Патентная документация ЕАПВ

 
Запрос :  ea000025891b*\id

больше ...
Термины запроса в документе


Полный текст патента

(57) Реферат / Формула:

1. Вариант белка ActRIIB, содержащий аминокислотную последовательность, которая по меньшей мере на 80% идентична последовательности аминокислот 29-109 SEQ ID NO:2, где указанный белок содержит по меньшей мере одну последовательность N-X-S/T в положении, отличающемся от положения эндогенной последовательности N-X-S/T ActRIIB, и где указанная по меньшей мере одна последовательность N-X-S/T находится в положении, находящемся за пределами лигандсвязывающего кармана.

2. Вариант белка ActRIIB по п.1, где указанный белок содержит N в положении, соответствующем положению 24 SEQ ID NO:2, и S или Т в положении, соответствующем положению 26 SEQ ID NO:2, и где указанный белок ингибирует передачу сигнала под действием активина, миостатина и/или GDF11 в клеточном анализе.

3. Вариант белка ActRIIB по п.1, где указанный белок содержит R или K в положении, соответствующем положению 64 SEQ ID NO:2.

4. Вариант белка ActRIIB по п.1, где указанный белок содержит по меньшей мере одну дополнительную модификацию по отношению к последовательности SEQ ID NO:2 и где указанная по меньшей мере одна дополнительная модификация представляет собой консервативную модификацию, расположенную в лигандсвязывающем кармане.

5. Вариант белка ActRIIB по п.1, где указанный белок содержит по меньшей мере одну дополнительную модификацию по отношению к последовательности SEQ ID NO:2 и где указанная по меньшей мере одна дополнительная модификация представляет собой модификацию в одном или более положениях, выбранных из группы, состоящей из K74, R40, Q53, K55, F82 и L79 SEQ ID NO:2.

6. Вариант белка ActRIIB по п.1, где указанный белок содержит аминокислотную последовательность, начинающуюся в положении аминокислоты, соответствующем любой из аминокислот 22-25 SEQ ID NO:2, и заканчивающуюся в положении аминокислоты, соответствующем любой из аминокислот 131, 133 или 134 SEQ ID NO:2.

7. Вариант белка ActRIIB по любому из пп.1-6, где указанный белок представляет собой слитый белок, дополнительно содержащий гетерологичную часть.

8. Вариант слитого белка ActRIIB по п.7, где указанный белок представляет собой гомодимер.

9. Вариант слитого белка ActRIIB по п.7, где указанная гетерологичная часть содержит константную область тяжелой цепи IgG.

10. Вариант белка ActRIIB по любому из пп.1-9, где указанный белок содержит аминокислотную последовательность, которая по меньшей мере на 90% идентична последовательности аминокислот 29-109 SEQ ID NO:2.

11. Вариант белка ActRIIB по любому из пп.1-9, где указанный белок содержит аминокислотную последовательность, которая по меньшей мере на 95% идентична последовательности аминокислот 29-109 SEQ ID NO:2.

12. Вариант белка ActRIIB по любому из пп.1-9, где указанный белок содержит аминокислотную последовательность, которая по меньшей мере на 99% идентична последовательности аминокислот 29-109 SEQ ID NO:2.


