл) флакон В
30 мМ буфера, 300
0,2
0,2
0,0
0,6
0,5
0,0
мМ аргинина (5 мг/мл) флакон С
30 мМ буфера, 500
0,2
0,3
0,5
0,5
0,0
мМ аргинина (2 мг/мл)
образцахс цитратом является относительно стабильным. Образцы с сукцинатом также имеют низкий уровень агрегатов, за исключением образцов с 100 мМ аргинина, это свидетельствует о том, что для сукцинатного буфера потребуется более 100 мМ аргинина для поддержания низкого уровня агрегации белков. В контрольном растворе (10 мМ фосфат, 150 мМ NaCl и 0,0033 % (вес/объем) полиоксиэтилен (20) сорбитанмонолаурата, рН 6 и 5 мг/мл) уровень агрегатов после 1-дневной инкубации при 40 °С составлял 3,7 % (см. таблицу 8).
Депегилирование представляет собой другой механизм деградации белков. В таблице 10 приведены результаты исследования депегилирования продукта с помощью эксклюзионной хроматографии, которые показывают, что уровень депегилирования в образцах с сукцинатом выше (0,4 %-0,8 %), чем в содержащих цитрат образцах ( <0,3 %). Уровень депегилирования в контрольном растворе на основе фосфата выше, чем во всех образцах состава на основе цитрата и незначительно выше, чем в большинстве составов на основе сукцината.
Поскольку согласно результатам эксклюзионной хроматографии содержащие цитрат образцы, которые инкубировали 1 день при 40 °С, имеют минимальный уровень агрегатов, некоторые образцы из исследования DOE №1 могут быть инкубированы при 25 °С в течение 28 дней. Представленные ниже условия образцов могут быть исследованы с помощью эксклюзионной хроматографии:
1. 30 мМ цитрата, 100 мМ аргинина в 2 мг/мл
2. 30 мМ цитрата, 500 мМ аргинина в 2 мг/мл
3. 30 мМ цитрата, 100 мМ аргинина в 8 мг/мл
4. 30 мМ цитрата, 500 мМ аргинина в 8 мг/мл
5. 30 мМ цитрата, 300 мМ аргинина в 5 мг/мл
В таблице 11 приведены результаты анализов с помощью эксклюзионной хроматографии в течение 28 дней эксперимента. Кроме того, отсутствие деградации продукта может быть подтверждено с помощью обращенно-фазовой высокоэффективной жидкостной хроматографии образцов, инкубировавшихся в течение 28 дней. Эти результаты приведены в таблице 12.
Пример 4
Оценка совместимости противоиона и шприца
Может быть проведено сравнение анионов хлорида и сульфата в качестве противоионов для аргинина. Образец может содержать 30 мМ цитрата и 300 мМ аргинина в 5 мг/мл (рН 6). Кроме того, может быть проведено исследование совместимости продукта в 3 мл полипропиленовом шприце MONOJECT для заполнения лекарственными препаратами в сравнении с 1 мл стеклянными флаконами. Буфер на основе 30 мМ цитрата, 300 мМ аргинина с рН 6 (хлорид) может быть приготовлен с использованием цитрата натрия и аргинина-HCl, раствор может быть протитрован с помощью 6 н. НС1. Буфер, содержащий 30 мМ цитрата, 300 мМ аргинина с рН 6 (сульфат), может быть приготовлен с использованием моногидрата лимонной кислоты, цитрата натрия и основного аргинина, раствор может быть протитрован с помощью концентрированной серной кислоты. Образец 6Г-КСФ-Т133-20К ПЭГ может быть подвергнут диализу с использованием двух буферов. Образцы могут быть исследованы с помощью эксклюзионной хроматографии в нулевой момент времени. Один набор образцов может быть помещен в 1 мл стеклянный флакон для лиофилизации, а второй в 3 мл шприцы перед инкубацией при 40 °С в течение 3 дней.