(19)
Евразийское
патентное
ведомство
025891
(13) B1
(12) ОПИСАНИЕ ИЗОБРЕТЕНИЯ К ЕВРАЗИЙСКОМУ ПАТЕНТУ
(45) Дата публикации и выдачи патента 2017.02.28
(21) Номер заявки 201300713
(22) Дата подачи заявки 2008.02.04
(51) Int. Cl.
C07K14/00 (2006.01) C07K14/705 (2006.01)
C07K 14/71 (2006.01)
C07K16/18 (2006.01)
(54) ВАРИАНТЫ, ПРОИСХОДЯЩИЕ ИЗ ActRIIB, И ИХ ПРИМЕНЕНИЕ
(31) 60/899,304; 60/927,088; 60/931,880
(32) 2007.02.02; 2007.05.01; 2007.05.25
(33) US
(43) 2014.03.31
(62) 200970729; 2008.02.04
(71) (73) Заявитель и патентовладелец:
АКСЕЛЕРОН ФАРМА ИНК. (US)
(72) Изобретатель:
Нопф Джон, Кумар Равиндра, Сихра Джасбир (US)
(74) Представитель:
Медведев В.Н. (RU) (56) WO-A2-2006012627
BHATIA Prakash K. et al. Protein Glycosylation: Implications for In Vivo Functions and Therapeutic Applications. Advances in Biochemical Engineering/Biotechnology, 1998, vol. 64, pp. 155-201, реферат, с. 187, 188
(57) В некоторых своих аспектах изобретение относится к композициям и к способам, применяемым для модуляции (стимуляции или ингибирования) роста ткани, такой как костная ткань, хрящевая ткань, мышечная ткань, жировая ткань и/или нервная ткань. Изобретение также относится к способам скрининга соединений, модулирующих активность белка ActRIIB и/или лиганда ActRIIB. Описанные здесь композиции и способы могут быть применены для лечения заболеваний, ассоциированных с аномальной активностью белка ActRIIB и/или лиганда ActRIIB.
Перекрестная ссылка на родственные заявки
В настоящей заявке испрашивается преимущество предварительной заявки рег. № 60/899304, поданной 2 февраля 2007 г., предварительной заявки рег. № 60/927088, поданной 1 мая 2007 г., и предварительной заявки рег. № 60/931880, поданной 25 мая 2007 г. Все описания вышеуказанных заявок вводятся в настоящее описание посредством ссылки.
Предшествующий уровень техники
Суперсемейство трансформирующего фактора роста-бета (TGF-бета) содержит ряд факторов роста, которые имеют общие элементы и структурные мотивы последовательностей. Известно, что эти белки оказывают биологическое действие на клетки широкого ряда позвоночных и беспозвоночных различных типов. Члены этого суперсемейства белков играют важную роль в образовании структуры и формировании ткани в процессе эмбрионального развития и могут оказывать влияние на различные процессы диф-ференцировки, включая адипогенез, миогенез, хондрогенез, кардиогенез, гемопоэз, нейрогенез и диффе-ренцировку эпителиальных клеток. Это семейство подразделяется на две основных ветви: BMP/GDF и TGF-бета/активин/ВМРЮ, члены которых обладают различными, а часто дополнительными функциями. При изменении активности члена семейства TGF-бета в организме часто могут происходить значительные физиологические изменения. Так, например, у крупного рогатого скота пьемонтской породы и породы "бельгийская голубая" имеется мутация в гене GDF8 (также называемом миостатином), приводящая к потере его функции, что вызывает значительное увеличение мышечной массы (Grobet et al., Nat Genet. 1997, 17(1):71-4). Кроме того, у человека неактивные аллели GDF8 ассоциируются с увеличением мышечной массы и, как сообщалось, с исключительно высокой мышечной силой (Schuelke et al., N. Engl. J. Med. 2004, 350:2682-8).
Изменения в мышцах, костях, хрящах и в других тканях могут быть достигнуты путем активации или подавления передачи сигнала, опосредуемого соответствующим членом семейства TGF-бета. А поэтому в настоящее время необходимо разработать средства, которые будут служить сильными регуляторами передачи сигнала TGF-бета.
Описание сущности изобретения
В некоторых своих аспектах настоящее изобретение относится к полипептидам ActRIIB, в частности, к вариантам ActRIIB, включая амино- и карбоксиконцевые усечения и альтерации последовательностей. Такие полипептиды ActRIIB могут быть использованы для лечения различных расстройств или состояний, в частности мышечных и нейромышечных расстройств (например, мышечной дистрофии, амиотрофического бокового склероза (АБС) и атрофии мышц); расстройств, ассоциированных с отложением жира в ткани (например, ожирения); метаболических расстройств (например, диабета типа 2); ней-родегенеративных расстройств и гипотрофии мышц, ассоциированной со старением (саркопении); рака предстательной железы и кахексии при раке. В конкретных вариантах изобретения полипептиды ActRIIB (например, растворимые полипептиды ActRIIB) могут служить антагонистами рецептора ActRIIB в любом процессе, ассоциированном с активностью ActRIIB. Могут быть сконструированы, но необязательно, полипептиды ActRIIB согласно изобретению, которые будут преимущественно антагонистами одного или нескольких лигандов рецепторов ActRIIB, таких как GDF8 (также называемый миостатином), GDF11, активин А, активин В, активин АВ, Nodal и ВМР7 (также называемый ОР-1), а поэтому могут быть использованы для лечения других расстройств. Примерами полипептидов ActRIIB являются природные полипептиды ActRIIB, a также их функциональные варианты. Настоящее изобретение также относится к ряду вариантов, происходящих от ActRIIB, которые вызывают значительное снижение аффинности к активину, но при этом сохраняют способность связываться с GDF11. Такие варианты оказывают желаемое воздействие на мышцы, но оказывают более слабое воздействие на другие ткани.
В некоторых своих аспектах настоящее изобретение относится к фармацевтическим препаратам, включающим растворимый полипептид ActRIIB, который связывается с лигандом ActRIIB, таким как GDF8, GDF11, активин, ВМР7 или Nodal, и фармацевтически приемлемый носитель. Растворимый полипептид ActRIIB связывается, но необязательно, с лигандом ActRIIB с Kd, составляющим менее чем 10 мкМ или менее чем 1 мкМ, 100, 10 или 1 нМ. Растворимый полипептид ActRIIB ингибирует, но необязательно, передачу сигнала ActRIIB, такую как передача внутриклеточного сигнала, запускаемая лигандом ActRIIB. Растворимый полипептид ActRIIB, который может быть использован в таком препарате, может представлять собой любой из полипептидов, описанных в настоящей заявке, такой как полипептид, имеющий аминокислотную последовательность, выбранную из SEQ ID №№: 1, 2, 5, 6 и 12, или аминокислотную последовательность, которая по меньшей мере на 80, 85, 90, 95, 97 или 99% идентична аминокислотной последовательности, выбранной из SEQ ID №№: 1, 2, 5, 6 и 12. Растворимый полипептид Ac-tRIIB может включать функциональный фрагмент природного полипептида ActRIIB, например фрагмент, содержащий по меньшей мере 10, 20 или 30 аминокислот последовательности, выбранной из SEQ ID №№: 1, 2, 5, 6 и 12 или последовательности SEQ ID NO:1, в которой отсутствуют 1, 2, 3, 4, 5 или 10-15 С-концевых аминокислот и 1, 2, 3, 4 или 5 N-концевых аминокислот. Предпочтительный полипептид в отличие от SEQ ID NO:1 может иметь усечение в 2-5 аминокислот у N-конца и не более чем в 3 аминокислоты у С-конца. Другим предпочтительным полипептидом является полипептид, представленный в SEQ ID NO:12. Растворимый полипептид ActRIIB в отличие от природного полипептида ActRIIB может
включать одну или несколько модификаций в аминокислотной последовательности (например, в лига-ндсвязывающем домене). Модификация в аминокислотной последовательности в отличие от природного полипептида ActRIIB может вызывать, например, изменение характера гликозилирования полипептида, продуцируемого у млекопитающих, насекомых или в других эукариотических клетках, или изменение уровня протеолитического расщепления полипептида. Растворимым полипептидом ActRIIB может быть слитый белок, который в качестве одного домена имеет полипептид ActRIIB (например, лига-ндсвязывающий домен ActRIIB или его вариант) и один или несколько дополнительных доменов, которые сообщают нужные свойства, такие как улучшенные фармакокинетические свойства, способность к более легкой очистке, способность к нацеливанию на конкретные ткани и т. п. Так, например, домен слитого белка может усиливать одно или несколько свойств, таких как in vivo стабильность, время полужизни in vivo, способность к поглощению/внедрению, локализация или распределение в ткани, образование белковых комплексов, мультимеризация слитого белка и/или очистка. Растворимый слитый белок Ac-tRIIB может включать Fc-домен иммуноглобулина (дикого типа или мутантный) или сывороточный альбумин. В некоторых вариантах изобретения гибрид ActRIIB-Fc включает относительно неструктурированный линкер, расположенный между Fc-доменом и внеклеточным доменом ActRIIB. Этот неструктурированный линкер может соответствовать неструктурированной области, состоящей приблизительно из 15 аминокислот и находящейся у С-конца внеклеточного домена ActRIIB ("хвоста"), либо он может представлять собой искусственную последовательность, состоящую из 5-15, 20, 30, 50 или более аминокислот и в основном не содержащую вторичной структуры. Линкер может быть обогащен глициновыми и пролиновыми остатками и может, например, содержать повторяющиеся последовательности треони-на/серина и глицинов (например, повторы TG4 или SG4). Слитый белок может включать подпоследовательность для очистки, такую как эпитопная метка, метка FLAG, полигистидиновая последовательность и GST-гибрид. Растворимый полипептид ActRIIB включает, но необязательно, один или несколько модифицированных аминокислотных остатков, выбранных из гликозилированной аминокислоты, ПЭГили-рованной аминокислоты, фарнезилированной аминокислоты, ацетилированной аминокислоты, биотини-лированной аминокислоты, аминокислоты, конъюгированной с липидной молекулой, и аминокислоты, конъюгированной с органическим дериватизирующим агентом. Фармацевтический препарат может также включать одно или несколько дополнительных соединений, таких как соединение, которое может быть использовано для лечения ActRIIB-ассоциированного расстройства. Предпочтительно фармацевтический препарат является, по существу, апирогенным. Вообще говоря, предпочтительно, чтобы белок ActRIIB экспрессировался в клеточной линии млекопитающих, которая опосредует соответствующее природное гликозилирование белка ActRIIB, что позволило бы снизить вероятность возникновения нежелательного иммунного ответа у пациента. В настоящее время с успехом используются человеческие клеточные линии и клеточные линии СНО, но при этом предполагается, что могут быть использованы и другие стандартные экспрессионные векторы млекопитающих.
В некоторых своих аспектах настоящее изобретение относится к фармацевтическим средствам в упаковках, содержащих описанный здесь фармацевтический препарат и этикетку, в которой указывается на возможность применения этого препарата для стимуляции роста ткани либо снижения или предотвращения потери ткани у человека. Репрезентативными тканями являются ткани костей, хряща, мышц, жировые ткани и нервные ткани.
В некоторых своих аспектах настоящее изобретение относится к растворимым полипептидам Ac-tRIIB, содержащим модифицированный лигандсвязывающий (например, GDF8-связывающий) домен. Такие модифицированные лигандсвязывающие домены рецептора ActRIIB имеют одну или несколько мутаций в аминокислотных остатках, таких как Е37, Е39, R40, K55, R56, Y60, А64, K74, W78, L79, D80, F82 и F101 человеческого ActRIIB (нумерация сделана по отношению к SEQ ED NO:2). Модифицированный лигандсвязывающий домен в отличие от лигандсвязывающего домена рецептора ActRIIB дикого типа может иметь, но необязательно, повышенную селективность по отношению к лиганду, такому как GDF8/GDF11. Для иллюстрации мутациями, представленными в настоящей заявке, являются мутации K74Y, K74F, K74I и D80I, повышающие селективность модифицированного лигандсвязывающего домена к GDF11 (а следовательно, предположительно, к GDF8), но не к активину (данные приводятся для ActRIIB). Нижеследующие мутации, а именно D54A, ^5А, L79A и F82A, дают обратный эффект, то есть приводят к увеличению отношения связывания активина по отношению к GDF11. Общая активность связывания (с GDF11 и активином) может быть повышена путем включения области "хвоста" или предположительно неструктурированной линкерной области, а также путем введения мутации Ю4А. Другими мутациями, которые приводят к общему снижению аффинности связывания с лигандом, являются
R40A, Е37А, R56A, W78A, D80K, D80R, D80A, D80G, D80F, D80M и D80N. Мутации могут быть объединены для достижения желаемых эффектов. Так, например, многие мутации, которые влияют на отношение связывания GDF11:активин, в целом, оказывают негативное влияние на связывание с лигандом, а поэтому они могут быть объединены с мутациями, которые в основном повышают уровень связывания с лигандом, что будет приводить к повышению селективности связывания белка с лигандом.
Модифицированный лигандсвязывающий домен имеет, но необязательно, отношение Kd для связывания с активином к Kd для связывания с GDF8, которое по меньшей мере в 2, 5, 10 или даже в 100 раз
превышает отношение для лигандсвязывающего домена дикого типа. Модифицированный лига-ндсвязывающий домен имеет, но необязательно, отношение IC50 для ингибирования активина к IC50 для ингибирования GDF8/GDF11, которое по меньшей мере в 2, 5, 10 или даже в 100 раз превышает отношение для лигандсвязывающего домена дикого типа. Указанный модифицированный лигандсвязывающий домен ингибирует, но необязательно, GDF8/GDF11 с IC50, которая по меньшей мере в 2, 5, 10 или даже в 100 раз ниже, чем IC50 для ингибирования активина. Такими растворимыми полипептидами ActRIIB могут быть слитые белки, включающие Fc-домен иммуноглобулина (дикого типа или мутантный). В некоторых случаях рассматриваемыми растворимыми полипептидами ActRIIB являются антагонисты (ингибиторы) GDF8/GDF11.
Рассматриваются и другие варианты ActRIIB, например варианты, описанные ниже. Вариант слитого белка ActRIIB содержит часть, происходящую из последовательности ActRIIB SEQ ID NO:2, и вторую полипептидную часть, где часть, происходящая от ActRIIB, соответствует последовательности, начинающейся в положениях любой из аминокислот 21-29 последовательности SEQ ID NO:2 (необязательно начинающейся в положениях 22-25 последовательности SEQ ID NO:2) и заканчивающейся в положениях любой из аминокислот 109-134 последовательности SEQ ID NO:2, и где слитый белок ActRIIB ингибиру-ет передачу сигнала под действием активина, миостатина и/или GDF11, как показал клеточный анализ. Описанный выше вариант слитого белка ActRIIB имеет часть, происходящую от ActRIIB, которая соответствует последовательности, начинающейся в любом из положений аминокислот 20-29 последовательности SEQ ID NO:2 (начинающейся, но необязательно, в положениях 22-25 последовательности SEQ ID NO:2) и заканчивающейся в любом из положений аминокислот 109-133 последовательности SEQ ID NO:2. Описанный выше вариант слитого белка ActRIIB имеет часть, происходящую от ActRIIB, которая соответствует последовательности, начинающейся в любом из положений аминокислот 20-24 последовательности SEQ ID NO:2 (начинающейся, но необязательно, в положениях 22-25 последовательности SEQ ID NO:2) и заканчивающейся в любом из положений аминокислот 109-133 SEQ ID NO:2. Вышеописанный вариант слитого белка ActRIIB имеет часть, происходящую от ActRIIB, которая соответствует последовательности, начинающейся в любом из положений аминокислот 21-24 SEQ ID NO:2 и заканчивающейся в любом из положений аминокислот 109-134 SEQ ID NO:2. Вышеописанный вариант слитого белка ActRIIB имеет часть, происходящую от ActRIIB, которая соответствует последовательности, начинающейся в любом из положений аминокислот 20-24 SEQ ID NO:2, и заканчивающейся в любом из положений аминокислот 118-133 SEQ ID NO:2. Вышеописанный вариант слитого белка ActRIIB имеет часть, происходящую от ActRIIB, которая соответствует последовательности, начинающейся в любом из положений аминокислот 21-24 SEQ ID NO:2 и заканчивающейся в любом из положений аминокислот 118-134 SEQ ID NO:2. Вышеописанный вариант слитого белка ActRIIB имеет часть, происходящая от ActRIIB, которая соответствует последовательности, начинающейся в любом из положений аминокислот
20- 24 SEQ ID NO:2 и заканчивающейся в любом из положений аминокислот 128-133 SEQ ID NO:2. Вышеописанный вариант слитого белка ActRIIB имеет часть, происходящую от ActRIIB, которая соответствует последовательности, начинающейся в любом из положений аминокислот 20-24 SEQ ID NO:2 и заканчивающейся в любом из положений аминокислот 128-133 SEQ ID NO:2. Вышеописанный вариант слитого белка ActRIIB имеет часть, происходящую от ActRIIB, которая соответствует последовательности, начинающейся в любом из положений аминокислот 21-29 SEQ ID NO:2 и заканчивающейся в любом из положений аминокислот 118-134 SEQ ID NO:2. Вышеописанный вариант слитого белка ActRIIB имеет часть, происходящую от ActRIIB, которая соответствует последовательности, начинающейся в любом из положений аминокислот 20-29 SEQ ID NO:2 и заканчивающейся в любом из положений аминокислот 118-133 SEQ ID NO:2. Вышеописанный вариант слитого белка ActRIIB имеет часть, происходящую от ActRIIB, которая соответствует последовательности, начинающейся в любом из положений аминокислот
21- 29 SEQ ID NO:2 и заканчивающейся в любом из положений аминокислот 128-134 SEQ ID NO:2. Вышеописанный вариант слитого белка ActRIIB имеет часть, происходящую от ActRIIB, которая соответствует последовательности, начинающейся в любом из положений аминокислот 20-29 SEQ BD NO:2 и заканчивающейся в любом из положений аминокислот 128-133 SEQ ID NO:2. Неожиданно было обнаружено, что конструкции, начинающиеся в положениях 22-25 SEQ ID NO:2, обладают активностью, уровень которой превышает уровень активности белков, имеющих полноразмерный внеклеточный домен человеческого ActRIIB. Любой из вышеописанных вариантов слитого белка ActRIIB может быть продуцирован в виде гомодимера. Любой из вышеуказанных слитых белков ActRIIB может иметь гетероло-гичную часть, которая содержит константную область тяжелой цепи IgG, такую как Fc-домен.
Рассматриваются и другие варианты белков ActRIIB, например варианты, описанные ниже. Вариант белка ActRIIB содержит аминокислотную последовательность, которая по меньшей мере на 80% идентична аминокислотной последовательности, состоящей из аминокислот 29-109 SEQ ID NO:2, где в положении, соответствующем аминокислоте 64 SEQ ID NO:2, присутствуют R или K, и где вариант белка ActRIIB ингибирует передачу сигнала под действием активина, миостатина и/или GDF11 в клеточном анализе. Описанный выше вариант белка ActRIIB по отношению к последовательности SEQ ID NO:2 имеет по меньшей мере одну модификацию, которая находится за пределами лигандсвязывающего кармана. Описанный выше вариант белка ActRIIB по отношению к последовательности SEQ ID NO:2 имеет
по меньшей мере одну консервативную модификацию, расположенную в лигандсвязывающем кармане. Описанный выше вариант белка ActRIIB по отношению к последовательности SEQ ID NO:2 имеет по меньшей мере одну модификацию в одном или более положениях, выбранных из группы, состоящей из K74, R40, Q53, K55, F82 и L79. Описанный выше вариант белка ActRIIB содержит по меньшей мере одну последовательность N-X-S/T в положении, отличающемся от положения эндогенной последовательности N-X-S/T ActRIIB, и в положении, находящемся за пределами лигандсвязывающего кармана.
Рассматриваются и другие варианты белков ActRIIB, например варианты, описанные ниже. Вариант белка ActRIIB содержит аминокислотную последовательность, которая по меньшей мере на 80% идентична аминокислотной последовательности, состоящей из аминокислот 29-109 SEQ ID NO:2, где указанный белок содержит по меньшей мере одну последовательность N-X-S/T в положении, отличающемся от положения эндогенной последовательности N-X-S/T ActRIIB, и в положении, находящемся за пределами лигандсвязывающего кармана. Описанный выше вариант белка ActRIIB содержит N в положении, соответствующем положению 24 SEQ ID NO:2, и S или Т в положении, соответствующем положению 26 SEQ ID NO:2, где указанный вариант белка ActRIIB ингибирует передачу сигнала под действием активина, миостатина и/или GDF11 в клеточном анализе. Описанный выше вариант белка ActRIIB содержит R или K в положении, соответствующем положению 64 SEQ ID NO:2. Описанный выше вариант белка ActRIIB по отношению к последовательности SEQ ID NO:2 имеет по меньшей мере одну консервативную модификацию, расположенную в лигандсвязывающем кармане. Описанный выше вариант белка ActRIIB по отношению к последовательности SEQ ID NO:2 имеет по меньшей мере одну модификацию в одном или более положениях, выбранных из группы, состоящей из K74, R40, Q53, K55, F82 и L79. Описанный выше вариант белка ActRIIB представляет собой слитый белок, который дополнительно содержит гетерологичную часть. Любой из вышеописанных вариантов слитого белка ActRIIB может быть продуцирован в виде гомодимера. Любой из вышеуказанных слитых белков ActRIIB может иметь гетерологичную часть, которая содержит константную область тяжелой цепи IgG, такую как Fc-домен.
В некоторых своих аспектах настоящее изобретение относится к нуклеиновым кислотам, которые кодируют растворимый полипептид ActRIIB, но не кодируют полноразмерный полипептид ActRIIB. Выделенный полинуклеотид может содержать последовательность, кодирующую растворимый полипептид ActRIIB, такой как полипептид, описанный выше. Так, например, выделенная нуклеиновая кислота может включать последовательность, кодирующую внеклеточный домен (например, лигандсвязывающий домен) ActRIIB, и последовательность, кодирующую полноразмерный трансмембранный домен ActRIIB или его часть и/или полноразмерный цитоплазматический домен ActRIIB или его часть, а также стоп-кодон, расположенный в трансмембранном домене или в цитоплазматическом домене или расположенный между внеклеточным доменом и трансмембранным доменом или цитоплазматическим доменом. Так, например, выделенный полинуклеотид может содержать полноразмерную полинуклеотидную последовательность ActRIIB, такую как последовательность SEQ ID NO:4, или ее частично усеченный вариант, где указанный выделенный полинуклеотид также содержит кодоны терминации транскрипции, состоящие по меньшей мере из 600 нуклеотидов, расположенных перед 3'-концом или в каком-либо другом участке таким образом, чтобы трансляция полинуклеотида приводила к образованию внеклеточного домена, присоединенного, но необязательно, к усеченной части полноразмерного ActRIIB. Нуклеиновые кислоты, описанные в настоящей заявке, могут быть функционально присоединены к промотору, регулирующему экспрессию, и настоящее изобретение также относится к клеткам, трансформированным такими рекомбинантными полинуклеотидами. Предпочтительными клетками являются клетки млекопитающих, такие как клетки СНО.
В некоторых своих аспектах настоящее изобретение относится к способам получения растворимого полипептида ActRIIB. Этот способ может включать экспрессию любой из нуклеиновых кислот (например, SEQ ID NO:3), описанных в настоящей заявке, в подходящей клетке, такой как клетки яичника китайского хомячка (СНО). Указанный способ может включать а) культивирование клеток в условиях, подходящих для экспрессии растворимого полипептида ActRIIB, где указанные клетки трансформируются конструкцией для экспрессии растворимого ActRIIB; и b) выделение экспрессируемого таким образом растворимого полипептида ActRIIB. Растворимые полипептиды ActRIIB могут быть выделены в виде неочищенных, частично очищенных или в высокой степени очищенных фракций с применением хорошо известных методов получения белка из клеточных культур.
В некоторых аспектах изобретения описанный здесь растворимый полипептид ActRIIB может быть использован в способе лечения индивидуума, страдающего расстройством, ассоциированным с потерей мышечной массы или с недостаточным ростом мышечной массы. Такими расстройствами являются атрофия мышц, мышечная дистрофия, амиотрофический боковой склероз (АБС) и гипотрофия мышц (например, кахексия, анорексия, синдром мышечной дистрофии Дюшенна (МДД), синдром мышечной дистрофии Беккера, истощение при СПИДе, мышечная дистрофия, нейромышечные заболевания, заболевание двигательных нейронов, заболевания нервно-мышечных соединений и воспалительные миопатии). Такой способ может включать введение индивидууму, нуждающемуся в этом, эффективного количества растворимого полипептида ActRIIB.
В некоторых аспектах изобретения описанный здесь растворимый полипептид ActRIIB может быть