В таблице 13 приведены результаты эксклюзионной хроматографии. Эти результаты показывают, что в образцах, которые хранятся в шприцах, образование агрегатов в два-три раза выше, чем в образцах из стеклянных флаконов. Уровень депегилирования продукта остается таким же, как и в нулевой момент времени. При оценке двух противоионов установлено, что образцы в стеклянных флаконах имеют минимальные изменения уровня агрегатов после 3 дней инкубации при температуре 40 °С. Таким образом, хлорид может быть использован вместо сульфата в качестве противоиона без влияния на уровень агрегатов.
Хлорид (шприц)
1,2
98, 5
0,3
2,2
97, 5
0,3
4,0
95, 5
0,4
4,9
94, 6
0,5
Сульфат (шприц)
1,6
98, 1
0,3
2,1
97, 5
0,3
3,5
96, 1
0,4
4,6
95, 0
0,5
Пример 5
Полный план трехфакторного, 2-уровневого эксперимента (DOE №2) Второе исследование DOE может быть проведено с целью оценки влияния рН, концентрации аргинина и концентрация белка в цитратном буфере. В таблице 14
приведены условия состава, использованные в DOE №2.
6Г-КСФ-Т133-20К ПЭГ может быть подвергнут диализу в 5 буферных растворах. Образцы 1 и 2 могут быть подвергнуты диализу в буфере, содержащем 30 мМ цитрата и 200 мМ аргинина при рН 5,0. Образцы 3 и 4 могут быть подвергнуты диализу в буфере, содержащем 30 мМ цитрата и 200 мМ аргинина при рН 5,0. Образцы 5 и 6 могут быть подвергнуты диализу в буфере, содержащем 30 мМ цитрата и 250 мМ аргинина при рН 6,0. Образцы 7 и 8 могут быть подвергнуты диализу в буфере, содержащем 30 мМ цитрата и 300 мМ аргинина при рН 6,0. Образцы 9 и 10 могут быть подвергнуты диализу в буфере, содержащем 30 мМ цитрата и 300 мМ аргинина при рН 5,5. Каждый образец после диализа может быть доведен до конечной концентрации целевого продукта, а затем разделен на 2 аликвоты х 1 мл в стеклянных флаконах для лиофилизации с получением двух наборов образцов: один набор может храниться при
температуре 2-8 °С в качестве контроля, второй набор может храниться при температуре 40 °С в течение трех дней.
В таблице 15 приведены результаты эксклюзионной хроматографии. Изменение уровня агрегатов варьируется от -0,1 % до 2,1 %. Более высокий уровень агрегатов строго коррелирует с более высокой концентрацией продукта. Разность уровней депегилирования варьирует от 0,1 % до 0,8 %. Незначительно более высокий уровень депегилирования коррелирует с низкой концентрацией продукта при низких значениях рН. При снижении рН уровень депегилирования увеличивается, и эта тенденция согласуется с более ранними наблюдениями в исследованиях свойств субстанций-кандидатов для использования в производстве готовых препаратов.
ПРИМЕР 6
Исследование с принудительным перемешиванием
Может быть проведено исследование с принудительным перемешиванием с целью оценки стабильности белка в препаратах. Образцы могут быть получены путем диализа 6Г-КСФ-Т133-20К ПЭГ (16,6 мг/мл белка в 10 мМ ацетата натрия, 5 % сорбита при рН 4,0) против 30 мМ цитрата и 250 мМ аргинина при рН 6,0. Часть материала после диализа может быть разбавлена до целевой концентрации 5 мг/мл, с использованием буфера, содержащего 30 мМ цитрата и 250 мМ аргинина при рН 6,0. После этого объединенная фракция может быть профильтрована через 0,22 мкм фильтр и подвергнута принудительному перемешиванию в стеклянном стакане при 60 оборотах в минуту с помощью магнитной мешалки в течение двух часов при комнатной температуре. Образцы могут быть отобраны каждые 30 минут.