использован в способе снижения содержания жира в организме или снижения скорости увеличения содержания жира в организме, а также для лечения расстройства, ассоциированного с нежелательным увеличением массы тела, такого как ожирение, инсулиннезависимый сахарный диабет (ИНЗСД), сердечнососудистое заболевание, рак, гипертензия, остеоартрит, инсульт, заболевания дыхательных путей и заболевание желчного пузыря. Такие способы могут включать введение индивидууму, нуждающемуся в этом, эффективного количества растворимого полипептида ActRIIB.
В некоторых конкретных аспектах изобретения описанный здесь растворимый полипептид ActRIIB может быть использован в способе лечения расстройства, ассоциированного с аномальной активностью GDF8. Такими расстройствами являются метаболические расстройства, такие как диабет типа 2, непереносимость глюкозы, метаболический синдром (например, синдром X) и инсулинорезистентность, вызываемая травмами (например, ожогами или нарушением баланса азота); расстройства, ассоциированные с отложением жира в ткани (например, ожирение), мышечная дистрофия (включая мышечную дистрофию Дюшенна); амиотрофический боковой склероз (АБС); атрофия мышц; атрофия органов; общее недомогание; синдром канала запястья, хроническая обструктивная болезнь легких, саркопения, кахексия и другие синдромы гипотрофии мышц; остеопороз; остеопороз, индуцированный глюкокортикоидами; остео-пения; остеоартрит; переломы, ассоциированные с остеопорозом; разрежение кости, вызываемое длительной терапией глюкокортикоидами; преждевременное угасание половой функции; подавление функции андрогенов; дефицит витамина D; вторичный гиперпаратиреоидит; дефицит питательных веществ и нервная анорексия. Такой способ может включать введение индивидууму, нуждающемуся в этом, эффективного количества растворимого полипептида ActRIIB.
В некоторых своих аспектах настоящее изобретение относится к способу идентификации агента, стимулирующего рост ткани, такой как костная, хрящевая, мышечная и жировая ткань. Указанный способ включает а) идентификацию тестируемого агента, который конкурирует с растворимым полипептидом ActRIIB за связывание с лигандсвязывающим доменом полипептида ActRIIB; и b) оценку влияния данного агента на рост массы ткани.
В некоторых своих аспектах настоящее изобретение относится к способам подавления активности полипептида ActRIIB или лиганда ActRIIB (например, GDF8, GDF11, активина, ВМР7 и Nodal) в клетке. Эти способы включают контактирование клеток с растворимым полипептидом ActRIIB. Мониторинг активности полипептида или лиганда ActRIIB проводят, но необязательно, путем оценки передачи сигнала, опосредуемой комплексом ActRIIB/лиганд ActRIIB, например путем оценки пролиферации клеток. Клетками, используемыми в данных способах, являются остеобласты, хондроциты, миоциты, адипоциты и мышечные клетки.
В некоторых своих аспектах настоящее изобретение относится к применению растворимого полипептида ActRIIB для производства лекарственного препарата для лечения описанного здесь расстройства или состояния.
Краткое описание графического материала
На фиг. 1 представлена последовательность человеческого растворимого полипептида ActRIIB (внеклеточного) (SEQ ID NO:1). С-концевой "хвост" подчеркнут.
На фиг. 2 представлена последовательность человеческого белка-предшественника ActRIIB (SEQ ID NO:2). Сигнальный пептид подчеркнут; внеклеточный домен (также называемый SEQ ID NO:1) показан жирным шрифтом, а предполагаемые сайты N-связанного гликозилирования показаны в рамке.
На фиг. 3 представлена последовательность нуклеиновой кислоты, кодирующая человеческий растворимый полипептид ActRIIB (внеклеточный), представленный как SEQ ID NO:3.
На фиг. 4 представлена последовательность нуклеиновой кислоты, кодирующая человеческий белок-предшественник ActRIIB, представленный как SEQ ID NO:4.
На фиг. 5 проиллюстрировано увеличение массы тела у мышей, обработанных носителем (ромбы), полипептидом ActRIIB(R64 20-134)-mFc (квадраты) или его формой с длительным временем полужизни,
ActRIIB(R64 A24N 20-134) (треугольники).
На фиг. 6 представлены массы мышц, иссеченных в конце исследования. Носитель: левый столбец (слабое затенение) для каждой группы; ActRIIB(R64 20-134)-mFc: средний столбец (умеренное затенение) для каждой группы; ActRIIB(R64 A24N 20-134): правый столбец (сильное затенение) для каждой группы.
На фиг. 7 проиллюстрировано измерение силы спазмов у мышей SOD, обработанных PBS и мышиным ActRIIB (R64 Ю4А 20-134)-mFc (или хвост "K74А+15") (белые и черные столбцы соответственно). На этой фигуре проиллюстрировано увеличение мышечной силы у мышей ActRIIB (R64 Ю4А 20-134)-mFc-группы по сравнению с мышами PBS-группы на ранней стадии (на день 117) и на поздней стадии (на день 149) развития заболевания. *Р <0,05, двухсторонний т-критерий Стьюдента.
На фиг. 8 проиллюстрировано сравнение выживаемости мышей SOD, обработанных PBS и ActRIIB
(R64 Ю4А 20-134)-mFc (белые и черные линии соответственно) в соответствии с критерием Каплана-
Мейера. У ActRIIB (R64 20-134)-mFc-обработанной группы по сравнению с PBS-обработанной
группой выживаемость была в среднем на несколько дней выше.
На фиг. 9 проиллюстрировано процентное изменение состава веществ в организме у мышей, кото
рым давали корм с высоким содержанием жира, включающий PBS и ActRIIB (R64 20-134)-mFc (белые и черные столбцы соответственно). Обработка мышей мышиным белком ActRIIB(R64 20-134)-Fc приводит к значительному снижению массы жира и увеличению безжировой ткани.
На фиг. 10 показано поперечное сечение мышц бедра (с 4-кратным увеличением) у старых мышей (А) или у старых мышей, обработанных белком ActRIIB(R64 20-134)-mFc (В).
На фиг. 11 представлены средние массы тела мышей в эксперименте на мышах с раковой кахексией, проводимом с использованием клеток рака толстой кишки СТ26. Ромбы: животные, не имеющие опухолей и обработанные физиологическим раствором; квадраты: ActRIIB(R64 20-134)-mFc-обработанные мыши, не имеющие опухолей; треугольники: мыши с опухолями, обработанные физиологическим раствором; "х": ActRIIB(R64 20-134)-mFc-обработанные мыши с опухолями (10 мг/кг); "*": ActRIIB(R64 20-134)-mFc-обработанные мыши с опухолями (30 мг/кг); кружки: ActRIIB(R64 20-134)-mFc-обработанные мыши с опухолями, (10 мг/кг), для проведения профилактического лечения обработку начинали во время имплантации опухоли.
На фиг. 12 проиллюстрировано сопоставление путем выравнивания остатков человеческих ActRIIA и ActRIIB с остатками, выведенными здесь исходя из анализа состава множества кристаллических структур ActRIIB и ActRIIA, и непосредственно контактирующих с лигандом (лигандсвязывающего кармана), показанных в рамках.
На фиг. 13 проиллюстрировано сопоставление путем выравнивания множества последовательностей различных белков ActRIIB позвоночных и человеческого ActRIIA.
Подробное описание изобретения
1. Общий обзор.
В некоторых своих аспектах настоящее изобретение относится к полипептидам ActRIIB. Используемый здесь термин "ActRIIB" означает семейство белков-рецепторов активина типа IIB (ActRIIB) и ActRIIB-родственных белков, происходящих от любых видов. Членами семейства ActRIIB в основном являются все трансмембранные белки, состоящие из лигандсвязывающего внеклеточного домена с богатой цистеином областью, трансмембранного домена и цитоплазматического домена с предсказанной се-рин/треонин-киназной специфичностью.
Аминокислотные последовательности белка-предшественника человеческого ActRIIA (показаны для сравнения) и белка-предшественника ActRIIB проиллюстрированы на фиг. 1 (SEQ ID NO:1) и фиг. 2 (SEQ ID NO:2) соответственно.
Используемый здесь термин "полипептид ActRIIB" означает полипептиды, содержащие любой природный полипептид, являющийся членом семейства ActRIIB, а также любые их варианты (включая мутанты, фрагменты, гибриды и пептидомиметики), которые сохраняют нужную активность. Так, например, полипептидами ActRIIB являются полипептиды, происходящие от последовательности любого известного ActRIIB и имеющие последовательность, которая по меньшей мере примерно на 80%, а предпочтительно по меньшей мере на 85, 90, 95, 97, 99% или более идентична последовательности полипептида ActRIIB.
В своем конкретном варианте настоящее изобретение относится к растворимым полипептидам Ac-tRIIB. Используемый здесь термин "растворимый полипептид ActRIIB", в общих чертах, означает полипептиды, содержащие внеклеточный домен белка ActRIIB. Используемый здесь термин "растворимый полипептид ActRIIB" включает любой природный внеклеточный домен белка ActRIIB, а также любые его варианты (включая мутанты, фрагменты и пептидомиметики), которые сохраняют нужную активность. Так, например, внеклеточный домен белка ActRIIB связывается с лигандом и, по существу, является растворимым. Примерами растворимых полипептидов ActRIIB являются растворимые полипептиды ActRIIB, проиллюстрированные на фиг. 1 (SEQ ED NO:1). Другие примеры растворимых полипептидов ActRIIB, помимо внеклеточного домена белка ActRIIB, содержат сигнальную последовательность, см. пример 1. Сигнальной последовательностью может быть нативная сигнальная последовательность Ac-tRIIB или сигнальная последовательность другого белка, такая как сигнальная последовательность тканевого активатора плазминогена (ТРА) или сигнальная последовательность мелатина пчелиного меда
(НВМ).
TGF-р-сигналы опосредуются гетеромерными комплексами серин/треонин-киназных рецепторов типа I и типа II, которые фосфорилируют и активируют расположенные ниже белки Smad после стимуляции лиганда (Massague, 2000, Nat. Rev. Mol. Cell Biol. 1:169-178). Все эти рецепторы типа I и типа II представляют собой трансмембранные белки, состоящие из лигандсвязывающего внеклеточного домена с богатой цистеином областью, трансмембранного домена и цитоплазматического домена с предсказанной специфичностью к серину/треонину. Рецепторы типа I играют важную роль в передаче сигнала, а рецепторы типа II необходимы для связывания с лигандами и для экспрессии рецепторов типа I. Рецепторы активина типа I и II после связывания с лигандом образуют стабильный комплекс, что приводит к фосфорилированию рецепторов типа I под действие рецепторов типа II.
Два родственных рецептора типа II, ActRIIA и ActRIIB, были идентифицированы как рецепторы ак-тивинов типа II (Mathews и Vale, 1991, Cell 65:973-982; Attisano et al., 1992, Cell 68: 97-108). Помимо ак-тивинов, ActRIIA и ActRIIB могут биохимически взаимодействовать с несколькими другими белками
семейства TGF-p, включая ВМР7, Nodal, GDF8 и GDF11 (Yamashita et al., 1995, J. Cell Biol. 130:217-226; Lee и McPherron 2001, Proc. Natl. Acad. Sci. 98:9306-9311; Yeo и Whitman, 2001, Mol. Cell 7: 949-957; Oh et al., 2002, Genes Dev. 16:2749-54). Заявителями было обнаружено, что растворимые слитые белки Ac-tRIIA-Fc и слитые белки ActRIIB-Fc оказывают в основном различное действие in vivo, причем ActRIIA-Fc влияет, главным образом, на кости, а ActRIIB-Fc влияет, главным образом, на скелетную мышцу.
В некоторых своих вариантах настоящее изобретение относится к подавлению функции лиганда для рецепторов ActRIIB (также называемого лигандом ActRIIB) под действием рассматриваемого полипептида ActRIIB (например, растворимого полипептида ActRIIB). Таким образом, композиции и способы согласно изобретению могут быть применены для лечения расстройств, ассоциированных с аномальной активностью одного или нескольких лигандов для рецепторов ActRIIB.
Репрезентативными лигандами для рецепторов ActRIIB являются некоторые члены семейства TGF-Р, такие как активин, Nodal, GDF8, GDF11 и ВМР7.
Активины представляют собой димерные полипептидные факторы роста и принадлежат к суперсемейству TGF-бета. Существует три активина (А, В и АВ), которые представляют собой го-мо/гетеродимеры, состоящие из двух близкородственных р-субъединиц (PApA, pBpB и pApB). В суперсемействе TGF-бета активины являются уникальными и многофункциональными факторами, которые могут стимулировать продуцирование гормонов в клетках яичника и плаценты, поддерживать выживаемость нервных клеток, положительно или отрицательно влиять на прохождение клеточного цикла в зависимости от типа клетки и индуцировать дифференцировку мезодермы, по меньшей мере, в эмбрионах амфибий (DePaolo et al., 1991, Proc SocEp Biol Med. 198:500-512; Dyson et al., 1997, Curr Biol. 7:81-84; Woodruff, 1998, Biochem Pharmacol. 55:953-963). Кроме того, было обнаружено, что эритроидный фактор дифференцировки (EDF), выделенный из стимулированных человеческих клеток моноцитарного лейкоза, идентичен активину A (Murata et al., 1988, PNAS, 85:2434). Было высказано предположение, что акти-вин А действует как природный регулятор эритропоэза в костном мозге. В некоторых тканях передача активинового сигнала подавляется под действием родственного ему гетеродимера, ингибина. Так, например, в процессе высвобождения фолликулостимулирующего гормона (FSH) из гипофиза активин стимулирует секрецию и синтез FSH, а ингибин способствует предупреждению секреции и синтеза FSH. Другими белками, которые могут регулировать биологическую активность активина и/или связываться с активином, являются фоллистатин (FS), белок, родственный фоллистатину (FSRP), а2-макроглобулин, белок Cerberus и эндоглин, описанные ниже.
Белки Nodal функционируют в мезодерме и участвуют в индуцировании и образовании эндодермы, а также в последующей организации аксиальных структур, например, на ранней стадии эмбриогенеза в сердце и в желудке. Было продемонстрировано, что дорсальная ткань на стадии развития эмбрионов позвоночных преимущественно участвует в образовании аксиальных структур спинной хорды и прехор-дальной пластины, но в то же время она участвует в рекрутинге окружающих клеток с образованием неаксиальных эмбрионных структур. Белок Nodal очевидно передает сигнал посредством рецепторов типа I и типа II и внутриклеточных эффекторов, известных как белки Smad. Недавно проведенные исследования лишь подтвердили идею о том, что ActRIIA и ActRIIB служат в качестве рецепторов типа II для Nodal (Sakuma et al., Genes Cells. 2002, 7:401-12). Было высказано предположение, что лиганды Nodal взаимодействуют со своими кофакторами (например, крипто-белок), что приводит к активации рецепторов активина типа I и типа II, которые фосфорилируют Smad2. Белки Nodal участвуют во многих событиях, играющих важную роль в развитии эмбриона позвоночного на ранней стадии, включая образование мезодермы, образование структуры передней пластины и формирование левой-правой оси. Экспериментальные исследования показали, что передача сигнала Nodal активирует pAR3-Lux, то есть репортерную молекулу люциферазы, которая, как сообщалось ранее, является специфической по отношению к акти-вину и TGF-бета. Однако Nodal не обладает способностью индуцировать pTlx2-Lux, то есть репортер, который является специфическим по отношению к белкам морфогенеза кости. Недавно полученные результаты биохимического анализа со всей очевидностью показали, что передача сигнала Nodal опосредуется путями активина-TGF-бета, Smads, Smad2 и Smad3. Последующие результаты показали, что внеклеточный крипто-белок необходим для передачи сигнала Nodal, а не активина или TGF-бета.
Фактор роста и дифференцировки-8 (GDF8) также известен как миостатин. GDF8 является негативным регулятором массы скелетной мышцы. GDF8 в высокой степени экспрессируется в скелетной мышце развивающегося организма и в скелетной мышце взрослого индивидуума. Нуль-мутация GDF8 у трансгенных мышей характеризуется заметной гипертрофией и гиперплазией скелетной мышцы (McPherron et al., Nature, 1997, 387:83-90). Аналогичное увеличение массы скелетной мышцы наблюдается в случае природных мутаций GDF8 у крупного рогатого скота (Ashmore et al., 1974, Growth, 38:501507; Swatland и Kieffer, J. Anim. ScL, 1994, 38:752-757; McPherron и Lee, Proc. Natl. Acad. Sci. USA, 1997, 94:12457-12461; и Kambadur et al., Genome Res., 1997, 7:910-915), и что удивительно, у человека (Schuel-ke et al., N Engl J Med 2004; 350:2682-8). Исследования также показали, что гипотрофия мышц, ассоциированная с ВИЧ-инфекцией у человека, сопровождается повышением уровня экспрессии белка GDF8 (Gonzalez-Cadavid et al., PNAS, 1998, 95:14938-43). Кроме того, GDF8 может модулировать продуцирова
ние мышцеспецифических ферментов (например, креатинкиназы) и пролиферацию миобластов (WO 00/43781). Пропептид GDF8 может нековалентно связываться со зрелым димером домена GDF8, что приводит к инактивации его биологической активности (Miyazono et al. (1988) J. Biol. Chem., 263: 64076415; Wakefield et al. (1988) J. Biol. Chem., 263; 7646-7654 и Brown et al. (1990) Growth Factors, 3: 35-43). Другими белками, которые связываются с GDF8 или со структурно родственными белками и ингибиру-ют их биологическую активность, являются фоллистатин, а возможно и белки, родственные фоллистати-ну (Gamer et al. (1999) Dev. Biol., 208:222-232).
Фактор роста и дифференцировки-11 (GDF11), также известный как ВМР11, представляет собой секретируемый белок (McPherron et al., 1999, Nat. Genet. 22:260-264). GDF11 экспрессируется в хвостовой почке, в почке конечностей, в верхнечелюстной и в челюстной дуге и в спинно-мозговых узлах в процессе развития организма у мышей (Nakashima et al., 1999, Mech. Dev. 80:185-189). GDF11 играет уникальную роль в образовании структуры тканей мезодермы и нервных тканей (Gamer et al., 1999, Dev Biol., 208:222-32). Было показано, что GDF11 является негативным регулятором хондрогенеза и миогене-за на стадии развития конечностей кур (Gamer et al., 2001, Dev Biol. 229:407-20). Экспрессия GDF11 в мышце также указывает на то, что GDF11, также как и GDF8, играет определенную роль в регуляции роста мышц. Кроме того, экспрессия GDF11 в головном мозге указывает на то, что GDF11 может также обладать активностями, ассоциированными с функцией нервной системы. Интересно отметить, что GDF11, как было обнаружено, ингибирует нейрогенез обонятельного эпителия (Wu et al., 2003, Neuron. 37:197-207). Следовательно, GDF11 может быть использован in vitro и in vivo для лечения таких заболеваний, как заболевания мышц и нейродегенеративные заболевания (например, амиотрофический боковой склероз).
Хорошо известно, что белок морфогенеза кости (ВМР7), также называемый остеогенным белком-1 (ОР-1), индуцирует образование хряща и костей. Кроме того, ВМР7 регулирует широкий ряд физиологических процессов. Так, например, ВМР7 может представлять собой остеоиндуцирующий фактор, ответственный за остеогенез эпителия. Было также обнаружено, что ВМР7 играет определенную роль в регуляции уровня кальция и в гомеостазе кости. ВМР7 подобно активину связывается с рецепторами типа II, ActRIIA и IIB. Однако ВМР7 и активин осуществляют рекрутинг различных рецепторов типа I с образованием гетеромерных рецепторных комплексов. Как показали наблюдения, основной рецептор ВМР7 типа I, представляет собой ALK2, а активин связывается исключительно с ALK4 (ActRIIB). BMP7 и ак-тивин вырабатывают определенные биологические ответы и активируют различные пути Smad (Macias-Silva et al., 1998, J Biol Chem. 273:25628-36).
В некоторых своих аспектах настоящее изобретение относится к использованию некоторых полипептидов ActRIIB (например, растворимых полипептидов ActRIIB) для подавления сигнала, передаваемого лигандами ActRIIB, по существу, в любом процессе, ассоциированном с активностью ActRIIB. Полипептиды ActRIIB согласно изобретению могут, но необязательно, подавлять активность одного или нескольких лигандов рецепторов ActRIIB, таких как активин, Nodal, GDF8, GDF11 и ВМР7, а поэтому они могут быть использованы для лечения других расстройств.
Поэтому в настоящем изобретении рассматривается использование полипептидов ActRIIB для лечения или предупреждения заболеваний или состояний, ассоциированных с аномальной активностью ActRIIB или лиганда ActRIIB. ActRIIB или лиганды ActRIIB участвуют в регуляции многих важных биологических процессов. Благодаря ключевым функциям, которые они играют в этих процессах, они могут быть желательными мишенями для терапевтического лечения. Так, например, полипептиды ActRIIB (например, растворимые полипептиды ActRIIB) могут быть использованы для лечения расстройств или состояний у человека или животного. Примерами таких расстройств или состояний являются, но не ограничиваются ими, метаболические расстройства, такие как диабет типа 2, непереносимость глюкозы, метаболический синдром (например, синдром X), и инсулинорезистентность, вызываемая травмами (например, ожогами или нарушением баланса азота); расстройства, ассоциированные с отложением жира в ткани (например, ожирение), мышечные и нейромышечные заболевания, такие как мышечная дистрофия (включая мышечную дистрофию Дюшенна); амиотрофический боковой склероз (АБС); атрофия мышц; атрофия органов; общее недомогание; синдром канала запястья, хроническая обструктивная болезнь легких, саркопения, кахексия и другие синдромы гипотрофии мышц. Другими примерами является остеопо-роз, в частности, у пожилых женщин и/или у женщин после менопаузы; остеопороз, индуцированный глюкокортикоидами; остеопения; остеоартрит и переломы, ассоциированные с остеопорозом. Другими примерами являются разрежение кости, вызываемое длительной терапией глюкокортикоидами; преждевременное угасание половой функции; подавление функции андрогенов; дефицит витамина D; вторичный гиперпаратиреоидит; дефицит питательных веществ и нервная анорексия. Такие расстройства и состояния обсуждаются ниже в разделе "Репрезентативное терапевтическое применение".
Термины, используемые в описании настоящей заявки, обычно употребляются в своем общепринятом смысле в соответствии с контекстом настоящего изобретения и в соответствии с контекстом, в котором употребляется каждый из этих терминов. Для представления специалисту дополнительной информации о композициях и способах согласно изобретению и информации об осуществлении и применении таких способов, некоторые термины обсуждаются ниже или в каком-либо разделе описания настоящей
заявки. Объем употребления или значение любого используемого здесь термина будут очевидны специалистам из конкретного контекста, в котором используется данный термин.
Термины "примерно" и "приблизительно", в общих чертах, означают допустимую степень ошибки при определении количественной величины, вычисленной с учетом способа или точности измерений. Обычно допустимые степени ошибок составляют в пределах 20, предпочтительно 10, а более предпочтительно 5% от данной величины или интервала величин.
Альтернативно, в частности, в биологических системах термины "примерно" и "приблизительно" могут означать величины, которые входят в пределы величин, предпочтительно порядка величин, которые в 5 раз, а более предпочтительно в 2 раза превышают данную величину. Если это не оговорено особо, то представленные здесь численные значения являются приблизительными, а это означает, что, если эти значения не указаны точно, то могут быть использованы термины "примерно" или "приблизительно".
Способы согласно изобретению могут включать стадии сравнения последовательностей друг с другом, включая сравнение последовательности дикого типа с последовательностями одного или нескольких мутантов (вариантов последовательностей). Такие сравнения обычно включают выравнивание полимерных последовательностей, например, с использованием программ и/или алгоритмов выравнивания последовательностей, хорошо известных специалистам (например, BLAST, FASTA и MEGALIGN и т. п.). Специалисту в данной области хорошо известно, что при осуществлении таких выравниваний, в том случае, если мутация представляет собой инсерцию или делецию остатка, в сравниваемую полимерную последовательность, не содержащую введенного или делетированного остатка, будет вводиться "пробел" (обычно обозначаемый штрихом или "А").
Термин "гомологичный" во всех его грамматических формах и орфографических вариантах относится к взаимосвязи между двумя белками, которые имеют "общее эволюционное происхождение", включая белки, происходящие от суперсемейств белков организмов одного и того же вида, а также гомологичные белки, происходящие от организмов других видов. Такие белки (и кодирующие их нуклеиновые кислоты) имеют гомологичные последовательности, на что указывает их сходство, независимо от процента идентичности, или присутствия конкретных остатков или мотивов и наличия консервативных положений.
Термин "сходство последовательностей" во всех его грамматических формах означает степень идентичности или соответствия между последовательностями нуклеиновых кислот или между аминокислотными последовательностями, которые могут иметь, а могут и не иметь общее эволюционное происхождение.
Однако термин "гомологичный", употребляемый в своем общепринятом смысле и в контексте описания настоящей заявки, в том случае, если он употребляется вместе с наречием "в высокой степени", может относиться к сходству последовательностей, которые могут иметь, а могут и не иметь общее эволюционное происхождение.
2. Полипептиды ActRIIB.
В некоторых своих аспектах настоящее изобретение относится к вариантам полипептидов ActRIIB (например, к растворимым полипептидам ActRIIB). Их фрагменты, функциональные варианты и модифицированные формы могут, но необязательно, обладать биологическими активностями, которые сходны с биологическими активностями их соответствующих полипептидов ActRIIB дикого типа, или являются такими же, как биологические активности данных полипептидов дикого типа. Так, например, вариант ActRIIB согласно изобретению может связываться с лигандом ActRIIB (например, с активином А, активином АВ, активином В, Nodal, GDF8, GDF11 или ВМР7) и ингибировать функцию этого лиганда. Полипептид ActRIIB модулирует, но необязательно, рост тканей, таких как ткани костей, хряща, мышц или жировых тканей. Примерами полипептидов ActRIIB являются человеческий полипептид-предшественник ActRIIB (SEQ ID NO:2) и растворимые человеческие полипептиды ActRIIB (например, SEQ ID №№ 1, 5, 6 и 12).
В настоящем изобретении идентифицированы функционально активные части и варианты ActRIIB. Заявителями было установлено, что Fc-слитый белок, имеющий последовательность, описанную в публикации Hilden et al. (Blood. 1994 Apr 15; 83(8):2163-70), где аланин присутствует в положении, соответствующем аминокислоте 64 SEQ ID NO:2 (А64), обладает относительно низкой аффинностью по отношению к активину и GDF-11. В противоположность этому тот же самый Fc-слитый белок с аргинином в положении 64 (R64) обладает аффинностью по отношению к активину и GDF-11 в интервалах от низких наномолярных значений до высоких пикомолярных значений. Поэтому в описании настоящей заявки последовательность с R64 используется как эталонная последовательность человеческого ActRIIB дикого типа.
Attisano и др. (Cell. 1992 Jan 10; 68 (1) :97-108) показали, что делеция пролинового "узла" у С-конца внеклеточного домена ActRIIB приводит к снижению аффинности рецептора по отношению к активину. Представленные здесь данные показали, что слитый белок ActRIIB-Fc, содержащий аминокислоты 20119 SEQ ID NO:2, "ActRIIB(20-119)-Fc", обладает пониженной способностью связываться с GDF-11 и с активином по сравнению с ActRIIB(20-134)-Fc, который включает область пролинового "узла" и полноразмерный пограничный мембранный домен. Однако белок ActRIIB(20-129)-Fc сохраняет аналогичную,
но несколько меньшую активность по сравнению с активностью белка дикого типа, даже если область пролинового "узла" отсутствует в результате дизрупции. Таким образом, предполагается, что все внеклеточные домены ActRIIB, которые заканчиваются в положениях аминокислот 134, 133, 132, 131, 130 и 129, являются активными, однако конструкции, заканчивающиеся в положении 134 или 133, могут быть наиболее активными. Аналогичным образом, предполагается, что мутации в любом из остатков 129-134 не будут оказывать влияние на аффинность связывания с лигандом в крупных концевых областях. В подтверждение этому следует отметить, что мутации Р129 и Р130 не приводят к значительному снижению уровня связывания с лигандом. Поэтому слитый белок ActRIIB-Fc может заканчиваться уже в положении аминокислоты 109 (конечный цистеин), однако при этом предполагается, что формы полипептидов, заканчивающиеся в положениях 109 и 119 или между этими положениями, обладают пониженной способностью связываться с лигандом. Аминокислота 119 является слабоконсервативной, а поэтому она может быть легко модифицирована или удалена. Формы, заканчивающиеся в положении 128 или далее, сохраняют активность связывания с лигандом. Формы, заканчивающиеся в положениях 119 и 127 или между этими положениями, обладают умеренной способностью к связыванию. Любая из этих форм может оказаться желательной для применения в зависимости от клинических или экспериментальных условий.
Предполагается, что у N-конца ActRIIB белок, начинающийся в положении аминокислоты 29 или ранее, будет сохранять активность связывания с лигандом. Аминокислотой 29 является исходный цисте-ин. Замена аланина на аспарагин, вводимая в положение 24 последовательности N-связанного гликози-лирования, не оказывает какого-либо значительного влияния на связывание с лигандом. Это подтверждает тот факт, что мутации в области, расположенной между сигнальным отщепляемым пептидом и перекрестно-связанной цистеиновой областью, соответствующей аминокислотам 20-29, являются в достаточной степени толерантными. В частности, конструкции, начинающиеся в положениях 20, 21, 22, 23 и 24, сохраняют свою активность, а также предполагается, что такую активность также сохраняют конструкции, начинающиеся в положениях 25, 26, 27, 28 и 29. Данные, представленные в примерах, указывают на то, что, как было неожиданно обнаружено, конструкция, начинающаяся в положениях 22, 23, 24 или 25, обладает наибольшей активностью.
В целом, активная часть ActRIIB содержит аминокислоты 29-109 SEQ ID NO:2, и конструкции могут, например, начинаться в положении остатка, соответствующего аминокислотам 20-29, и заканчиваться в положении, соответствующем аминокислотам 109-134. Другими примерами могут служить конструкции, которые начинаются в положениях 20-29 или 21-29 и заканчиваются в положениях 119-134, 119133 или 129-134, 129-133. Другими примерами являются конструкции, которые начинаются в положениях 20-24 (или 21-24, или 22-25) и заканчиваются в положениях 109-134 (или 109-133), 119-134 (или 119133) или 129-134 (или 129-133). Также рассматриваются варианты с этими интервалами, в частности варианты, которые по меньшей мере на 80, 85, 90, 95 или 99% идентичны соответствующей части SEQ ID
NO:4.
Настоящее изобретение включает результаты анализа состава структур ActRIIB, представленные на фиг. 22, где указанные результаты указывают на то, что лигандсвязывающий карман определяется остатками Y31, N33, N35, L38-T41, Е47, Е50, Q53-K55, L57, Н58, Y60, S62, K74, W78-N83, Y85, R87, А92 и E94-F101. Предполагается, что в этих положениях консервативные мутации являются толерантными, хотя мутация Ю4А также является достаточно толерантной, как и мутации R40A, ^5А, F82A и мутации в положении L79. У Xenopus R40 представляет собой K, что указывает на то, что основные аминокислоты в этом положении являются толерантными. В ActRIIB коров Q53 представляет собой R, а в ActRIIB Xenopus Q53 представляет собой K, а поэтому аминокислоты, включая R, K, Q, N и Н, являются толерантными в этом положении. Таким образом, активный вариант белка ActRIIB имеет общую структурную формулу, которая содержит аминокислоты 29-109, но необязательно, начинается в положениях 2024 или 22-25 и заканчивается в положениях 129-134, и которая также содержит не более чем 1, 2, 5, 10 или 15 консервативных аминокислотных замен в лигандсвязывающем кармане, и 0, 1 или более неконсервативных модификаций в положениях 40, 53, 55, 74, 79 и/или 82 в лигандсвязывающем кармане. Такой белок может сохранять последовательность, которая более чем на 80, 90, 95 или 99% идентична последовательности аминокислот 29-109 SEQ ID NO:4. Сайты, находящиеся за пределами связывающего кармана, вариабельность которых может быть, в частности, достаточно толерантной, включают амино- и карбоксиконцы внеклеточного домена (указанного выше) и положения 42-46 и 65-73. Замена аспарагина аланином в положении 65 (N65A) фактически может приводить к повышению уровня связывания с ли-гандом в эталонном А64, и, таким образом, предполагается, что такая замена не будет оказывать негативного влияния на уровень связывания с лигандом в эталонном R64. Такая замена, вероятно, будет приводить к элиминации сайта гликозилирования в положении N65 в эталонном А64, что указывает на то, что значительные изменения, сделанные в этой области, являются, очевидно, толерантными. Замена R64 является слабо толерантной, R64K является достаточно толерантной, и, таким образом, другой основный остаток, такой как Н, может быть толерантным в положении 64.
ActRIIB является в высокой степени консервативным почти у всех позвоночных, при этом крупные фрагменты внеклеточного домена такого белка являются полностью консервативными. Многие из этих лигандов, которые связываются с ActRIIB, также являются в высокой степени консервативными. В соот
ветствии с этим сравнение последовательностей ActRIIB различных позвоночных позволяет идентифицировать остатки, которые могут быть модифицированными. Следовательно, активный человеческий вариант ActRIIB может включать одну или несколько аминокислот в соответствующих положениях последовательности ActRIIB другого позвоночного, либо он может включать остаток, аналогичный остатку, присутствующему в последовательности человека или другого позвоночного. Такой способ определения активного варианта ActRIIB проиллюстрирован в нижеследующих примерах. В ActRIIB Xenopus L46 представляет собой валин, и в этом положении такой остаток может быть модифицирован, и он может быть заменен, но необязательно, другим гидрофобным остатком, таким как V, I или F, или неполярным остатком, таким как А. У Xenopus E52 представляет собой K, что указывает на то, что этот сайт может быть толерантным к модификациям широкого ряда, включая замены полярными остатками, такими как Е, D, K, R, Н, S, T, P, G, Y, и вероятно, А. У Xenopus T93 представляет собой K, что указывает на то, что в этом положении широкие структурные изменения могут оставаться толерантными, при этом предпочтение следует отдать полярным остаткам, таким как S, K, R, E, D, H, G, P, G и Y. У Xenopus F108 представляет собой Y, а поэтому Y или другая гидрофобная группа, такая как I, V или L, должны быть толерантными. У Xenopus E111 представляет собой K, что указывает на то, что в этом положении заряженные остатки, включая D, R, K и Н, а также Q и N, могут быть толерантными. У Xenopus R112 представляет собой K, что указывает на то, что в этом положении, включая R и Н, основные остатки являются толерантными. В положении 119 остаток А и, очевидно, Р у грызунов и V у Xenopus являются относительно слабоконсервативными, а поэтому, по существу, любая аминокислота в этом положении должна быть толерантной.
В описании настоящей заявки продемонстрировано, что присоединение дополнительного сайта N-связанного гликозилирования (N-X-S/T) приводит к увеличению времени полужизни слитого белка Ac-tRIIB-Fc в сыворотке по сравнению со временем полужизни ActRIIB(R64)-Fc-формы. При введении ас-парагина в положение 24 (А24^конструкции) образуется последовательность NXT, которая сообщает более длительное время полужизни. Другие последовательности NX(T/S) присутствуют в положениях 42-44 (NQS) и 65-67 (NSS), хотя последняя последовательность не может быть эффективно гликозилиро-вана остатком R в положении 64. Последовательности N-X-S/T могут быть в основном введены в положениях, находящихся за пределами лигандсвязывающего кармана, определенного на фиг. 12. Особенно подходящими сайтами для введения неэндогенных последовательностей N-X-S/T являются аминокислоты 20-29, 20-24, 22-25, 109-134, 120-134 или 129-134. Последовательности N-X-S/T могут быть также введены в линкер между последовательностью ActRIEB и Fc или другим компонентом гибрида. Такой сайт может быть легко встроен путем введения N в "правильное" положение по отношению к уже существующему S или Т или путем введения S или Т в положение, соответствующее уже существующему N. Таким образом, желательными модификациями, которые могут приводить к образованию сайта N-связанного гликозилирования, являются A24N, R64N, S67N (возможно объединенные с модификациями N65A), E106N, R112N, G120N, E123N, P129N, A132N, R112S и R112T. Благодаря защите, сообщаемой гликозилированием, любой S, который, как было предсказано, является гликозилированным, может быть заменен на Т без создания иммуногенного сайта. Аналогичным образом, любой Т, который, как было предсказано, является гликозилированным, может быть заменен на S. Рассматриваются также модификации S67T и S44T. Аналогичным образом, в вариант A24N может быть введена модификация S26T. В соответствии с этим вариант ActRIIB может включать одну или несколько дополнительных неэндогенных консенсусных последовательностей N-связанного гликозилирования.
Положение L79 может быть модифицировано в целях изменения связывающих свойств активина-миостатина (GDF-11). L79A или L79P снижают уровень связывания GDF-11 в гораздо большей степени, чем уровень связывания активина. L79E или L79D сохраняют способность связываться с GDF-11. Интересно отметить, что варианты L79E и L79D обладают значительно меньшей способностью связываться с активином. In vivo эксперименты показали, что такие неактивиновые рецепторы в значительной степени сохраняют способность увеличивать мышечную массу, но обладают значительно меньшим действием на другие ткани. Полученные данные продемонстрировали необходимость и целесообразность получения полипептидов, обладающих более слабым действием на активин.
Описанные модификации могут быть объединены различными методами. Кроме того, описанные здесь результаты применения программы мутагенеза показали, что в ActRIIB имеются положения аминокислот, которые часто и предпочтительно являются консервативными. Такими положениями являются положение 64 (основная аминокислота), положение 80 (кислотная или гидрофобная аминокислота), положение 78 (гидрофобная аминокислота, в частности, триптофан), положение 37 (кислотная аминокислота, в частности, аспарагиновая или глутаминовая аминокислота), положение 56 (основная аминокислота), положение 60 (гидрофобная аминокислота, в частности, фенилаланин или тирозин). Таким образом, в каждом из описанных здесь вариантов настоящее изобретение относится к каркасной области аминокислот, которые могут быть консервативными. Другими положениями, которые могут быть, что предпочтительно, консервативными, являются следующие положения: положение 52 (кислотная аминокислота), положение 55 (основная аминокислота), положение 81 (кислотная аминокислота), положение 98 (полярная или заряженная аминокислота, в частности, Е, D, R или K).
В некоторых вариантах изобретения выделенные фрагменты полипептидов ActRIIB могут быть получены путем скрининга полипептидов, рекомбинантно продуцированных из соответствующего фрагмента нуклеиновой кислоты, кодирующей полипептид ActRIIB (например, SEQ ID №№ 3 и 4). Кроме того, фрагменты могут быть химически синтезированы методами, известными специалистам, такими как стандартный метод химического твердофазного синтеза Меррифилда с использованием f-Moc или t-Boc. Такие фрагменты могут быть получены (рекомбинантными методами или методами химического синтеза) и протестированы для идентификации тех пептидильных фрагментов, которые могут действовать, например, как антагонисты (ингибиторы) или агонисты (активаторы) белка ActRIIB или лиганда
ActRIIB.
В некоторых вариантах изобретения функциональный вариант полипептида ActRIIB имеет аминокислотную последовательность, которая по меньшей мере на 75% идентична аминокислотной последовательности, выбранной из SEQ ID NO: 3, 4 и 10. В некоторых случаях функциональный вариант имеет аминокислотную последовательность, которая по меньшей мере на 80, 85, 90, 95, 97, 98, 99 или 100% идентична аминокислотной последовательности, выбранной из SEQ ID NO: 3, 4 и 10.
В некоторых вариантах изобретения рассматривается получение функциональных вариантов путем модификации структуры полипептида ActRIIB для таких целей, как повышение терапевтической эффективности или стабильности (например, срока хранения ex vivo и резистентности к протеолитическому расщеплению in vivo). Модифицированные полипептиды ActRIIB могут быть также получены, например, путем замены, делеции или добавления аминокислот. Так, например, имеются основания предположить, что отдельная замена лейцина на изолейцин или валин, аспартата на глутамат, треонина на серин или аналогичная замена аминокислоты структурно родственной аминокислотой (например, консервативные мутации) не будет оказывать значительного влияния на биологическую активность полученной молекулы. Консервативными заменами являются замены, осуществляемые в пределах семейства аминокислот, которые являются родственными по их боковым цепям. Для того чтобы определить, может ли замена в аминокислотной последовательности полипептида ActRIIB приводить к образованию функционального гомолога, вариант полипептида ActRIIB может быть легко оценен на его способность вырабатывать клеточный ответ методом, аналогичным методу определения такой способности полипептида ActRIIB дикого типа, либо он может быть оценен на его способность связываться с одним или несколькими ли-гандами, такими как активин, GDF-11 или миостатин, методом, аналогичным методу определения такой способности полипептида дикого типа.
В некоторых конкретных вариантах изобретения рассматривается введение мутаций во внеклеточный домен (также называемый лигандсвязывающим доменом) полипептида ActRIIB так, чтобы такой вариант (или мутант) полипептида ActRIIB обладал измененной активностью связывания с лигандом (например, аффинностью связывания или специфичностью связывания). В некоторых случаях такие варианты полипептидов ActRIIB обладают измененной (повышенной или пониженной) аффинностью связывания с конкретным лигандом. В других случаях варианты полипептидов ActRIIB обладают измененной специфичностью связывания с их лигандами.
Так, например, настоящее изобретение относится к вариантам полипептидов ActRIIB, которые преимущественно связываются с GDF8/GDF11, а не с активинами. В настоящем изобретении преимущественными также являются такие полипептиды, которые обеспечивают уменьшение побочных эффектов, хотя такие селективные варианты могут оказаться менее желательными для лечения тяжелых заболеваний, при которых для достижения терапевтического эффекта может оказаться необходимым очень высокий прирост мышечной массы, и где некоторый определенный уровень побочных эффектов является допустимым. Так, например, аминокислотные остатки белка ActRIIB, такие как Е39, K55, Y60, K74, W78, D80 и F101, присутствуют в лигандсвязывающем кармане и опосредуют связывание с его лигандами, такими как активин и GDF8. Таким образом, настоящее изобретение относится к модифицированному лигандсвязывающему домену (например, GDF8-связывающему домену) рецептора ActRIIB, который содержит одну или несколько мутаций в этих аминокислотных остатках. Модифицированный лиганд-связывающий домен по сравнению с лигандсвязывающим доменом рецептора ActRIIB дикого типа может, но необязательно, обладать повышенной селективностью к лиганду, такому как GDF8. Для иллюстрации можно сказать, что эти мутации повышают селективность модифицированного лиганд-связывающего домена по отношению к GDF8, а не к активину. Модифицированный лиганд-связывающий домен имеет, но необязательно, отношение Kd для связывания с активином к KJ для связывания с GDF8, которое по меньшей мере в 2, 5, 10 или даже в 100 раз превышает отношение для лиганд-связывающего домена дикого типа. Модифицированный лигандсвязывающий домен имеет, но необязательно, отношение IC50 для ингибирования активина к IC50 для ингибирования GDF8, которое по меньшей мере в 2, 5, 10 или даже в 100 раз превышает отношение для лигандсвязывающего домена дикого типа. Такой модифицированный лигандсвязывающий домен ингибирует GDF8, но необязательно, с ин-гибирующей концентрацией IC50, которая по меньшей мере в 2, 5, 10 или даже в 100 раз ниже ингиби-рующей концентрации IC50 для ингибирования активина.
В конкретном примере положительно заряженный аминокислотный остаток Asp (D80) лиганд-связывающего домена ActRIIB может быть заменен другим аминокислотным остатком так, чтобы вари
ант полипептида ActRIIB предпочтительно связывался с GDF8, а не с активином. Предпочтительно остаток D80 заменяют аминокислотным остатком, выбранным из группы, состоящей из незаряженного аминокислотного остатка, отрицательно заряженного аминокислотного остатка и гидрофобного аминокислотного остатка. В другом конкретном примере для значительного снижения уровня связывания с акти-вином, но сохранения способности связываться с GDF11, гидрофобный остаток L79 может быть заменен кислотными аминокислотами, такими как аспарагиновая кислота или глутаминовая кислота. Для специалистов в данной области очевидно, что большинство описанных мутаций, вариантов или модификаций может быть сделано на уровне нуклеиновых кислот или в некоторых случаях с помощью посттрансляционной модификации или химического синтеза. Такие методы хорошо известны специалистам.
В некоторых вариантах изобретения рассматриваются специфические мутации, вводимые в полипептиды ActRIIB в целях изменения характера гликозилирования данного полипептида. Репрезентативные сайты гликозилирования в полипептидах ActRIIB проиллюстрированы на фиг. 2. Такие мутации могут быть выбраны для введения или элиминации одного или нескольких сайтов гликозилиролвания, таких как сайты О-связанного или N-связанного гликозилирования. Сайты распознавания аспарагин-связанного гликозилирования обычно содержат последовательность из трех пептидов, аспарагин-Х-треонин (где "X" представляет собой любую аминокислоту), которая специфически распознается соответствующими клеточными гликозилирующими ферментами. Такая модификация может быть также введена путем добавления одного или нескольких сериновых или треониновых остатков в последовательность полипептида ActRIIB дикого типа либо замены на эти остатки в данной последовательности (для сайтов O-связанного гликозилирования). Различные аминокислотные замены или делеции в первом или третьем положениях или в обоих этих положениях аминокислот распознаваемого сайта гликозили-рования (и/или аминокислотная делеция во втором положении) приводят к предотвращению гликозили-рования в модифицированной последовательности из трех пептидов. Другим методом увеличения числа углеводных молекул в полипептиде ActRIIB является химическое или ферментативное присоединение гликозидов к полипептиду ActRIIB. В зависимости от применяемого метода присоединения сахар (сахара) может (могут) быть присоединен(ы) к (а) аргинину и гистидину; (b) свободным карбоксильным группам; (с) свободным сульфгидрильным группами, таким как сульфгидрильные группы цистеина; (d) свободным гидроксильным группам, таким как группы серина, треонина или гидроксипролина; (е) ароматическим остаткам, таким как остатки фенилаланина, тирозина или триптофана; или (f) к амидной группе глутамина. Эти методы описаны в WO 87/05330, опубликованной 11 сентября 1987, и в публикации Ap-lin & Wriston (1981) CRC Crit. Rev. Biochem., pp. 259-306, которая вводится в настоящее описание посредством ссылки. Удаление одной или нескольких углеводных групп, присутствующих на полипептиде ActRIIB, может быть осуществлено химически и/или ферментативно. Химическое дегликозилирование может включать, например, обработку полипептида ActRIIB соединением трифторметансульфоновой кислоты или эквивалентным соединением. Такая обработка приводит к отщеплению большинства или всех сахаров, за исключением линкерного сахара (N-ацетилглюкозамина или N-ацетилгалактозамина), при этом аминокислотная последовательность остается интактной. Химическое дегликозилирование более подробно описано в публикации Hakimuddin et al. (1987) Arch. Biochem. Biophys. 259:52 и Edge et al. (1981) Anal. Biochem. 118:131. Ферментативное расщепление углеводных групп на полипептидах Ac-tRIIB может быть достигнуто с использованием различных эндо- и экзогликозидаз как описано Thotakura et al. (1987) Meth. Enzymol. 138:350. Последовательность полипептида ActRIIB может быть скорректирована, если это необходимо, в зависимости от типа используемой экспрессионной системы, поскольку все клетки млекопитающих, дрожжей, насекомых и растений могут иметь различные типы гликозилирова-ния, на которые может влиять аминокислотная последовательность пептида. В общих чертах, белки Ac-tRIIB, которые присутствуют у человека, могут быть экспрессированы в клеточных линиях млекопитающих, таких как клеточные линии HEK293 или СНО, которые имеют свой собственный тип гликози-лирования, хотя предполагается, что могут быть также использованы и другие экспрессионные клеточные линии млекопитающих.