Во всех временных точках все образцы были прозрачными, бесцветными и без видимых частиц. В таблице 16 приведена результаты измерения концентрации белка, поглощения при 550 нм и рН для каждого момента времени.
Концентрация белка остается стабильной в течение смешивания. Значение рН остается постоянным в течение всего эксперимента. Как показано в Таблице 17, состав продукта согласно данным эксклюзионной хроматографии также является постоянным в течение всего исследования. В целом, результаты этого исследования показывают, что белок является стабильным в течение всего периода принудительного перемешивания.
Тодмин
перемешанный
1,6
98,2
0,3
ТбОмин КОНТРОЛЬ
1,6
98,1
0,3
TI20MHH
перемешанный
1,6
98,2
0,3
Пример 7
Исследование с использованием метода замораживания-оттаивания Исследование с использованием метода замораживания-оттаивания может быть проведено с целью определения концентрации белка и рН различных образцов. Белок в образцах может быть подвергнут пяти или менее циклам замораживания и оттаивания. Образцы могут быть профильтрованы через 0,22 мкм фильтры и распределены в 15 мл флаконы. Одна аликвота может быть использована в качестве контроля. Для трех оставшихся аликвот каждый цикл замораживания-оттаивания мог состоять из замораживания раствора белка в течение одного часа при -75±5 °С и оттаивания при комнатной температуре в течение примерно одного часа до исчезновения льда. Раствор образца во флаконе может быть перемешан путем аккуратного вращения флакона три раза. Одна аликвота может быть оставлена для испытания после первого, второго и пятого цикла замораживания и оттаивания.
Во всех временных точках все образцы являются прозрачными, бесцветными и не имеют видимых частиц. В таблице 18 приведены результаты измерения концентрации белка, поглощения при 550 нм и рН для каждого момента времени.
хроматографии является сопоставимым во всех временных точках и приведен в таблице 19.
Таблица 19. Совокупные результаты эксклюзионной хроматографии в
ФОРМУЛА ИЗОБРЕТЕНИЯ
1. Стабильный водный состав, содержащий полипептид 6Г-КСФ (бычий
Гранулоцитарный колониестимулирующий фактор) или его вариант, буферное
вещество и вспомогательное вещество, причем указанный состав по существу не
содержит полиоксиэтилен (20) сорбитанмонолаурат.
2. Состав п. 1, отличающийся тем, что полипептид 6Г-КСФ или его вариант связан с линкером, полимером или биологически активной молекулой.
3. Состав п. 1, отличающийся тем, что полипептид 6Г-КСФ или его вариант связан с водорастворимым полимером.
4. Состав по п. 3, отличающийся тем, что водорастворимый полимер содержит полиэтиленгликолевый фрагмент.
5. Состав по п. 4, отличающийся тем, что водорастворимый полимер имеет молекулярную массу от приблизительно 0,1 кДа до приблизительно 100 кДа.
6. Состав по п. 4, отличающийся тем, что водорастворимый полимер имеет молекулярную массу от приблизительно 0,1 кДа до приблизительно 50 кДа.
7. Состав по п. 4, отличающийся тем, что водорастворимый полимер имеет молекулярную массу приблизительно 20 кДа.
8. Состав по п. 1, отличающийся тем, что полипептид 6Г-КСФ или его вариант представляет собой бГ-КСФ-Т133рАГ-20К ПЭГ.
9. Состав по п. 1, отличающийся тем, что полипептид 6Г-КСФ или его вариант присутствует в количестве от приблизительно 0,5 до приблизительно 12 г/л.
10. Состав по п. 9, отличающийся тем, что полипептид 6Г-КСФ или его вариант присутствует в количестве приблизительно 5 г/л.
11. Состав по п. 1, отличающийся тем, что буферное вещество представляет собой цитрат, гистидин, малеат, сукцинат, фосфат или их комбинацию.