Настоящее изобретение также относится к способу получения вариантов, в частности серий комбинаторных вариантов полипептидов ActRIIB, включая, но необязательно, усеченные варианты; и пулов комбинаторных мутантов, которые являются особенно подходящими для идентификации функциональных вариантов последовательности. Целью скрининга таких комбинаторых библиотек может быть, например, получение вариантов полипептида ActRIIB, обладающих измененными свойствами, такими как измененные фармакокинетические свойства или измененный характер связывания с лигандом. Ниже описаны различные скрининг-анализы, и такие анализы могут быть проведены для оценки вариантов. Так, например, вариант полипептида ActRIIB может быть скринирован на его способность связываться с полипептидом ActRIIB и на предотвращение связывания лиганда ActRIIB с полипептидом ActRIIB.
Активность полипептида ActRIIB или его вариантов может быть также протестирована в клеточном анализе или в анализе in vivo. Так, например, может быть оценено влияние варианта полипептида Ac-tRIIB на экспрессию генов, участвующих в формировании кости и в образовании остеобластов или их предшественников. При необходимости, это может быть осуществлено в присутствии одного или нескольких рекомбинантных белков-лигандов ActRIIB (например, ВМР7), а клетки могут быть трансфици
рованы так, чтобы они продуцировали полипептид ActRIIB и/или его варианты, и, необязательно, лиганд ActRIIB. Аналогичным образом, полипептид ActRIIB может быть введен мышам или другим животным, а затем могут быть оценены одно или несколько свойств кости, таких как плотность или объем. Может быть также оценена скорость срастания костей после их перелома. Аналогичным образом, активность полипептида ActRIIB или его вариантов может быть протестирована в клетках мышц, в адипоцитах и в нервных клетках на любое ее влияние на рост этих клеток, например, с помощью анализов, описанных ниже. Такие анализы являются хорошо известными и могут быть осуществлены рутинными методами. Для мониторинга влияния на последующую передачу сигнала в таких клеточных линиях может быть использован SMAD-чувствительный ген-репортер.
Могут быть получены комбинаторные варианты, которые по сравнению с природным полипептидом ActRIIB обладают селективной способностью. Такие варианты белков при их экспрессии из реком-бинантных ДНК-конструкций могут быть использованы в протоколах генотерапии. Аналогичным образом, путем мутагенеза могут быть получены варианты, которые имеют внутриклеточное время полужизни, значительно отличающееся от времени полужизни соответствующего полипептида ActRIIB дикого типа. Так, например, модифицированный белок может сообщать нативному полипептиду ActRIIB большую или меньшую стабильность к протеолитическому расщеплению или к другим процессам, которые приводят к деструкции или к какой-либо другой инактивации нативного полипептида ActRIIB. Такие варианты и кодирующие их гены могут быть использованы в целях изменения уровней полипептида Ac-tRIIB посредством модуляции времени полужизни полипептидов ActRIIB. Так, например, короткое время полужизни может давать более кратковременные биологические эффекты, а в случае использования части индуцибельно экспрессионной системы, оно может более жестко регулировать уровни рекомби-нантных полипептидов ActRIIB в клетках.
В некоторых вариантах изобретения полипептиды ActRIIB согласно изобретению могут также содержать пострансляционные модификации, помимо любых модификаций, которые обычно присутствуют в полипептидах ActRIIB. Такими модификациями являются, но не ограничиваются ими, ацетилирование, карбоксилирование, гликозилирование, фосфорилирование, липидизация и ацилирование. В результате этого модифицированные полипептиды ActRIIB могут содержать неаминокислотные элементы, такие как полиэтиленгликоли, липиды, поли- или моносахариды и фосфаты. Влияние таких неаминокислотных элементов на функциональные свойства полипептида ActRIIB может быть протестировано как описано в настоящей заявке для других вариантов полипептидов ActRIIB. Если полипептид ActRIIB продуцируется в клетках путем отщепления растущей формы полипептида ActRIIB, то для регулирования укладки и/или функции белка важную роль может также играть посттрансляционный процессинг. Различные клетки (такие как СНО, HeLa, MDCK, 293, WI38, NIH-3T3 или HEK293) имеют конкретные клеточные механизмы и характерные механизмы такой посттрансляционной активности и могут быть выбраны для гарантии соответствующей модификации и процессинга полипептидов ActRIIB.
В некоторых аспектах изобретения функциональными вариантами или модифицированными формами полипептидов ActRIIB являются слитые белки, имеющие по меньшей мере часть полипептидов ActRIIB и один или несколько слитых доменов. Хорошо известными примерами таких слитых доменов являются, но не ограничиваются ими, полигистидин, Glu-Glu, глутатион^-трансфераза (GST), тиоредок-син, белок А, G-белок, константная область тяжелой цепи иммуноглобулина (например, Fc), белок, связывающийся с мальтозой (МВР), или альбумин человеческой сыворотки. Слитый домен может быть выбран так, чтобы он сообщал нужные свойства. Так, например, некоторые слитые домены являются особенно подходящими для выделения слитых белков с помощью аффинной хроматографии. Для проведения аффинной очистки используются соответствующие матрицы для аффинной хроматографии, такие как смолы, конъюгированные с глутатионом, амилазой и никелем или кобальтом. Многие такие матрицы поставляются в виде набора, такого как система очистки Pharmacia GST и система QIAexpress(tm) (Qiagen), в которой используются партнеры по связыванию (HIS6). В другом примере слитый домен может быть выбран так, чтобы он облегчал детектирование полипептидов ActRIIB. Примерами таких доменов для детектирования являются различные флуоресцентные белки (например, GFP), а также "эпитопные метки", обычно представляющие собой короткие пептидные последовательности, для которых имеются специфические антитела. Хорошо известными эпитопными метками, которые легко доступны для специфических моноклональных антител, являются метки FLAG, гемаглютинин вируса гриппа (НА) и с-myc. В некоторых случаях слитые домены имеют сайт расщепления протеазой, такой как фактор Ха или тромбин, что позволяет релевантной протеазе частично расщеплять слитые белки и тем самым высвобождать из них рекомбинантные белки. Высвобождаемые белки могут быть затем выделены из слитого домена путем проведения хроматографического разделения. В некоторых предпочтительных вариантах изобретения полипептид ActRIIB присоединяют к домену, который стабилизирует полипептид ActRIIB in vivo ("домен-стабилизатор"). Термин "стабилизация" означает увеличение времени полужизни в сыворотке, независимо от того, происходит ли это вследствие снижения уровня деструкции, снижения уровня выведения из почек или других фармакокинетических эффектов. Известно, что гибриды Fc-части иммуноглобулина сообщают белкам широкого ряда желательные фармакокинетические свойства. Аналогичным образом, желательные свойства могут также сообщать гибриды с альбумином человеческой сыворотки.
Слитыми доменами других типов, которые могут быть отобраны, являются мультимеризующие (например, димеризующие, тетрамеризующие) домены и функциональные домены (которые сообщают дополнительную биологическую функцию, такую как дополнительная стимуляция роста мышечной массы).
В своем конкретном примере настоящее изобретение относится к слитому белку, который используется в качестве антагониста GDF8 и содержит внеклеточный (например, GDF8-связывающий) домен, присоединенный к Fc-домену (например, SEQ ID N0:13).
THTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVD (А)
VSHEDPEVKFNWYVDGVEVBNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCK (А)
VSNKALPVPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNG
QPENNYKTTPPVLDSDGPFFLYSKLTVDKSRWQQGNVFSCSVMHEALHN (А)
HYTQKSLSLSPGK*
Fc-домен предпочтительно имеет одну или несколько мутаций в таких остатках, как Asp-265, Lys-322 и Asn-434. В некоторых случаях мутантный Fc-домен, имеющий одну или несколько таких мутаций (например, мутацию в Asp-265), обладает пониженной способностью связываться с Fcy-рецептором по сравнению с Fc-доменом дикого типа. В других случаях мутантный Fc-домен, имеющий одну или несколько таких мутаций (например, мутацию в Asn-434), по сравнению с Fc-доменом дикого типа обладает повышенной способностью связываться с Fc-рецептором, родственным МНС класса I (FcRN).
Следует отметить, что различные элементы слитых белков могут быть расположены в любом порядке, который позволяет сохранять их желательные функции. Так, например, полипептид ActRIIB может быть расположен у С-конца по отношению к гетерологичному домену, либо, альтернативно, гетеро-логичный домен может быть расположен у С-конца по отношению к полипептиду ActRIIB. Домен полипептида ActRIIB и гетерологичный домен необязательно должны находиться рядом друг с другом в слитом белке, а дополнительные домены или аминокислотные последовательности могут быть включены со стороны С- или N-концов по отношению к любому домену или между этими доменами.
В некоторых вариантах изобретения полипептиды ActRIIB согласно изобретению содержат одну или несколько модификаций, обладающих способностью стабилизировать полипептиды ActRIIB.
Так, например, такие модификации увеличивают время полужизни полипептидов ActRIIB in vitro, увеличивают время полужизни полипептидов ActRIIB в кровотоке или снижают уровень протеолитиче-ского расщепления полипептидов ActRIIB. Такими стабилизирующими модификациями являются, но не ограничиваются ими, слитые белки (включая, например, слитые белки, содержащие полипептид ActRIIB и домен-стабилизатор), модификации сайта гликозилирования (включая, например, присоединение сайта гликозилирования к полипептиду ActRIIB) и модификации углеводной молекулы (включая, например, удаление углеводных групп из полипептида ActRIIB). В случае слитых белков полипептид ActRIIB присоединяют к домену-стабилизатору, такому как молекула IgG (например, Fc-домену). Используемый здесь термин "домен-стабилизатор" означает не только слитый домен (например, Fc), как в случае слитых белков, но также включает небелковые модификации, такие как углеводная молекула или небелковый полимер, такой как полиэтиленгликоль.
В некоторых своих вариантах настоящее изобретение относится к получению подходящих выделенных и/или очищенных форм полипептидов ActRIIB, которые были отделены или как-либо иначе очищены от других белков.
В некоторых вариантах изобретения полипептиды ActRIIB (немодифицированные или модифицированные) согласно изобретению могут быть получены различными методами, известными специалистам. Так, например, такие полипептиды ActRIIB могут быть синтезированы стандартными методами химического синтеза белков, такими как методы, описанные в публикациях Bodansky, M. Principles of Peptide Synthesis, Springer Verlag, Berlin (1993) и Grant G. A. (ed.), Synthetic Peptides: A User's Guide, W. H. Freeman & Company, New York (1992). Кроме того, автоматические синтезаторы пептидов являются коммерчески доступными (например, Advanced ChemTech Model 396; Milligen/Biosearch 9600). Альтернативно, полипептиды ActRIIB, их фрагменты или варианты могут быть рекомбинантно продуцированы с использованием различных экспрессионных систем (например, E.coli, клеток яичника китайского хомячка, клеток COS, бакуловируса), хорошо известных специалистам (также см. ниже). В другом варианте изобретения модифицированные или немодифицированные полипептиды ActRIIB могут быть получены путем гидролиза природных или рекомбинантно продуцированных полноразмерных полипептидов Ac-tRIIB с использованием, например, протеазы, например трипсина, термолизина, химотрипсина, пепсина или комплексного фермента, конвертирующего основную аминокислоту (РАСЕ). Для идентификации сайтов протеолитического расщепления может быть проведен компьютерный анализ (с использованием коммерчески доступной программы, например, MacVector, Omega, PCGene, Molecular Simulation, Inc.). Альтернативно, такие полипептиды ActRIIB могут быть получены из природных или рекомбинантно продуцированных полноразмерных полипептидов ActRIIB известными стандартными методами, такими как метод химического расщепления (например, бромцианом, гидроксиламином).
3. Нуклеиновые кислоты, кодирующие полипептиды ActRIIB.
В некоторых своих аспектах настоящее изобретение относится к выделенным и/или рекомбинант-ным нуклеиновым кислотам, кодирующим любой из полипептидов ActRIIB (например, растворимые полипептиды ActRIIB), включая любые описанные здесь варианты. Так, например, SEQ ID NO:4 кодирует природный полипептид-предшественник ActRIIB, a SEQ ID NO:3 кодирует растворимый полипептид ActRIIB. Рассматриваемые нуклеиновые кислоты могут быть одноцепочечными или двухцепочечными. Такими нуклеиновыми кислотами могут быть молекулы ДНК или РНК. Указанные нуклеиновые кислоты могут быть использованы, например, в методах получения полипептидов ActRIIB или в качестве самих терапевтических средств (например, в методе генотерапии).
Из некоторых аспектов изобретения также очевидно, что рассматриваемые нуклеиновые кислоты, кодирующие полипептиды ActRIIB, включают нуклеиновые кислоты, которые являются вариантами SEQ ID NO:3. Вариантами нуклеотидных последовательностей являются последовательности, которые отличаются одной или несколькими нуклеотидными заменами, добавлениями или делециями, такие как аллельные варианты, а поэтому такими последовательностями являются кодирующие последовательности, которые отличаются от нуклеотидной кодирующей последовательности, представленной в SEQ ID
NO:4.
В некоторых своих вариантах настоящее изобретение относится к выделенным или рекомбинант-ным последовательностям нуклеиновой кислоты, которые по меньшей мере на 80, 85, 90, 95, 97, 98, 99 или 100% идентичны SEQ ID NO:3. Для среднего специалиста в данной области совершенно очевидно, что последовательности нуклеиновой кислоты, комплементарные SEQ ID NO:3, и варианты SEQ ID NO:3 также входят в объем настоящего изобретения. В других вариантах изобретения последовательности нуклеиновой кислоты согласно изобретению могут быть выделенными, рекомбинантными и/или присоединенными к гетерологичной нуклеотидной последовательности, либо они могут присутствовать в библиотеке ДНК.
В других вариантах изобретения нуклеиновыми кислотами согласно изобретению также являются нуклеотидные последовательности, которые гибридизуются в условиях высокой жесткости с нуклеотид-ной последовательностью, представленной в SEQ ID NO:3, с комплементарной последовательностью SEQ ID NO:3 или с их фрагментами. Как обсуждалось выше, для среднего специалиста в данной области совершенно очевидно, что соответствующие условия жесткости, которые стимулируют гибридизацию ДНК, могут варьироваться. Так, например, может быть осуществлена гибридизация в присутствии 6,0ххлорида натрия/цитрата натрия (SSC) примерно при 45°С с последующей промывкой 2,0xSSC при 50°С. Так, например, концентрация соли на стадии промывки может быть выбрана из интервала концентраций, соответствующих условиям низкой жесткости примерно при 2,0xSSC при 50°С, и концентраций, соответствующих условиям высокой жесткости примерно при 0,2xSSC при 50°С. Кроме того, температура в стадии промывки может быть увеличена, начиная от комнатной температуры, соответствующей условиям низкой жесткости примерно 22°С, до температуры, соответствующей условиям высокой жесткости примерно 65°С. Температура и концентрация соли могут варьироваться, при этом один из параметров может оставаться постоянным, например температура или концентрация соли, а другой параметр может изменяться. В одном из своих вариантов настоящее изобретение относится к нуклеиновым кислотам, которые гибридизуются в условиях низкой жесткости при 6x SSC и при комнатной температуре с последующей промывкой 2x SSC при комнатной температуре.
Выделенные нуклеиновые кислоты, которые отличаются от нуклеиновых кислот, представленных в SEQ ID NO:3, вырожденностью генетического кода, также входят в объем настоящего изобретения. Так, например, ряд аминокислот кодируется более чем одним триплетом. Кодоны, которые соответствуют одной и той же аминокислоте, или синонимичные кодоны (например, CAU и САС являются синонимичными кодонами для гистидина) могут давать "молчащие" мутации, которые не влияют на аминокислотную последовательность белка. Однако предполагается, что в клетках млекопитающих имеется полиморфизм последовательностей ДНК, который приводит к изменениям в аминокислотных последовательностях рассматриваемых белков. Для специалистов в данной области очевидно, что такие изменения в одном или нескольких нуклеотидах (примерно до 3-5% нуклеотидов) нуклеиновых кислот, кодирующих конкретный белок, могут присутствовать у индивидуумов данного вида вследствие природной аллельной вариабельности. Любые и все указанные нуклеотидные модификации и полиморфизмы аминокислот входят в объем настоящего изобретения.
В некоторых вариантах изобретения рекомбинантные нуклеиновые кислоты согласно изобретению могут быть функционально присоединены к одной или нескольким регуляторным нуклеотидным последовательностям в экспрессионной конструкции. Регуляторные нуклеотидные последовательности обычно присутствуют в клетке-хозяине, используемой для экспрессии. Специалистам известно много типов соответствующих экспрессионных векторов и подходящих регуляторных последовательностей для различных клеток-хозяев. Обычно указанными одной или несколькими регуляторными нуклеотидными последовательностями могут быть, но не ограничиваются ими, промоторные последовательности, лидер-ные или сигнальные последовательности, сайты связывания с рибосомой, последовательности инициации и терминации транскрипции, последовательности инициации и терминации трансляции и последова
тельности энхансеров или активаторов. В настоящем изобретении рассматриваются конститутивные или индуцибельные промоторы, известные специалистам. Промоторами могут быть природные промоторы или слитые промоторы, которые объединяют элементы, содержащие более чем один промотор. Экспрес-сионная конструкция может присутствовать в клетке на эписоме, такой как плазмида, либо такая экс-прессионная конструкция может быть встроена в хромосому. В предпочтительном варианте изобретения экспрессионный вектор содержит селективный маркерный ген, что позволяет осуществлять отбор трансформированных клеток-хозяев. Селективные маркерные гены хорошо известны специалистам и могут варьироваться в зависимости от используемой клетки-хозяина.
В некоторых своих аспектах настоящее изобретение относится к рассматриваемой нуклеиновой кислоте, присутствующей в экспрессионном векторе, включающем нуклеотидную последовательность, кодирующую полипептид ActRIIB и функционально присоединенную по меньшей мере к одной регуля-торной последовательности. Регуляторные последовательности известны специалистам и могут быть выбраны так, чтобы они позволяли осуществлять прямую экспрессию полипептида ActRIIB. В соответствии с этим термин "регуляторная последовательность" включает промоторы, энхансеры и другие элементы регуляции экспрессии. Репрезентативные регуляторные последовательности описаны в публикации Goeddel; Gene Expression Technology: Methods in Enzymology, Academic Press, San Diego, CA (1990). Так, например, любая из последовательностей регуляции экспрессии широкого ряда, регулирующих экспрессию последовательности ДНК, при ее функциональном присоединении к данной последовательности, может быть использована в данных векторах для экспрессии последовательностей ДНК, кодирующих полипептид ActRIIB. Такими подходящими последовательностями регуляции экспрессии являются, например, ранний и поздний промотор SV40, промотор tet, предранний промотор аденовируса или цито-мегаловируса, промоторы RSV, система lac, система trp, система ТАС или TRC, промотор Т7, экспрессия которого регулируется РНК-полимеразой Т7, главные операторные и промоторные области фага лямбда, регуляторные области оболочечного белка fd, промотор 3-фосфоглицераткиназы или других гликолити-ческих ферментов, промоторы кислотной фосфатазы, например Pho5, промоторы дрожжевых факторов скрещивания а, полиэдроновый промотор бакуловирусной системы и другие последовательности, которые, как известно, регулируют экспрессию генов прокариотических или эукариотических клеток или их вирусов и различные их комбинации. Следует отметить, что конструирование экспрессионного вектора может зависеть от таких факторов, как выбор трансформируемой клетки-хозяина и/или типа белка, предназначенного для экспрессии. Кроме того, необходимо также учитывать число копий векторов, способность регулировать число таких копий и уровень экспрессии любого другого белка, кодируемого вектором, такого как антибиотики-маркеры.
Рекомбинантная нуклеиновая кислота согласно изобретению может быть продуцирована путем ли-гирования клонируемого гена или его части в вектор, подходящий для экспрессии в любых прокариоти-ческих клетках, эукариотических клетках (дрожжей, птиц, насекомых или млекопитающих) или в обеих этих клетках. Экспрессионными носителями для продуцирования рекомбинантного полипептида Ac-tRIIB являются плазмиды и другие векторы. Так, например, подходящими векторами являются плазмиды следующих типов: плазмиды, происходящие от pBR322; плазмиды, происходящие от pEMBL; плазмиды, происходящие от рЕХ; плазмиды, происходящие от рВТас; и плазмиды, происходящие от pUC, которые могут быть использованы для экспрессии в прокариотических клетках, таких как E.coli.
Некоторые экспрессионные векторы млекопитающих содержат прокариотические последовательности, облегчающие размножение векторов в бактериях, и одну или несколько эукариотических транскрипционных единиц, которые экспрессируются в эукариотических клетках. Примерами экспрессионных векторов млекопитающих, подходящих для трансфекции эукариотических клеток, являются векторы,
происходящие от pcDNAI/amp, pcDNAI/neo, pRc/CMV, pSV2gpt, pSV2neo, pSV2-dhfr, pTk2, pRSVneo,
pMSG, pSVT7, pko-neo и pHyg. Для облегчения репликации и отбора на резистентность к лекарственному средству в прокариотических и эукариотических клетках некоторые из этих векторов модифицируют последовательностями, происходящими от бактериальных плазмид, таких как pBR322. Альтернативно, для временной экспрессии белков в эукариотических клетках могут быть использованы производные вирусов, таких как вирус бычьей папилломы (BPV-1) или вирус Эпштейна-Барра (pHEBo, pREP-производное и р205). Примеры других вирусных экспрессионных систем (включая ретровирусные системы) можно найти ниже в разделе "Системы доставки методами генотерапии". Различные методы, применяемые для получения плазмид и трансформации организмов-хозяев, хорошо известны специалистам. Описание других подходящих экспрессионных систем для прокариотических и эукариотических клеток, а также описание общих процедур рекомбинации можно найти в руководстве Molecular Cloning A Laboratory Manual, 2nd Ed., ed. Sambrook, Fritsch & Maniatis (Cold Spring Harbor Laboratory Press, 1989) Chapters 16 and 17. В некоторых случаях может оказаться желательным экспрессировать рекомбинантные полипептиды с использованием бакуловирусной экспрессионной системы. Примерами таких бакуловирус-ных экспрессионных систем являются векторы, происходящие от pVL (такие как pVL1392, pVL1393 и pVL941), векторы, происходящие от pAcUW (такие как pAcUW1), и векторы, происходящие от pBlueBac (такие как р -gal-содержащий вектор pBlueBac III).
В предпочтительном варианте изобретения для продуцирования рассматриваемых полипептидов ActRIIB в клетках СНО могут быть сконструированы такие векторы, как вектор Pcmv-Script (Stratagene, La Jolla, Calif.), векторы pcDNA4 (Invitrogen, Carlsbad, Calif.) и векторы pCI-neo (Promega, Madison, Wise). Следует отметить, что рассматриваемые генные конструкции могут быть использованы для индуцирования экспрессии рассматриваемых полипептидов ActRIIB в клетках, размножаемых в культуре, например для продуцирования белков, включая слитые белки или варианты белков, и для их очистки.