12. Состав по п. 11, отличающийся тем, что буферное вещество представляет собой цитрат или сукцинат.
13. Состав по п. 12, отличающийся тем, что буферное вещество представляет собой цитрат.
14. Состав по п. 12, отличающийся тем, что буферное вещество представляет собой сукцинат.
15. Состав по п. 12, отличающийся тем, что буферное вещество имеет
молярность от приблизительно 10 до приблизительно 50 мМ.
16. Состав по п. 15, отличающийся тем, что буферное вещество имеет молярность приблизительно 30 мМ.
17. Состав по п. 1, отличающийся тем, что вспомогательное вещество представляет собой хлорид натрия, трегалозу, сорбит, аргинин или их комбинацию.
18. Состав по п. 17, отличающийся тем, что вспомогательное вещество представляет собой аргинин.
19. Состав по п. 18, отличающийся тем, что аргинин имеет молярность от приблизительно 100 мМ до приблизительно 500 мМ.
20. Состав по п. 19, отличающийся тем, что аргинин имеет молярность от приблизительно 200 мМ до приблизительно 300 мМ.
21. Состав по п. 20, отличающийся тем, что аргинин имеет молярность приблизительно 250 мМ.
22. Состав по п. 1, отличающийся тем, что указанный состав имеет рН от приблизительно 5,7 до приблизительно 6,6.
23. Состав по п. 22, отличающийся тем, что указанный состав имеет рН от приблизительно 6,0 до приблизительно 6,3.
24. Состав по п. 1, отличающийся тем, что средняя концентрация агрегатов полипептида 6Г-КСФ или его варианта в составе ниже приблизительно 2,1 % масс/масс, после пятидневного периода инкубации в неблагоприятных условиях хранения.
25. Состав по п. 1, отличающийся тем, что средняя концентрация агрегатов полипептида 6Г-КСФ или его варианта в составе ниже приблизительно 1,5 % масс/масс, после однодневного периода инкубации в условиях ускоренного старения.
26. Состав по п. 1 возможно включающий один или более других терапевтических ингредиентов.
27. Лиофилизат или порошок состава по п. 1.
28. Водный раствор, полученный путем растворения лиофилизата или порошка по п. 27 в воде.
29. Способ приготовления состава по п. 1, включающий получение стабильного водного раствора, содержащего полипептид 6Г-КСФ или его вариант, буферное вещество и вспомогательное вещество, причем указанный состав по существу не содержит полиоксиэтилен (20) сорбитанмонолаурат.
30. Способ лечения животного, которое имеет заболевание, модулируемое 6Г-КСФ, включающий введение указанному животному терапевтически эффективного количества состава по п. 1.
16.
31. Способ по п. 30, отличающийся тем, что указанное заболевание представляет собой инфекцию.
32. Способ по п. 31, отличающийся тем, что указанная инфекция представляет собой мастит, и указанное животное является тельной коровой.
33. Стабильный водный состав, включающий полипептид 6Г-КСФ или его вариант, цитратный или сукцинатный буфер, аргинин и возможно противоион для аргинина.
34. Состав по п. 33, отличающийся тем, что указанный состав по существу не содержит поверхностно-активное вещество, содержащее полисорбат.
35. Состав по п. 33, отличающийся тем, что полипептид 6Г-КСФ или его вариант связан с линкером, полимером или биологически активной молекулой.
36. Состав по п. 33, отличающийся тем, что полипептид 6Г-КСФ или его вариант связан с водорастворимым полимером.
37. Состав по п. 36, отличающийся тем, что водорастворимый полимер содержит полиэтиленгликолевый фрагмент.
38. Состав по п. 37, отличающийся тем, что водорастворимый полимер имеет молекулярную массу от приблизительно 0,1 кДа до приблизительно 100 кДа.
39. Состав по п. 37, отличающийся тем, что водорастворимый полимер имеет молекулярную массу приблизительно от приблизительно 0,1 кДа до приблизительно 50 кДа.