Настоящее изобретение также относится к клетке-хозяину, трансфицированной рекомбинантным геном, включая последовательность (например, SEQ ID NO:4), кодирующую один или несколько рассматриваемых полипептидов ActRIIB. Клеткой-хозяином может быть любая прокариотическая или эука-риотическая клетка. Так, например, полипептид ActRIIB согласно изобретению может быть экспресси-рован в бактериальных клетках, таких как E.coli, клетки насекомых (например, с использованием баку-ловирусной экспрессионной системы), клетки дрожжей или клетки млекопитающих. Специалистам известны и другие подходящие клетки-хозяева.
В соответствии с этим настоящее изобретение также относится к способам продуцирования рассматриваемых полипептидов ActRIIB. Так, например, клетки-хозяева, трансфицированные экспрессион-ным вектором, кодирующим полипептид ActRIIB, могут быть культивированы в условиях, подходящих для экспрессии полипептида ActRIIB. Полипептид ActRIIB может быть секретирован и выделен из смеси клеток и среды, содержащей полипептид ActRIIB. Альтернативно, полипептид ActRIIB может сохраняться в цитоплазме или в мембранной фракции, после чего клетки собирают, подвергают лизису и выделяют белок. Клеточная культура включает клетки-хозяева, среду и другие побочные продукты. Подходящие среды для культивирования клеток хорошо известны специалистам. Рассматриваемые полипептиды ActRIIB могут быть выделены из среды для культивирования клеток, клеток-хозяев или того и другого известными методами, применяемыми для очистки белков, включая ионообменную хроматографию, гель-фильтрацию, ультрафильтрацию, электрофорез и иммуноаффинную очистку с использованием антител, специфичных к конкретным эпитопам полипептидов ActRIIB. В предпочтительном варианте изобретения полипептидом ActRIIB является слитый белок, содержащий домен, который облегчает его очистку.
В другом варианте изобретения слитый ген, кодирующий лидерную последовательность для очистки, такую как последовательность сайта расщепления поли-(His)/энтерокиназой, расположенную у N-конца нужной части рекомбинантного полипептида ActRIIB, может обеспечивать очистку экспрессируе-мого слитого белка с помощью аффинной хроматографии, проводимой с использованием смолы, связанной с металлом Ni2+. Для очистки лидерная последовательность может быть затем удалена путем обработки энтерокиназой с получением очищенного полипептида ActRIIB (например, см. Hochuli et al., (1987) J. Chromatography 411:177 и Janknecht et al., PNAS USA 88:8972).
Методы получения слитых генов хорошо известны специалистам. По существу, присоединение различных ДНК-фрагментов, кодирующих различные полипептидные последовательности, осуществляют в соответствии со стандартными методами с применением затупленных концов или липких концов со ступенчатыми разрывами для лигирования; гидролиза рестриктирующими ферментами для образования соответствующих концов; достраивания "липких концов", если это необходимо; обработки щелочной фосфатазой во избежание нежелательного присоединения, и ферментативного лигирования. В другом варианте изобретения слитый ген может быть синтезирован стандартными методами, включая использование автоматизированных синтезаторов ДНК. Альтернативно, ПЦР-амплификация генных фрагментов может быть осуществлена с использованием заякоривающих праймеров, которые образуют комплементарные выступающие концы между двумя расположенными друг за другом генными фрагментами, которые затем могут быть подвергнуты отжигу с получением химерной генной последовательности (см., например, Current Protocols in Molecular Biology, eds. Ausubel et al., John Wiley & Sons: 1992).
4. Антитела.
В другом своем аспекте настоящее изобретение относится к антителам. Антитело, которое специфически реагирует с полипептидом ActRIIB (например, с растворимым полипептидом ActRIIB) и которое конкурентно связывается с полипептидом ActRIIB, может быть использовано в качестве антагониста активности полипептида ActRIIB. Так, например, с использованием иммуногенов, происходящих от полипептида ActRIIB, могут быть получены антисыворотка или моноклональные антитела против белков/пептидов в соответствии со стандартными протоколами (см., например, Antibodies: A Laboratory Manual ed. Harlow & Lane (Cold Spring Harbor Press: 1988)). Млекопитающее, такое как мышь, хомячок или кролик, может быть иммунизировано иммуногенной формой полипептида ActRIIB, антигенным фрагментом, обладающим способностью вырабатывать ответ типа продуцирования антител, или слитым белком. Методы сообщения иммуногенности белку или пептиду включают конъюгирование с носителями или другие способы, хорошо известные специалистам. Иммуногенная часть полипептида ActRIIB может быть введена в присутствии адъюванта. Мониторинг процесса иммунизации может быть проведен путем детектирования титров антител в плазме или сыворотке. Для оценки уровней антител могут быть проведены стандартный ELISA или другие иммуноанализы с использованием иммуногена в качестве антигена.
После иммунизации животного антигенным препаратом полипептида ActRIIB может быть получена антисыворотка, и если это необходимо, из такой сыворотки могут быть выделены поликлональные антитела. Для продуцирования моноклональных антител у иммунизованного животного могут быть собраны антитело-продуцирующие клетки (лимфоциты), а затем в соответствии со стандартными процедурами слияния соматических клеток эти клетки могут быть подвергнуты слиянию с иммортализованными клетками, такими как клетки миеломы, в результате чего могут быть получены гибридомные клетки. Такие методы хорошо известны специалистам и включают, например, гибридомный метод (впервые разработанный Kohler и Milstein, (1975) Nature, 256: 495-497), гибридомный метод с использованием человеческих В-клеток (Kozbar et al., (1983) Immunology Today, 4: 72), и EBV-гибридомный метод для продуцирования человеческих моноклональных антител (Cole et al., (1985) Monoclonal Antibodies and Cancer Therapy, Alan R. Liss, Inc. pp. 77-96). Гибридомные клетки могут быть скринированы иммунохимическим методом на продуцирование антител, специфически реагирующих с полипептидом ActRIIB, и монокло-нальных антител, выделенных из культуры, содержащей такие гибридомные клетки.
Используемый здесь термин "антитело" включает фрагменты антитела, которые также специфически реагируют с рассматриваемым полипептидом ActRIIB. Антитела могут быть фрагментированы стандартными методами, и полученные фрагменты могут быть скринированы на возможность их использования в описанных выше способах, применяемых для целых антител. Так, например, F (ab'^-фрагменты могут быть получены путем обработки антитела пепсином. Так, например, F(ab')2-фрагмент может быть обработан для восстановления дисульфидных мостиков в целях продуцирования Fab-фрагментов. Термин "антитело согласно изобретению" также включает биспецифические, одноцепочечные, химерные и гуманизированные молекулы, обладающие аффинностью по отношению к полипептиду ActRIIB, сообщаемой по меньшей мере одной областью CDR данного антитела. В предпочтительных вариантах изобретения указанное антитело также содержит присоединенную к нему метку, которая может быть детектирована (например, такой меткой может быть радиоизотоп, флуоресцентное соединение, фермент и кофактор фермента).
В некоторых предпочтительных вариантах изобретения антителом согласно изобретению является моноклональное антитело, а в некоторых своих вариантах настоящее изобретение относится к способу разработки подходящих методов получения новых антител. Так, например, метод получения монокло-нального антитела, которое специфически связывается с полипептидом ActRIIB, может включать введение мышам иммуногенной композиции, содержащей полипептид ActRIIB, в количестве, эффективном для стимуляции детектируемого иммунного ответа; получение антитело-продуцирующих клеток (например, клеток селезенки) у этих мышей; слияние указанных антитело-продуцирующих клеток с миелом-ными клетками для получения антитело-продуцирующих гибридом и тестирование антитело-продуцирующих гибридом для идентификации гибридомы, продуцирующей моноклональное антитело, которое специфически связывается с полипептидом ActRIIB. Гибридома после ее получения может быть размножена в клеточной культуре, необязательно в условиях культивирования, при которых гибридом-ные клетки продуцируют моноклональное антитело, которое специфически связывается с полипептидом ActRIIB. Моноклональное антитело может быть выделено из клеточной культуры.
Используемое здесь определение "специфически реагирующий с если оно относится к антителу, означает, как в общих чертах известно специалистам, что данное антитело является достаточно селективным по отношению к представляющему интерес антигену (например, к полипептиду ActRIIB), но не к другим не представляющим интерес антигенам, и что данное антитело может быть использовано как минимум для детектирования присутствия представляющего интерес антигена в биологическом образце конкретного типа. В некоторых способах, в которых используется данное антитело, таких как терапевтические методы, может оказаться желательной более высокая степень специфичности связывания. Моно-клональные антитела обычно имеют более высокую тенденцию (по сравнению с поликлональными антителами) к эффективному распознаванию нужных антигенов, но не перекрестно реагирующих полипептидов. Одним из факторов, который влияет на специфичность взаимодействия антитело:антиген, является аффинность антитела к антигену. Хотя нужная специфичность может достигаться в интервале различных аффинностей, однако в основном предпочтительные антитела должны обладать аффинностью (должны иметь константу диссоциации), составляющей примерно 10-6, 10-7, 10-8, 10-9 или менее.
Кроме того, выбор методов, используемых для скрининга антител в целях идентификации нужного антитела, может зависеть от свойств полученного антитела. Так, например, если антитело используется для связывания с антигеном в растворе, то может оказаться желательным проведение теста на связывание в растворе. Для тестирования взаимодействия между антителами и антигенами в целях идентификации особенно подходящих антител применяется ряд различных методов. Такими методами являются ELISA, анализы на связывание методом поверхностного плазмонного резонанса (например, анализ на связывание Biacore, Bia-core AB, Uppsala, Sweden), "сэндвич"-анализы (например, система парамагнитных сфер IGEN International, Inc., Gaithersburg, Maryland), вестерн-блот-анализы, анализы методом им-мунопреципитации и иммуногистохимический анализ.
В некоторых своих аспектах настоящее изобретение относится к антителам, которые связываются с растворимым полипептидом ActRIIB. Такие антитела могут быть получены в основном, как описано
выше, с использованием растворимого полипептида ActRIIB или его фрагмента в качестве антигена. Антитела этого типа могут быть использованы, например, для детектирования полипептидов ActRIIB в биологических образцах и/или для мониторинга уровней растворимых полипептидов ActRIIB у индивидуума. В некоторых случаях антитело, которое специфически связывается с растворимым полипептидом ActRIIB, может быть использовано для модуляции активности полипептида ActRIIB и/или лиганда Ac-tRIIB и, тем самым, регуляции (стимуляции или ингибирования) роста тканей, таких как ткани костей, хрящей и мышц; жировые ткани и нервные ткани. 5. Скрининг-анализы.
В некоторых своих аспектах настоящее изобретение относится к применению рассматриваемых полипептидов ActRIIB (например, растворимых полипептидов ActRIIB) для идентификации соединений (агентов), которые являются агонистами или антагонистами полипептидов ActRIIB. Соединения, идентифицированные с помощью такого скрининга, могут быть протестированы в таких тканях, как ткани костей, хрящей и мышц; жировые ткани и/или нервные ткани, для оценки способности этих соединений модулировать рост ткани in vitro. Данные соединения могут быть также, но необязательно, протестированы на животных-моделях для оценки способности этих соединений модулировать рост ткани in vivo.
Существует множество методов скрининга терапевтических средств, модулирующих рост ткани, путем нацеливания на полипептиды ActRIIB. В некоторых вариантах изобретения может быть осуществлен крупномасштабный скрининг соединений для идентификации агентов, которые устраняют влияние ActRIIB-опосредуемых эффектов на рост кости, хряща, мышц, жировой ткани и/или нейронов. В некоторых вариантах изобретения осуществляют анализ для скрининга и идентификации соединений, которые специфически ингибируют или подавляют связывание полипептида ActRIIB с его партнером по связыванию, таким как лиганд ActRIIB (например, активин, Nodal, GDF8, GDF11 или ВМР7).
Альтернативно, может быть осуществлен анализ для идентификации соединений, которые повышают уровень связывания полипептида ActRIIB с белком-партнером по связыванию, таким как лиганд ActRIIB. В другом варианте изобретения такие соединения могут быть идентифицированы на их способность взаимодействовать с полипептидом ActRIIB.
Существует достаточное число форматов анализов, которые точно не описаны в настоящем изобретении, но тем не менее они известны среднему специалисту в данной области. Как описано в настоящей заявке, тестируемые соединения (агенты) согласно изобретению могут быть получены любым комбинаторным химическим методам. Альтернативно, рассматриваемые соединения могут быть in vivo или in vitro синтезированы естественным образом как биомолекулы. Такие соединения (агенты), тестируемые на их способность действовать как модуляторы роста ткани, могут быть продуцированы, например, бактериями, дрожжами, растениями или другими организмами (например, природные продукты), химическими методами (например, в виде небольших молекул, включая пептидомиметики) или рекомбинант-ными методами. Тестируемыми соединениями, рассматриваемыми в настоящей заявке, являются непеп-тидильные органические молекулы, пептиды, полипептиды, пептидомиметики, сахара, гормоны и молекулы нуклеиновой кислоты. В конкретном варианте изобретения тестируемым агентом является небольшая органическая молекула, молекулярная масса которой составляет примерно менее чем 2000 Да.
Тестируемые соединения согласно изобретению могут быть получены в виде одной дискретной молекулы или в виде более сложных библиотек, таких как библиотеки, полученные химическим комбинаторным методом. Такие библиотеки могут включать, например, спирты, алкилгалогениды, амины, амиды, сложные эфиры, альдегиды, простые эфиры и органические соединения других классов. Тестируемые соединения могут быть презентированы тест-системе в выделенной форме или в виде смеси соединений, в частности, в начальных стадиях скрининга. Такие соединения могут быть, но необязательно, дериватизированы другими соединениями и могут иметь дериватизирующие группы, облегчающие выделение данных соединений. Неограничивающими примерами дериватизирующих групп являются био-тин, флуоресцеин, дигоксигенин, белок, флуоресцирующий в зеленом диапазоне спектра, изотопы, поли-гистидин, магнитные сферы, глутатион^-трансфераза (GST), фотоактивируемые сшивающие агенты или любые их комбинации.
Во многих программах скрининга лекарственных средств, в которых тестируют библиотеки соединений и природных экстрактов, для максимизации числа соединений, наблюдаемых в данный период времени, может оказаться желательным проведение анализов в крупномасштабном формате. Анализы, осуществляемые в бесклеточных системах, например системах, которые могут быть модифицированы очищенными или наполовину очищенными белками, часто и предпочтительно используются в качестве "предварительного" скрининга, то есть такие анализы могут быть разработаны для быстрого выявления и относительно легкого детектирования модификации в молекулярной мишени, опосредуемой тестируемым соединением. Кроме того, токсическое воздействие на клетку или биологическая доступность тестируемого соединения могут, вообще говоря, не учитываться в in vitro системе, а вместо этого все внимание в этом анализе может быть сфокусировано, главным образом, на влиянии лекарственного средства на молекулярную мишень, которое может проявляться в модификации аффинности связывания полипептида ActRIIB со связывающимся с ним белком (например, лигандом ActRIIB).
В репрезентативном скрининг-анализе согласно изобретению, который описан здесь лишь для ил
люстрации, представляющее интерес соединение подвергают контактированию с выделенным и очищенным полипептидом ActRIIB, обычно способным связываться с лигандом ActRIIB, если это необходимо для проведения данного анализа. Затем к смеси соединения и полипептида ActRIIB добавляют композицию, содержащую лиганд ActRIIB. Детектирование и количественная оценка комплексов Ac-tRIIB/лиганд ActRIIB представляют собой методы определения эффективности соединений в ингибиро-вании (или потенцировании) образования комплексов между полипептидом ActRIIB и связывающимся с ним белком. Эффективность данного соединения может быть оценена путем построения кривой "доза-ответ" на основании данных, полученных с использованием различных концентраций тестируемого соединения. Кроме того, может быть также осуществлен анализ с контролем, в котором для сравнения используется фоновый уровень. Так, например, в анализе с контролем выделенный и очищенный лиганд ActRIIB добавляют к композиции, содержащей полипептид ActRIIB, и образование комплекса ActRIIB/лиганд ActRIIB количественно оценивают в отсутствие тестируемого соединения. При этом следует отметить, что, по существу, порядок смешивания реагентов может варьироваться, и такие реагенты могут быть смешаны одновременно. Кроме того, для разработки подходящей бесклеточной аналитической системы вместо очищенных белков могут быть использованы клеточные экстракты и лизаты.
Образование комплексов между полипептидом ActRIIB и связывающимся с ним белком может быть детектировано различными методами. Так, например, модуляция образования комплексов может быть количественно оценена с использованием, например, детектируемо меченых белков, таких как радиоактивно меченые (например, 32Р, 35S, 14C или 3Н), флуоресцентно меченые (например, ФИТЦ) или ферментативно меченые полипептид ActRIIB или связывающийся с ним белок, с помощью иммуноана-лиза или хроматографического детектирования.
В некоторых вариантах настоящего изобретения рассматривается применение анализов с поляризацией флуоресценции и анализов с переносом флуоресцентной резонансной энергии (FRET) для прямого или непосредственного измерения степени взаимодействия между полипептидом ActRIIB и связывающимся с ним белком. Кроме того, во многих вариантах изобретения могут применяться и другие способы детектирования, например, с использованием оптических волноводов (публикация РСТ WO 96/26432 и патент США № 5677196), поверхностного плазмонного резонанса (SPR), датчиков поверхностных зарядов и датчиков поверхностного натяжения.
Кроме того, в настоящем изобретении рассматривается применение анализа, проводимого посредством "взаимодействия по типу захвата", также известного как "анализ с использованием двухкомпо-нентного гибрида", который осуществляют в целях идентификации агентов, ингибирующих или потенцирующих взаимодействие между полипептидом ActRIIB и связывающимся с ним белком (см., например, патент США № 5283317; Zervos et al. (1993) Cell 72:223-232; Madura et al. (1993) J. Biol. Chem 268:12046-12054; Bartel et al. (1993) Biotechniques 14:920-924 и Iwabuchi et al. (1993) Oncogene 8:16931696). В конкретном варианте изобретения рассматривается использование обратимых двухкомпонент-ных слитых систем для идентификации соединений (например, небольших молекул или пептидов), которые нарушают взаимодействие между полипептидом ActRIIB и связывающимся с ним белком (см., например, Vidal & Legrain, (1999) Nucleic Acids Res 27:919-29; Vidal & Legrain (1999) Trends Biotechnol 17:374-81 и патенты США №№ 5525490, 5955280 и 5965368.
В некоторых вариантах изобретения рассматриваемые соединения идентифицируют по их способности взаимодействовать с полипептидом ActRIIB согласно изобретению. Взаимодействие между указанным соединением и полипептидом ActRIIB может быть ковалентным или нековалентным. Так, например, такое взаимодействие может быть идентифицировано на уровне белка с применением биохимических методов in vitro, включая перекрестное сшивание под действием оптически активных агентов, связывание с радиоактивно меченым лигандом и аффинную хроматографию (Jakoby WB et al., 1974, Methods in Enzymology 46:1). В некоторых случаях соединения могут быть скринированы в анализе на основе механизма их действия, таком как анализ на соединения, которые связываются с полипептидом ActRIIB. Таким анализом может быть твердофазный анализ на связывание или анализ на связывание в растворе. Альтернативно, ген, кодирующий полипептид ActRIIB, вместе с репортерной системой (например, р-галактозидазой, люциферазой или белком, флуоресцирующим в зеленом диапазоне спектра), может быть трансфицирован в клетку, а затем библиотеку скринируют предпочтительно путем высокопроизводительного скрининга или с использованием отдельных членов библиотеки. Могут быть использованы и другие анализы на связывание, проводимые на основе определенного механизма, например анализы на связывание, которые позволяют детектировать изменение свободной энергии. Анализы на связывание могут быть проведены с использованием мишени, фиксированной на лунке, на сферах или на чипах, или захваченной иммобилизованным антителом, или выделенной путем капиллярного электрофореза. Связанные соединения могут быть в основном детектированы с помощью колориметрического или флуоресцентного анализа или методом поверхностного плазмонного резонанса.
В некоторых своих аспектах настоящее изобретение относится к способам и агентам для стимуляции роста мышц и увеличения мышечной массы, например, путем подавления функций полипептида ActRIIB и/или лиганда ActRIIB. Поэтому любое идентифицированное соединение может быть протестировано в целых клетках или тканях, in vitro или in vivo, для подтверждения его способности модулиро
вать рост мышечной массы. Для осуществления этих целей могут быть применены различные методы, известные специалистам. Так, например, могут быть осуществлены такие способы согласно изобретению, которые позволяют подавлять или ингибировать передачу сигнала посредством белка ActRIIB, активированного путем связывания с лигандом ActRIIB (например, GDF8). Следует отметить, что рост мышечной ткани в организме приводит к увеличению мышечной массы в организме по сравнению с мышечной массой соответствующего организма (или популяции организмов), в котором не происходит передачи сигнала посредством белка ActRIIB.
Так, например, влияние полипептидов ActRIIB или тестируемых соединений на рост/пролиферацию мышечных клеток может быть определено путем измерения уровней экспрессии генов Рах-3 и Myf-5, которые ассоциированы с пролиферацией миогенных клеток, и уровней экспрессии гена MyoD, которая ассоциируется с дифференциацией мышц (например, Amthor et al., Dev Biol. 2002, 251:241-57). Известно, что GDF8 ингибирует экспрессию генов Рах-3 и Myf-5 и предупреждает экспрессию генов MyoD. Предполагается, что полипептиды ActRIIB или тестируемые соединения подавляют такую активность GDF8. Другой пример клеточных анализов включает измерение уровня пролиферации миобластов, таких как миобласты С(2)С(12) в присутствии полипептидов ActRIIB или тестируемых соединений (например, Thomas et al., J Biol Chem. 2000, 275:40235-43).
В настоящем изобретении также рассматриваются анализы in vivo, проводимые для измерения мышечной массы и силы. Так, например, в публикации Whittemore et al. (Biochem Biophys Res Commun. 2003, 300:965-71) описан метод измерения уровня увеличения массы скелетной мышцы и силы сокращения мышцы у мышей. Этот метод может быть использован, но необязательно, для определения терапевтического влияния тестируемых соединений (например, полипептидов ActRIIB) на мышечные заболевания и патологии, например, на такие состояния, которые ассоциируются с ограничением мышечной массы.