40. Состав по п. 37, отличающийся тем, что водорастворимый полимер имеет молекулярную массу приблизительно 20 кДа.
41. Состав по п. 34, отличающийся тем, что указанное поверхностно-активное вещество, содержащее полисорбат, представляет собой полиоксиэтиленовое производное монолаурата натрия.
42. Состав по п. 34, отличающийся тем, что указанное поверхностно-активное вещество, содержащее полисорбат, представляет собой полиоксиэтилен (20) сорбитанмонолаурат.
43. Состав по п. 33, отличающийся тем, что полипептид 6Г-КСФ или его вариант представляет собой бГ-КСФ-Т133рАГ-20К ПЭГ.
44. Состав по п. 43, отличающийся тем, что полипептид бГ-КСФ-Т133рАГ-20К ПЭГ присутствует в количестве от приблизительно 0,5 до приблизительно 12 г/л, молярность цитратного буфера составляет приблизительно 30 мМ, молярность аргинина составляет приблизительно 250 мМ, причем состав имеет рН, приблизительно равный 6,0.
16.
45. Состав по п. 43, отличающийся тем, что средняя концентрация агрегатов 6Г-КСФ-Т133рАБ-20К ПЭГ в составе ниже приблизительно 1,6% масс/масс, после инкубации в течение 28 дней при температуре 25 °С.
46. Состав по п. 43, отличающийся тем, что средняя концентрация агрегатов 6Г-KCO-T133pAF-20K ПЭГ в составе ниже приблизительно 2,8 % масс/масс, после инкубации в течение 3 дней при температуре 40 °С.
47. Состав по п. 43, отличающийся тем, что средняя концентрация агрегатов 6Г-KC 48. Состав по п. 43, отличающийся тем, что средняя концентрация агрегатов 6Г-KC 49. Состав по п. 33, отличающийся тем, что противоион для аргинина представляет собой хлорид или сульфат.
50. Состав по п. 33 возможно включающий один или более других терапевтических ингредиентов.
51. Лиофилизат или порошок состава по п. 33.
52. Водный раствор, полученный путем растворения лиофилизата или порошка по п. 51 в воде.
53. Способ приготовления состава по п. 33, включающий получение стабильного водного раствора, содержащего полипептид 6Г-КСФ или его вариант, цитратный буфер, аргинин и возможно противоион для аргинина.
54. Способ по п. 53, отличающийся тем, что состав по существу не содержит поверхностно-активное вещество, содержащее полисорбат.
55. Способ по п. 53, отличающийся тем, что полипептид 6Г-КСФ или его вариант представляет собой бГ-КСФ-Т133рАГ-20К ПЭГ.
56. Способ лечения животного, которое имеет заболевание, модулируемое 6Г-КСФ, включающий введение указанному животному терапевтически эффективного количества состава по п. 33.
57. Способ по п. 56, отличающийся тем, что указанное заболевание представляет собой инфекцию.
58. Способ по п. 57, отличающийся тем, что указанная инфекция представляет собой мастит, и указанное животное является тельной коровой.
51.
59. Стабильный водный состав, состоящий по существу из полипептида 6Г-КСФ или его варианта, цитратного или сукцинатного буфера, аргинина и возможно противоиона для аргинина.
60. Состав по п. 59, отличающийся тем, что состав по существу не содержит поверхностно-активное вещество.
61. Состав по п. 59, отличающийся тем, что полипептид 6Г-КСФ или его вариант связан с линкером, полимером или биологически активной молекулой.
62. Состав по п. 59, отличающийся тем, что полипептид 6Г-КСФ или его вариант связан с водорастворимым полимером.
63. Состав по п. 62, отличающийся тем, что водорастворимый полимер содержит полиэтиленгликолевый фрагмент.
64. Состав по п. 63, отличающийся тем, что водорастворимый полимер имеет молекулярную массу от приблизительно 0,1 кДа до приблизительно 100 кДа.