В некоторых своих аспектах настоящее изобретение относится к способам и агентам для модуляции (стимуляции или ингибирования) образования кости и увеличения массы кости. Поэтому любое идентифицированное соединение может быть протестировано в целых клетках или тканях in vitro или in vivo для подтверждения его способности модулировать рост костей или хрящей. Для этой цели могут быть применены различные методы, известные специалистам.
Так, например, влияние полипептидов ActRIIB или тестируемых соединений на рост костей или хряща может быть определено путем измерения уровня индуцирования Msx2 или дифференцировки преостеобластов (мезенхимных клеток) в остеобласты в клеточных анализах (см., например, Daluiski et al., Nat. Genet. 2001, 27(l):84-8; Hino et al., Front Biosci. 2004, 9:1520-9). Другим примером клеточных анализов является анализ остеогенной активности рассматриваемых полипептидов ActRIIB и тестируемых соединений в преостеобластах и остеобластах. Для иллюстрации следует отметить, что для инфицирования плюрипотентных мезенхимных преостеобластов С3Н10Т1/2, преостеобластов С2С12 и остеобластов ТЕ-85 были сконструированы рекомбинантные аденовирусы, экспрессирующие ActRIIB. Затем определяют остеогенную активность путем измерения уровня индуцирования щелочной фосфатазы, остеокаль-цина и минерализации матрикса (см., например, Cheng et al., J. bone Joint Surg. Am. 2003, 85-A(8): 154452).
В настоящем изобретении также рассматривается анализы in vivo, проводимые для измерения уровня роста костей или хряща. Так, например, в публикации Namkung-Matthai et al., Bone, 28:80-86 (2001) описаны крысы с моделью остеопороза, на которых проводили исследования по репарации кости через короткий период времени после перелома. В публикации Kubo et al., Steroid Biochemistry & Molecular Biology, 68:197-202 (1999) также описаны крысы с моделью остеопороза, на которых проводили исследования по репарации кости через более длительный период времени после перелома. Работы, в которых приводится описание крысиной модели для исследования перелома костей при остеопорозе, во всей своей полноте вводятся в настоящее описание посредством ссылки. В некоторых своих аспектах настоящее изобретение относится к анализам на срастание костей при переломах, известным специалистам. Такими анализами являются анализ, в котором провоцируют переломы, и гистологический и биохимический анализы, описанные, например, в патенте США № 6521750, который во всей своей полноте вводится в настоящее описание посредством ссылки и в котором описаны экспериментальные протоколы провоцирования переломов, а также измерения степени переломов и процессов их репарации.
В некоторых своих аспектах настоящее изобретение относится к способам и агентам для регуляции увеличения массы тела и ожирения. На клеточном уровне в развитии ожирения важную роль играет пролиферация и дифференцировка адипоцитов, что приводит к образованию дополнительных жировых клеток (адипоцитов). Поэтому любое идентифицированное соединение может быть протестировано в целых клетках или тканях in vitro или in vivo для подтверждения способности этих соединений модулировать адипогенез путем измерения уровня пролиферации или дифференцировки адипоцитов. Для этой цели могут быть применены различные методы, известные специалистам. Так, например, влияние полипептида ActRIIB (например, растворимого полипептида ActRIIB) или тестируемых соединений на адипогенез может быть определено путем измерения уровня дифференцировки преадипоцитов 3T3-L1 в зрелые ади-поциты в клеточных анализах, например путем наблюдения аккумуляции триацилглицерина в везикулах,
окрашенных масляным красным О, и выявления некоторых маркеров адипоцитов, таких как FABP (аР2/422) и PPARy2 (см., например, Reusch et al., 2000, Mol Cell Biol. 20:1008-20; Deng et al., 2000, Endocrinology. 141:2370-6; Bell et al., 2000, Obes Res. 8:249-54). Другим примером клеточных анализов является анализ роли полипептидов ActRIIB и тестируемых соединений в пролиферации адипоцитов или клеток-предшественников адипоцитов (например, клеток 3T3-L1), например, путем монитринга бромдезок-сиуридин (BrdU)-позитивных клеток (см., например, Pico et al., 1998, Mol. Cell. Biochem. 189:1-7; Masuno et al., 2003, Toxicol Sci. 75:314-20.
Следует отметить, что скрининг-анализы согласно изобретению применяются не только для рассматриваемых полипептидов ActRIIB и вариантов полипептидов ActRIIB, но также и для любых тестируемых соединений, включая агонисты и антагонисты полипептидов ActRIIB. Кроме того, эти скрининг-анализы могут быть проведены для подтверждения эффективности нужных лекарственных средств и для контроля их качества.
6. Репрезентативное терапевтическое применение.
В некоторых вариантах изобретения композиции (например, полипептидов ActRIIB) согласно изобретению могут быть использованы для лечения или предупреждения заболевания или состояния, которые ассоциируются с аномальной активностью полипептида ActRIIB и/или лиганда ActRIIB (например, GDF8). Такие заболевания, расстройства или состояния называются здесь общим термином "ActRIIB-ассоциированные состояния". В некоторых своих вариантах настоящее изобретение относится к способам лечения или предупреждения заболевания у индивидуума, нуждающегося в этом, путем введения указанному индивидууму терапевтически эффективного количества полипептида ActRIIB, описанного выше. Такие способы являются особенно подходящими для терапевтического или профилактического лечения животных, а более предпочтительно человека.
Используемый здесь термин "терапевтическое соединение", которое "предупреждает" развитие расстройства или состояния, означает соединение, которое в статистическом образце подавляет развитие расстройства или состояния в обработанном образце по сравнению с необработанным контрольным образцом или замедляет начало развития или ослабляет тяжесть одного или нескольких симптомов такого расстройства или состояния по сравнению с необработанным контрольным образцом. Используемый здесь термин "лечение" включает профилактику указанного состояния, ослабление или предотвращение его развития после диагностики такого состояния.
Комплексы ActRIIB/лиганд ActRIIB играют важную роль в росте ткани, а также на ранних процессах развития, таких как регуляция образования различных структур, или в одной или нескольких постэволюционных функциях, включая развитие половой функции, продуцирование гормонов гипофиза и образование костей и хряща. Таким образом, ActRIIB-ассоциированными состояниями являются аномальный рост ткани и дефекты развития. Кроме того, ActRIIB-ассоциированными состояниями являются, но не ограничиваются ими, состояния, ассоциированные с нарушением роста и дифференцировки клеток, такие как воспаление, аллергия, аутоиммунные заболевания, инфекционные заболевания и опухоли.
Репрезентативными ActRIIB-ассоциированными состояниями являются нейромышечные расстройства (например, мышечная дистрофия и атрофия мышц), хроническая обструктивная болезнь легких (и гипотрофия мышц, ассоциированная с ХОБЛ), синдром гипотрофии мышц, саркопения, кахексия, расстройства, ассоциированные с отложением жира в ткани (например, ожирение), диабет типа 2 и дегенеративное заболевание кости (например, остеопороз). Другими репрезентативными ActRIIB-ассоциированными состояниями являются мышечно-дегенеративные и нейромышечные расстройства, репарация ткани (например, при заживлении ран), нейродегенеративные заболевания (например, амио-трофический боковой склероз), иммунные расстройства (например, расстройства, ассоциированные с аномальной пролиферацией или функцией лимфоцитов), и ожирение или расстройства, ассоциированные с аномальной пролиферацией адипоцитов.
В некоторых вариантах изобретения композиции (например, растворимых полипептидов ActRIIB) согласно изобретению используются для лечения мышечной дистрофии. Термин "мышечная дистрофия" означает группу дегенеративных мышечных заболеваний, характеризующихся постепенным ослаблением и разрушением скелетных мышц, а иногда мышц сердца и дыхательных путей. Мышечные дистрофии представляют собой генетические заболевания, характеризующиеся прогрессирующей гипотрофией мышц и слабостью мышц, которые начинаются с микроскопических изменений в мышцах. По мере ослабления мышц в течение определенного периода времени мышечная сила у человека снижается. Репрезентативными мышечными дистрофиями, которые могут быть подвергнуты лечению по схеме, предусматривающей использование рассматриваемых полипептидов ActRIIB, являются мышечная дистрофия Дюшенна (МДД), мышечная дистрофия Беккера (МДБ), мышечная дистрофия Эмери-Дрейфуса (МДЭД), мышечная дистрофия тазового и плечевого поясов (МДТПП), плече-лопаточно-лицевая мышечная дистрофия (ППЛ или ППЛД) (также известная как болезнь Ландузи-Дежерина), миотоническая дистрофия (МТД) (также известная как болезнь Штейнерта), мышечная дистрофия глаза и носоглотки (МДГН), дис-тальная мышечная дистрофия (ДМД) и наследственная мышечная дистрофия (НМД).
Мышечная дистрофия Дюшенна (МДД) впервые была описана французским неврологом Гийомом Бенджамин Аманд Дюшенном в 1860-х годах. Мышечная дистрофия Беккера (МДБ) была названа по
имени немецкого врача Петера Эмиля Беккера, который впервые описал этот тип МДД в 1950-х годах. МДД является одной из наиболее часто встречающихся наследственных заболеваний у мужчин, которой страдает один из 3500 мужчин. МДД развивается в случае разрушения гена дистрофина, локализованного на коротком плече хромасомы X. Поскольку у мужчин имеется только одна копия хромосомы X, то у них присутствует только одна копия гена дистрофина. В отсутствие белка дистрофина мышца легко разрушается при прохождении циклов сокращения и релаксации. Хотя на ранней стадии заболевания мышца компенсируется посредством регенерации, однако на более поздних стадиях мышечные клетки-предшественники больше не могут претерпевать имеющееся повреждение, в результате чего здоровая мышца заменяется нефункциональной фиброжировой тканью.
МДБ возникает в результате различных мутаций в гене дистрофина. У пациентов с МДБ присутствует некоторое количество дистрофина, но либо это количество является недостаточным, либо этот дис-трофин имеет недостаточную функцию. При этом следует принять во внимание тот факт, что определенное количество дистрофина так же сильно или быстро защищает мышцы пациентов с МДБ от дегенерации, как и мышцы людей с МДД.
Так, например, недавно проведенные исследования продемонстрировали, что блокирование или элиминация функции GDF8 (лиганда ActRIIB) in vivo может способствовать эффективному лечению, по меньшей мере, некоторых симптомов у пациентов с МДД и МДБ. Таким образом, рассматриваемые полипептиды ActRIIB могут действовать как ингибиторы GDF8 (антагонисты) и являются альтернативными средствами, блокирующими функции GDF8 и/или ActRIIB in vivo у пациентов с МДД и с МДБ. Этот результат подтверждается и подкрепляется представленными здесь данными, при этом было показано, что белок ActRIIB-Fc способствует увеличению мышечной массы у мышей с моделью мышечной дистрофии.
Аналогичным образом, рассматриваемые полипептиды ActRIIB представляют собой эффективные средства, увеличивающие мышечную массу при других патологических состояниях, при которых необходимо такое увеличение. Так, например, АБС, также называемый болезнью Луи Герига (заболевание двигательных нейронов), представляет собой хроническое неизлечимое и прогрессирующее расстройство ЦНС, которое поражает двигательные нейроны, то есть компоненты ЦНС, которые соединяют головной мозг со скелетными мышцами. При АБС двигательные нейроны повреждаются и в конечном счете погибают, и хотя головной мозг человека обычно полностью сохраняет свои функции и находится в возбужденном состоянии, однако сигнал, подаваемый мышцам на сокращение, никогда не достигает цели. Большинство людей страдает АБС в возрасте от 40 до 70 лет. Сначала ослабляются те двигательные нейроны, которые воздействуют на руки или ноги. У пациентов с АБС может наблюдаться затрудненная походка, они могут ронять вещи, падать, иметь запинающуюся речь и могут предаваться неконтролируемому смеху или плачу. В конечном счете мышцы конечностей начинают атрофироваться от бездействия. Такая мышечная слабость подрывает силы человека, и он может нуждаться в инвалидной коляске либо он становится вообще неспособным вставать с постели. Большинство пациентов с АБС умирает через 3-5 лет после начала заболевания от недостаточности дыхательных путей или от осложнений, возникающих в результате искусственной вентиляции легких, подобно той, которую обычно проводят при пневмонии. Эти результаты подтверждаются и подкрепляются представленными здесь данными, при этом было показано, что белок ActRIIB-Fc вызывает заметное увеличение мышечной массы и повышает продолжительность жизни у мышей с моделью АБС.
Увеличение мышечной массы, индуцированное полипептидом ActRIIB, может также давать положительный эффект при лечении пациентов, страдающих заболеваниями, ассоциированными с гипотрофией мышц. В публикации Gonzalez-Cadavid et al. (см. выше) сообщалось, что экспрессия GDF8 обратно пропорционально коррелирует с безжировой массой у человека, и что повышенная экспрессия гена GDF8 ассоциируется с потерей массы у мужчин, страдающих СПИДом с синдромом истощения. В результате ингибирования функции GDF8 у пациентов со СПИДом, по меньшей мере, некоторые симптомы СПИДа могут ослабляться, а могут и вообще исчезнуть, что позволяет значительно повысить качество жизни пациентов со СПИДом.
Поскольку потеря функции GDF8 (лиганда ActRIIB) также ассоциируется с потерей жира без снижения уровня поглощения питательных веществ (Zimmers et al., см. выше; McPherron и Lee, см. выше), то рассматриваемые полипептиды ActRIIB могут быть также использованы в качестве терапевтических средств для замедления или предупреждения развития ожирения и диабета типа II. Эти результаты подтверждаются и подкрепляются представленными здесь данными, при этом было показано, что белок Ac-tRIIB-Fc улучшает метаблический статус у мышей с ожирением.
Синдром анорексии-кахексии при раке является одним из наиболее неблагоприятных и опасных для жизни факторов при раке. Прогрессирующее снижение массы тела в случае синдрома анорексии-кахексии при раке является основным отличительным признаком рака многих типов и приводит не только к ухудшению качества жизни и к неэффективному ответу на химиотерапию, но также и к уменьшению продолжительности жизни по сравнению с пациентами, у которых имеются такие же опухоли, но не наблюдается потеря массы тела. Кахексия, ассоциированная с анорексией, потерей жировой и мышечной ткани, психическим расстройством и снижением качества жизни, является результатом сложного взаи
модействия раковой опухоли с организмом хозяина. Это заболевание является одной из наиболее распространенных причин смертности пациентов, страдающих раком, которая составляет 80%. Данное заболевание представляет собой комплексное нарушение метаболизма белков, углеводов и жиров. Опухоли непосредственно и косвенно приводят к развитию патологий, которые, в свою очередь, вызывают анорексию и потерю массы. В настоящее время не существует какого-либо способа регуляции или предотвращения процессов развития опухолей. Синдром анорексии-кахексии при раке влияет на продуцирование цитокинов и на высвобождение липидмобилизующих и протеолизиндуцирующих факторов и приводит к изменению промежуточного метаболизма. Хотя анорексия является широко распространенным расстройством, однако лишь одно снижение потребления пищи не способно изменить состав веществ в организме, наблюдаемый у пациентов, страдающих раком, а увеличение потребления пищи может привести к реверсии синдрома истощения. Если у пациентов, страдающих раком, в течение шести месяцев наблюдается беспричинная потеря массы, составляющая более чем 5% от преклинической массы, то таких пациентов следует отнести к индивидуумам с подозрением на рак.
Поскольку было обнаружено, что у взрослых мышей системная сверхэкспрессия GDF8 индуцирует значительную потерю мышечной и жировой ткани, аналогичную потери, наблюдаемой у человека с синдромами кахексии (Zimmers et al., см. выше), то рассматриваемые полипептиды ActRIIB, полученные в виде фармацевтических композиций, могут быть с успехом использованы для предупреждения, лечения или ослабления симптомов, наблюдаемых при синдроме кахексии, в том случае, где желательным является рост мышечной ткани.
В других своих вариантах настоящее изобретение относится к способам индуцирования образования костей и/или хряща, предупреждения потери костной ткани, повышения уровня минерализации кости или предупреждения деминерализации кости. Так, например, рассматриваемые полипептиды ActRIIB и соединения, идентифицированные в настоящем изобретении, могут быть применены для лечения ос-теопороза и сращения костей при переломах и устранения дефектов хряща у человека и других животных. Полипептиды ActRIIB могут быть использованы для лечения пациентов, у которых субклинически была диагностирована низкая плотность кости, в качестве профилактической меры против развития ос-теопороза.
В одном из конкретных вариантов изобретения способы и композиции согласно изобретению могут быть применены в терапии для сращивания костей при переломах и для устранения дефектов хряща у человека и животных. Рассматриваемые способы и композиции могут также иметь профилактическое применение для сращивания костей при закрытых и открытых переломах, а также для улучшения фиксации искусственных суставов. Образование костей de novo, индуцированное остеогенным агентом, способствует заживлению врожденных, вызванных травмами или онкологическими операциями черепно-лицевых дефектов, а также может оказаться эффективным для применения в косметической пластической хирургии. Кроме того, способы и композиции согласно изобретению могут быть использованы для лечения периодонтоза, а также в других стоматологических операциях. В некоторых случаях рассматриваемые полипептиды ActRIIB могут обеспечивать условия для миграции остеогенных клеток в данный участок, для стимуляции роста остеогенных клеток или для индуцирования дифференцировки предшественников остеогенных клеток. Полипептиды ActRIIB согласно изобретению могут быть также использованы для лечения остеопороза. Кроме того, полипептиды ActRIIB могут быть использованы для устранения дефектов хряща и предупреждения/лечения остеоартрита.
В другом своем конкретном варианте настоящее изобретение относится к терапевтическому способу и к композиции для сращивания переломов и для лечения других состояний, ассоциированных с дефектами хряща и/или костей, или периодонтоза. Настоящее изобретение также относится к терапевтическим способам и композициям для заживления ран и репарации ткани. Типами ран являются, но не ограничиваются ими, ожоги, порезы и язвы (см., например, публикацию РСТ № WO 84/01106). Такие композиции включают терапевтически эффективное количество по меньшей мере одного из полипептидов Ac-tRIIB согласно изобретению в смеси с фармацевтически приемлемыми наполнителями, носителями или матрицами.
В другом конкретном варианте изобретения указанные способы и композиции согласно изобретению могут быть применены для лечения состояний, вызывающих потерю костной ткани, таких как ос-теопороз; гиперпаратиреоидит; болезнь Кушинга; тиротоксикоз; хроническая диарея или малабсорбция; ацидоз почечных канальцев или нервная анорексия. Многим людям известно, что женщин, которые имеют низкий вес и ведут сидячий образ жизни, можно отнести к группе с фактором риска развития ос-теопороза (потери минеральной плотности кости, которая увеличивает риск перелома). Однако остеопо-роз может быть также результатом длительного употребления некоторых лекарственных препаратов. Остеопороз, возникающий в результате употребления лекарственных средств или индуцированный другими патологическими состояниями, известен как вторичный остеопороз. При состоянии, известном как болезнь Кушинга, избыточное количество кортизола, продуцируемое организмом, приводит к развитию остеопороза и к переломам. Наиболее распространенными лекарственными препаратами, ассоциированными с развитием вторичного остеопороза, являются кортикостероиды, то есть класс лекарственных средств, которые действуют как кортизол, то есть гормон, обычно продуцируемый надпочечниками. Хо
тя для развития скелета необходимы адекватные уровни тиреотропных гормонов (которые продуцируются щитовидной железой), однако избыток тиреотропных гормонов может приводить к снижению костной массы в течение определенного периода времени. Антациды, содержащие алюминий, при их употреблении в высоких дозах пациентами с почечными заболеваниями, в частности пациентами, подвергаемыми диализу, могут вызывать потерю костной ткани. Другими лекарственными препаратами, которые могут вызывать вторичный остеопороз, являются фенитоин (дилантин) и барбитураты, которые используются для предупреждения эпилептических припадков; метотрексат (Rheumatrex, Immunex, Folex PFS), то есть лекарственное средство, применяемое для лечения некоторых форм артрита, рака и иммунных расстройств; циклоспорин (Sandimmune, Neoral), то есть лекарственное средство, применяемое для лечения некоторых аутоиммунных заболеваний и для подавления иммунной системы у пациентов с трансплантированными органами; агонисты лютеинизирующего рилизинг-фактора (Lupron, Zoladex), применяемые для лечения рака предстательной железы и эндометриоза; гепарин (кальципарин, Liquaemin), то есть препарат, препятствующий свертыванию крови; и холестирамин (Questran) и колестипол (Colestid), применяемые для снижения высокого уровня холестерина. Потеря костной ткани вызывается также заболеваниями десен, поскольку болезнетворные бактерии, присутствующие в ротовой полости, провоцируют организм на вырабатывание защиты против таких бактерий. Эти бактерии продуцируют токсины и ферменты под линией десны, что приводит к развитию хронических инфекций.
В другом своем варианте настоящее изобретение относится к способам и терапевтическим средствам, применяемым для лечения заболеваний или расстройств, ассоциированных с аномальным или нежелательным ростом кости. Так, например, у пациентов, страдающих заболеванием, известным как прогрессирующая оссифицирующая фибродисплазия (ПОФ), наблюдается аномальный рост "второго скелета", который затрудняет любое движение. Кроме того, аномальный рост костей может наблюдаться после заместительной хирургии на бедрах, что приводит к ухудшению результата хирургической операции. Этот факт является наиболее типичным примером патологического роста костей и ситуации, при которой рассматриваемые способы и композиции могут давать терапевтический эффект. Те же самые способы и композиции могут быть также применены для лечения других форм аномального роста кости (например, патологического роста кости после травм, ожогов или поражения спинного мозга) и для лечения или предупреждения нежелательных состояний, ассоциированных с аномальным ростом кости, наблюдаемым в комбинации с метастазирующим раком предстательной железы или остеосаркомой. Примерами таких терапевтических средств являются, но не ограничиваются ими, полипептиды ActRIIB, которые ингибируют функцию лиганда ActRIIB (например, ВМР7), соединения, которые нарушают взаимодействие между ActRIIB и его лигандом (например, ВМР7), и антитела, которые специфически связываются с рецептором ActRIIB, в результате чего лиганд ActRIIB (например, ВМР7) не может связываться с рецептором ActRIIB.
В других своих вариантах настоящее изобретение относится к композициям и к способам регуляции содержания жира в организме у животного и для лечения или предупреждения состояний, в частности опасных для жизни состояний, ассоциированных с содержанием жира в организме. В соответствии с настоящим изобретением термин "регуляция (контролирование) массы тела" может означать снижение или увеличение массы тела, либо снижение или увеличение скорости набора веса, либо увеличение или снижение скорости потери веса, и этот термин также включает активное поддержание массы тела или предотвращение значительного ее изменения (например, предотвращение внешних или внутренних воздействий, которые могут каким-либо образом повышать или снижать массу тела). В одном из своих вариантов настоящее изобретение относится к регуляции массы тела путем введения животному (например, человеку), нуждающемуся в этом, полипептида ActRIIB.