65. Состав по п. 63, отличающийся тем, что водорастворимый полимер имеет молекулярную массу от приблизительно 0,1 кДа до приблизительно 50 кДа.
66. Состав по п. 63, отличающийся тем, что водорастворимый полимер имеет молекулярную массу приблизительно 20 кДа.
67. Состав по п. 60, отличающийся тем, что указанное поверхностно-активное вещество представляет собой полисорбат.
68. Состав по п. 67, отличающийся тем, что указанное поверхностно-активное вещество представляет собой полиоксиэтиленовое производное монолаурата натрия.
69. Состав по п. 68, отличающийся тем, что указанное поверхностно-активное вещество представляет собой полиоксиэтилен (20) сорбитанмонолаурат.
70. Состав по п. 59, отличающийся тем, что полипептид 6Г-КСФ или его вариант представляет собой бГ-КСФ-Т133рАГ-20К ПЭГ.
71. Состав по п. 70, отличающийся тем, что полипептид бГ-КСФ-Т133рАГ-20К ПЭГ присутствует в количестве приблизительно от 0,5 до 12 г/л, цитратный буфер имеет молярность примерно 30 мМ, аргинин имеет молярность примерно 250 мМ, причем рН состава приблизительно равен 6,0.
72. Состав по п. 70, отличающийся тем, что средняя концентрация агрегатов 6Г-КСФ-Т133рАГ-20К ПЭГ в составе ниже приблизительно 1,6% масс/масс, после инкубации в течение 28 дней при температуре 25 °С.
73. Состав по п. 70, отличающийся тем, что средняя концентрация агрегатов 6Г-КСФ-Т133рАГ-20К ПЭГ в составе ниже приблизительно 2,8 % масс/масс, после инкубации в течение 3 дней при температуре 40 °С.
51.
74. Состав по п. 70, отличающийся тем, что средняя концентрация агрегатов 6Г-КСФ-Т133рАБ-20К ПЭГ в составе ниже приблизительно 1,6 % масс/масс, или меньше после исследования с принудительным перемешиванием.
75. Состав по п. 70, отличающийся тем, что средняя концентрация агрегатов 6Г-KCO-T133pAF-20K ПЭГ в составе ниже приблизительно 1,6 % масс/масс, после пяти циклов замораживания-оттаивания.
76. Состав по п. 70, отличающийся тем, что противоион для аргинина представляет собой хлорид или сульфат.
77. Состав по п. 59, возможно содержащий один или более других терапевтических ингредиентов.
78. Лиофилизат или порошок состава по п. 59.
79. Водный раствор, полученный путем растворения лиофилизата или порошка по п. 78 в воде.
80. Способ приготовления состава по п. 59, включающий получение стабильного водного раствора, состоящего по существу из полипептида 6Г-КСФ или его варианта, цитратного буфера, аргинина и возможно противоиона для аргинина.
81. Способ по п. 80, отличающийся тем, что состав по существу не содержит поверхностно-активное вещество.
82. Способ по п. 80, отличающийся тем, что полипептид 6Г-КСФ или его вариант представляет собой бГ-КСФ-Т133рАГ-20К ПЭГ.
83. Способ лечения животного, которое имеет заболевание, модулируемое 6Г-КСФ, включающий введение указанному животному терапевтически эффективного количества состава по п. 59.
84. Способ по п. 83, отличающийся тем, что указанное заболевание представляет собой инфекцию.
85. Способ по п. 84, отличающийся тем, что указанная инфекция представляет собой мастит, и указанное животное является тельной коровой.
86. Стабильный водный состав, состоящий по существу из бГ-КСФ-Т133рАГ-20К ПЭГ, цитратный буфер, причем цитратный буфер имеет молярность примерно 30 мМ, аргинин, причем аргинин имеет молярность примерно 250 мМ, и возможно противоион для аргинина.
(19)
(19)
(19)
(19)
(19)