В одном из своих конкретных вариантов настоящее изобретение относится к способам и соединениям, применяемым для снижения массы тела и/или уменьшения прироста массы тела у животного, а более конкретно, для лечения или уменьшения степени ожирения у пациентов с риском развития ожирения или у пациентов, страдающих ожирением. В другом своем конкретном варианте настоящее изобретение относится к способам и соединениям для лечения животного, у которого отсутствует способность к набору или сохранению веса (например, у животного с синдромом истощения). Такие способы являются эффективными для увеличения веса и/или массы тела, или для снижения потери веса и/или массы, или для улучшения состояний, ассоциированных с нежелательно низким весом и/или массой тела или вызываемых таким нежелательно низким весом и/или массой тела (например, у больных).
Другие расстройства, включая высокий уровень холестерина, которые могут быть подвергнуты лечению с использованием белков ActRIIB, описаны в примерах.
7. Фармацевтические композиции.
В некоторых вариантах изобретения соединения (например, полипептиды ActRIIB) согласно изобретению приготавливают вместе с фармацевтически приемлемым носителем. Так, например, полипептид ActRIIB может быть введен отдельно или как компонент фармацевтической композиции (терапевтической композиции). Рассматриваемые композиции могут быть приготовлены для введения в любой форме, подходящей для ее применения в медицине или ветеринарии.
В некоторых вариантах изобретения терапевтический способ согласно изобретению включает вве
дение композиции местно, системно или в определенный участок в виде имплантата или медицинского приспособления. Терапевтическую композицию, вводимую в соответствии с настоящим изобретением, обычно приготавливают в апирогенной физиологически приемлемой форме. Кроме того, указанная композиция может быть, если это необходимо, инкапсулирована или инъецирована в вязкой форме для доставки в нужный участок ткани (например, в кость, хрящ, мышцу, жировую ткань или в нервную ткань), например в участок поражения ткани. Местное введение может быть подходящим для заживления ран и репарации ткани. Терапевтически эффективные средства, которые не являются полипептидами ActRIIB и которые могут быть также, но необязательно, включены в композицию, описанную выше, альтернативно или дополнительно могут быть введены одновременно или последовательно с рассматриваемыми соединениями (например, с полипептидами ActRIIB) в способах согласно изобретению.
В некоторых вариантах изобретения композиции согласно изобретению могут включать матрицу, способную доставлять одно или несколько терапевтических соединений (например, полипептидов Ac-tRIIB) в нужный участок ткани, и образовывать структуру, подходящую для развития ткани и обладающую оптимальной способностью ресорбироваться в организм. Так, например, такая матрица может обеспечивать пролонгированное высвобождение полипептидов ActRIIB. Такие матрицы могут быть изготовлены из материалов, которые в настоящее время используются в целях приготовления других имплантируемых медицинских препаратов.
Материал для изготовления матрицы выбирают с учетом биологической совместимости, биологической разлагаемости, механических свойств, внешнего вида и межфазных свойств. Соответствующий состав препарата определяется конкретной целью применения рассматриваемых композиций. Потенциальные матрицы для данных композиций могут быть биологически разлагаемыми, и такими матрицами могут быть химические вещества, такие как сульфат кальция, трифосфат кальция, гидроксиапатит, полимолочная кислота и полиангидриды. Другие потенциальные материалы являются биологически разлагаемыми и имеют хорошо определенные биологические свойства, и такими материалами являются костный или кожный коллаген. Другие матрицы состоят из чистых белков или компонентов внеклеточного матрикса. Другие потенциальные матрицы не являются биологически разлагаемыми и имеют определенные химические свойства, и такими матрицами являются спеченный гидроксиапатит, биостекло, алюминаты или другие керамические изделия. Матрицы могут состоять из комбинаций материалов любого из вышеупомянутых типов, таких как полимолочная кислота и гидроксиапатит или коллаген и трифосфат кальция. Биокерамические изделия в композиции, такой как алюминат-фосфат кальция, могут быть модифицированы и обработаны так, чтобы они имели измененные размер пор, размер частиц, форму частиц и биологическую разлагаемость.
В некоторых вариантах изобретения композиции согласно изобретению могут быть введены перо-рально, например в форме капсул, каше, драже, таблеток, лекарственных лепешек (приготовленных с использованием ароматизированной основы, обычно сахарозы и аравийской или трагакантовой камеди), порошков, гранул, или в виде раствора или суспензии в водной или безводной жидкости, или в виде жидкой эмульсии "масло в воде" или "вода в масле", или в виде эликсира или сиропа, или пастилок (приготовленных с использованием инертной основы, такой как желатин и глицерин, или сахароза и аравийская камедь), и/или в виде растворов для полоскания рта и т.п., содержащих предварительно определенное количество агента, используемого в качестве активного ингредиента. Агент может быть также введен в виде болюса, лекарственной кашки или пасты.
В твердых лекарственных формах для перорального введения (капсулах, таблетках, пилюлях, драже, порошках, гранулах и т.п.) одно или несколько терапевтических соединений согласно изобретению могут быть смешаны с одним или несколькими фармацевтически приемлемыми носителями, такими как цитрат натрия или дифосфат кальция, и/или с любым из нижеследующих компонентов, таких как (1) наполнители или агенты, придающие объем, такие как крахмалы, лактоза, сахароза, глюкоза, маннит и/или кремниевая кислота; (2) связующие вещества, такие как, например, карбоксиметилцеллюлоза, альгинаты, желатин, поливинилпирролидон, сахароза и/или аравийская камедь; (3) увлажнители, такие как глицерин; (4) дезинтегрирующие агенты, такие как агар-агар, карбонат кальция, картофельный крахмал или крахмал тапиоки, альгиновая кислота, некоторые силикаты и карбонат натрия; (5) агенты, замедляющие растворение, такие как парафин; (6) ускорители абсорбции, такие как соединения четвертичного аммония; (7) смачивающие агенты, такие как, например, цетиловый спирт и моностеарат глицерина; (8) абсорбенты, такие как каолин и бентонитовая глина; (9) замасливатели, такие как тальк, стеарат кальция, стеарат магния, твердые полиэтиленгликоли, лаурилсульфат натрия и их смеси, и (10) красители. В случае капсул, таблеток и драже фармацевтические композиции могут также содержать забуферивающие агенты. Твердые композиции аналогичного типа могут быть также использованы в качестве наполнителей в мягких и твердых желатиновых капсулах, приготовленных с использованием таких наполнителей, как лактоза или молочные сахара, а также высокомолекулярные полиэтиленгликоли и т. п.
Жидкими лекарственными формами для перорального введения являются фармацевтически приемлемые эмульсии, микроэмульсии, растворы, суспензии, сиропы и эликсиры. Жидкие лекарственные формы, помимо активного ингредиента, могут содержать инертные разбавители, обычно используемые специалистами, такие как вода или другие растворители, солюбилизирующие агенты и эмульгаторы, та
кие как этиловый спирт, изопропиловый спирт, этилкарбонат, этилацетат, бензиловый спирт, бензилбен-зоат, пропиленгликоль, 1,3-бутиленгликоль, масла (в частности, масло из семян хлопчатника, арахисовое масло, кукурузное масло, масло из зародышевых семян, оливковое масло, касторовое масло и кунжутное масло), глицерин, тетрагидрофуриловый спирт, полиэтиленгликоли и сложные эфиры жирной кислоты и сорбитана и их смеси. Композиции для перорального введения, помимо инертных разбавителей, могут также включать адъюванты, такие как смачивающие агенты, эмульгирующие и суспендирующие агенты, подсластители, ароматизаторы, красители, отдушки и консерванты.
Суспензии, помимо активных соединений, могут содержать суспендирующие агенты, такие как этоксилированные изостеариловые спирты, полиоксиэтиленсорбит и сложные эфиры сорбитана, микрокристаллическая целлюлоза, метагидроксид алюминия, бентонит, агар-агар и трагакантовая камедь и их смеси.
Некоторые описанные здесь композиции могут быть введены местно, либо нанесены на кожу, либо на слизистую оболочку. Композиции для местного применения могут также включать один или несколько агентов широкого ряда, которые, как известно, являются эффективными при их использовании в качестве усилителей пенетрации через кожу или роговой слой. Примерами таких агентов являются 2-пирролидон, ^метил-2-пирролидон, диметилацетамид, диметилформамид, пропиленгликоль, метиловый или изопропиловый спирт, диметилсульфоксид и азон. Для приготовления приятного на вид препарата в него могут быть также включены и другие агенты. Примерами таких агентов являются жиры, воски, масла, красители, ароматизаторы, консерванты, стабилизаторы и поверхностно-активные вещества. В данную композицию могут быть также включены кератолитические агенты, известные специалистам. Примерами являются салициловая кислота и сера.
Лекарственными формами для местного или чрескожного введения являются порошки, спреи, мази, пасты, кремы, лосьоны, гели, растворы, пластыри и ингаляторы. Активное соединение может быть смешано в стерильных условиях с фармацевтически приемлемым носителем и, при необходимости, с консервантами, буферами или пропеллентами. Мази, пасты, кремы и гели, помимо рассматриваемого соединения согласно изобретению (например, полипептида ActRIIB), могут содержать наполнители, такие как животные и растительные жиры, масла, воски, парафины, крахмал, трагакантовая камедь, производные целлюлозы, полиэтиленгликоли, силиконы, бентониты, кремниевая кислота, тальк и оксид цинка или их смеси.
Порошки и спреи, помимо рассматриваемого соединения, могут содержать наполнители, такие как лактоза, тальк, кремниевая кислота, гидроксид алюминия, силикаты кальция и полиамидный порошок или смеси этих веществ. Спреи могут также содержать специально приготовленные пропелленты, такие как хлорфторуглеводороды, и летучие незамещенные углеводороды, такие как бутан и пропан.
В некоторых вариантах изобретения фармацевтические композиции, подходящие для парентерального введения, могут содержать один или несколько полипептидов ActRIIB в комбинации с одним или несколькими фармацевтически приемлемыми стерильными изотоническими водными или безводными растворами, дисперсиями, суспензиями или эмульсиями или стерильными порошками, которые непосредственно перед их применением могут быть разведены с получением стерильных растворов или дисперсий для инъекций и которые могут содержать антиоксиданты, буферы, бактериостаты, растворенные вещества, которые сообщают данному препарату изотоничность с кровью данного реципиента, или суспендирующие агенты или загустители. Примерами подходящих водных и безводных носителей, которые могут быть использованы в фармацевтических композициях согласно изобретению, являются вода, этанол, полиолы (такие как глицерин, пропиленгликоль, полиэтиленгликоль и т. п.) и их подходящие смеси; растительные масла, такие как оливковое масло, и органические сложные эфиры для инъекций, такие как этилолеат. Соответствующая текучесть может поддерживаться, например, с использованием материалов для покрытий, таких как лецитин, путем сохранения нужного размера частиц в случае дисперсий и с использованием поверхностно-активных веществ.
Композиции согласно изобретению могут также содержать адъюванты, такие как консерванты, смачивающие агенты, эмульгаторы и диспергирующие агенты. Предотвращение действия микроорганизмов может быть достигнуто путем включения различных антибактериальных и противогрибковых средств, например парабена, хлорбутанола, фенолсорбиновой кислоты и т. п. В данные композиции могут быть также включены изотонические агенты, такие как сахара, хлорид натрия и т. п. Кроме того, пролонгированная абсорбция фармацевтической формы для инъекции может быть достигнута путем включения агентов, замедляющих абсорбцию, таких как моностеарат алюминия и желатин.
Следует отметить, что схема введения доз может быть определена лечащим врачом с учетом различных факторов, которые изменяют действие рассматриваемых соединений согласно изобретению (например, полипептидов ActRIIB). Различные факторы зависят от типа заболевания, подвергаемого лечению. В случае мышечных заболеваний такими факторами могут быть, но не ограничиваются ими, желаемое количество образуемой мышечной массы, мышцы, наиболее подверженные действию данного заболевания, условия, приводящие к ослаблению мышц, возраст, пол и режим питания пациента, время введения и другие клинические факторы. Доза может также определена с учетом добавления в конечную композицию других известных факторов роста. Мониторинг благоприятного эффекта лечения может
быть проведен путем периодической оценки роста и/или репарации мышц, например путем измерения мышечной силы, оценки размера мышц с помощью МРИ и анализа мышц с помощью биопсии.
В некоторых вариантах изобретения один или несколько полипептидов ActRIIB могут быть введены вместе (одновременно) или через различные периоды времени (последовательно или с перекрыванием). Кроме того, полипептиды ActRIIB могут быть введены вместе с терапевтическими средствами других типов, например с агентом, индуцирующим рост хряща, с агентом, индуцирующим рост кости, с агентом, индуцирующим рост мышц, с агентом, снижающим уровень жира, или с агентом, индуцирующим рост нейронов. Соединения двух типов могут быть введены одновременно или через различные периоды времени. Предполагается, что полипептиды ActRIIB согласно изобретению могут действовать в сочетании с другим терапевтическим средством либо, вероятно, они могут действовать синергически.
В конкретном примере изобретения описаны различные остеогенные факторы, факторы, индуцирующие рост хряща, и факторы, индуцирующие рост кости, в частности бисфосфонаты (см., например, европейские патентные заявки №№ 148155 и 169016). Так, например, другими факторами, которые могут быть объединены с рассматриваемыми полипептидами ActRIIB, являются различные факторы роста, такие как эпидермальный фактор роста (EGF), тромбоцитарный фактор роста (PDGF), трансформирующие факторы роста (TGF-a и TGF-P) и инсулиноподобный фактор роста (IGF).
В некоторых своих вариантах настоящее изобретение также относится к генотерапии для продуцирования полипептидов ActRIIB in vivo. Такая терапия дает терапевтический эффект в результате введения полинуклеотидных последовательностей ActRIIB в клетки или ткани, пораженные заболеваниями, перечисленными выше. Доставка полинуклеотидных последовательностей ActRIIB может быть достигнута с использованием рекомбинантного экспрессионного вектора, такого как химерный вирус или коллоидальная дисперсионная система. Для терапевтической доставки полинуклеотидных последовательностей ActRIIB предпочтительно используются липосомы, доставляемые в нужный участок.
Различными вирусными векторами, которые могут быть использованы в генотерапии, описанной в настоящей заявке, являются векторы на основе аденовируса, вируса герпеса, вируса коровьей оспы или предпочтительно РНК-вируса, такого как ретровирус. Предпочтительным ретровирусным вектором является производное мышиного или птичьего ретровируса. Примерами ретровирусных векторов, в которые может быть встроен один чужеродный ген, являются, но не ограничиваются ими, векторы на основе вируса мышиного лейкоза Молони (MoMuLV), вируса мышиной саркомы Харви (HaMuSV), вируса мышиной опухоли молочной железы (MuMTV) и вируса саркомы Рауса (RSV). Ряд других ретровирусных векторов может включать множество генов. Все эти векторы могут переносить или включать ген селективного маркера так, что в результате этого могут быть идентифицированы и получены трансдуцирован-ные клетки. Ретровирусные векторы могут быть сделаны мишень-специфическим путем присоединения, например, сахара, гликолипида или белка. Такую доставку предпочтительно осуществляют с использованием антитела. Специалистам в данной области очевидно, что специфические полинуклеотидные последовательности могут быть встроены в геном ретровируса или присоединены к вирусной оболочке так, чтобы обеспечивалась специфическая доставка ретровирусного вектора, содержащего полинуклеотид ActRIIB, в нужную мишень. В одном из предпочтительных вариантов изобретения вектор доставляют в клетки/ткани кости, хряща, мышц или нейронов.
Альтернативно, клетки тканевой культуры могут быть непосредственно трансфицированы плазми-дами, кодирующими ретровирусные структурные гены gag, pol и env, стандартными методами трансфек-ции фосфатом кальция. Затем эти клетки трансфицируют плазмидным вектором, содержащим представляющие интерес гены. Полученные клетки высвобождают ретровирусный вектор в культуральную среду.
Другой системой целевой доставки полинуклеотидов ActRIIB является коллоидальная дисперсионная система. Коллоидальными дисперсионными системами являются макромолекулярные комплексы, нанокапсулы, микросферы, сферы и липидные системы, включая эмульсии типа "масло в воде", мицеллы, смешанные мицеллы и липосомы. Предпочтительной коллоидальной системой согласно изобретению является липосома. Липосомы представляют собой искусственные мембранные везикулы, которые могут быть использованы в качестве носителей для доставки in vitro и in vivo. РНК, ДНК и интактные вирионы могут быть инкапсулированы во внутреннюю водную среду и доставлены в клетки в биологически активной форме (см., например, Fraley, et al., Trends Biochem. Sci., 6:77, 1981). Методы эффективного переноса генов с использованием липосомы в качестве носителя известны специалистам (см., например, Mannino, et al., Biotechniques, 6:682, 1988). В состав липосом обычно входит комбинация фосфо-липидов в основном вместе со стероидами, в частности с холестерином. Могут быть также использованы и другие фосфолипиды или липиды. Физические свойства липосом зависят от рН, ионной силы и присутствия двухвалентных катионов.
Примерами липидов, которые могут быть использованы для получения липосом, являются фосфа-тидильные соединения, такие как фосфатидилглицерин, фосфатидилхолин, фосфатидилсерин, фосфати-дилэтаноламин, сфинголипиды, цереброзиды и ганглиозиды. Репрезентативными фосфолипидами являются яичный фосфатидилхолин, дипальмитоилфосфатидилхолин и дистеароилфосфатидилхолин. Доставка липосом может быть также осуществлена на основе, например, специфичности к органу, к клетке и органелле, и такая доставка известна специалистам в данной области.
Примеры.
В общих чертах, настоящее изобретение будет более очевидным исходя из описанных ниже примеров, которые приводятся лишь в целях иллюстрации некоторых вариантов и аспектов настоящего изобретения и не должны рассматриваться как ограничение объема изобретения.
Пример 1. Получение слитого белка ActRIIB-Fc.
Заявителями был сконструирован растворимый слитый белок ActRIIB, который имеет внеклеточный домен человеческого ActRIIB, присоединенный к человеческому или мышиному Fc-домену посредством расположенного между ними линкера минимального размера (из трех аминокислот глицинов). Полученные конструкции обозначены ActRIIB-hFc и ActRIIB-mFc соответственно.
ActRIIB-hFc представлен ниже как белок, выделенный из клеточных линий СНО (SEQ ID N0:5)
GRGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGC
WLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEAGGPEVTYEPPPTAPTG
GGTHTCPPCPAPELLGGPSVFLFPPKPKDTLHISRTPEVTCVVVDVSHEDPEVKFMWYV
DGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLHGKEYKCKVSNKALPVPIEKTIS
KAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENHYKTTPP
VLDSDGSFFLYSKLTVDKSRWQQGKVF5CSVMHEALHNHYTQKSLSL5PGK
Белки ActRIIB-hFc и ActRIIB-mFc были экспрессированы в клеточных линиях СНО. Рассматривались три различных лидерных последовательности
(i) Последовательность меллитина пчелиного меда (HBML):
MKFLVNVALVFMVVYISYIYA {SEQ ID N0:7)
(ii) Последовательность тканевого активатора плазминогена (ТРА): MDAMKRGLCCVLLLCGAVFVSP (SEQ ID N0:8)
(iii) Нативная последовательность: MGAAAKLAFAVFLISCSSGA (SEQ ID N0:9).
Выбранная форма имеет лидерную последовательность ТРА и нижеследующую непроцессирован-ную аминокислотную последовательность
Указанный
(SEQ ID NO:10):
MDAMKRGLCCVLLLCGAVFVSPGASGRGEAETRECIYYHANWELERTNQSGLERCEG EQDKRLHCYftSWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNF CNERFTHLPEAGGPEVTYEPPPTAPTGGGTHTCPPCPfiPELLGGPSVFLFPPKPKDTLMIS RTPEVTCVVVDVSHEDPEVKFHWYVDGVEVHWAKTKPREEQYNSTYRVVSVLTVLHQ DWLNGKEYKCKVSNKALPVPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVK GFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGMVFSCSVM HEALHMHYTQKSLSLSPGK
полипептид кодируется нижеследующей последовательностью нуклеиновой кислоты
A TGGATGCAAT GAAGAGAGGG CTCTGCTGTG TGCTGCTGCT GTGTGGAGCA QTCTTCGTTT CGCCCGGCGC CTCTGGGCGT GGGGAGGCTG AGACACGGGA GTGCATCTAC TACAACGCCA ACTGGGAGCT GGAGCGCACC AACCAGAGCG GCCTGGAGCG CTGCGAAGGC GAGCAGGACA AGCGGCTGCA CTGCTACGCC TCCTGGCGCA ACAGCTCTGG CACCATCGAG CTCGTGAAGA AGGGCTGCTG GCTAGATGAC TTCAACTGCT ACGATAGGCA GGAGTGTGTG GCCACTGAGG AGAACCCCCA GGTGTACTTC TGCTGCTGTG AAGGCAACTT CTGCAACGAG CGCTTCACTC ATTTGCCAGA GGCTGGGGGC CCGGAAGTCA CGTACGAGCC ACCCCCGACA GCCCCCACCG GTGGTGGAAC TCACACATGC CCACCGTGCC CAGCACCTGA ACTCCTGGGG GGACCGTCAG TCTTCCTCTT CCCCCCAAAA CCCAAGGACA CCCTCATGAT CTCCCGGACC CCTGAGGTCA CATGCGTGGT GGTGGACGTG AGCCACGAAG ACCCTGAGGT CAAGTTCAAC TGSTACGTGG ACGGCGTGGA GGTGCATAAT GCCAAGACAA AGCCGCGGGA GGAGCAGTAC AACAGCACGT ACCGTGTGGT CAGCGTCCTC ACCGTCCTGC ACCAGGACTG GCTGAATGGC AAGGAGTАСА AGTGCAAGGT CTCCAACAAA GCCCTCCCAG TCCCCATCGA GAAAACCATC TCCAAAGCCA AAGGGCAGCC CCGAGAACCA CAGGTGTACA CCCTGCCCCC ATCCCGGGAG GAGATGACCA AGAACCAGGT CAGCCTGACC TGCCTGGTCA AAGGCTTCTA TCCCAGCGAC ATCGCCGTGG AGTGGGAGAG CAATGGGCAG CCGGAGAACA ACTACAAGAC CACGCCTCCC GTGCTGGACT CCGACGGCTC СГТСТТССТС TATAGCAAGC TCACCGTGGA CAAGAGCAGG TGGCAGCAGG
GGAACGTCTT CTCATSCTCC GTGATGCATG AGGCTCTGCA CAACCACTAC ACGCAGAAGA GCCTCTCCCT GTCTCCGGGT AAATGA
N-концевое секвенирование вещества, продуцируемого клетками СНО, выявило основную последовательность - GRGEAE (SEQ ID NO:11). Примечательно то, что другие конструкции, описанные в литературе, начинаются с последовательности -SGR.
Очистка может быть проведена с помощью колоночной хроматографии в несколько стадий, включая, например, три или более стадий, осуществляемых в любом порядке, например, с помощью хроматографии на белке А, хроматографии на Q-сефарозе, хроматографии на фенилсефарозе, эксклюзионной хроматографии и катионообменной хроматографии. Очистка может быть завершена с помощью вирусной фильтрации и буферного обмена.
Слитые белки ActRIIB-Fc экспрессировали также в клетках HEK293 и в клетках COS. Хотя материал, выделенный из всех клеточных линий, культивированных в подходящих условиях, обеспечивал при
сутствие белка, обладающего активностью, направленной на формирование структуры мышц in vivo, однако при этом в его активности наблюдалась некоторая вариабельность, вероятно обусловленная условиями отбора и/или культивирования клеточных линий. Пример 2. Генерирование мутантов ActRIIB-Fc.
Заявителями была генерирована серия мутаций внеклеточного домена ActRIIB, и указанные му-тантные белки были продуцированы в виде растворимых слитых белков, образованных между внеклеточным ActRIIB и Fc-доменом. Контрольный гибрид ActRIIB-Fc имеет нижеследующую последовательность (Fc-область подчеркнута) (SEQ ID N0:12):
SGRGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKG
CWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEAGGPEVTYEPPPTAPT
GGGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWY
VDGVEVHMAKTKPREEQYNSTYRVVSVLTVLHQDWLMGKEYKCKVSNKALPVPIEKTl
PVLDSDGSFFLYSKLTVDKSRWQQGHVFSCSVMHEALHHHYTQKSLSLSPGK
В исходный ActRIIB-Fc-белок были введены различные мутации, включая N- и С-концевые усечения. На основании данных, представленных в примере 1, было высказано предположение, что эти конструкции, если они экспрессируются с лидерной последовательностью ТРА, не содержат N-концевого се-рина. Мутации были введены во внеклеточный домен ActRIIB с помощью ПЦР-мутагенеза. После проведения ПЦР фрагменты очищали на колонке Qiagen, гидролизовали ферментами SfoI и AgeI и подвергали гель-очистке. Полученные фрагменты лигировали в экспрессионный вектор pAID4 (см. WO 2006/012627) так, чтобы после лигирования образовывался химерный гибрид с человеческим IgG1. После трансформации в E.coli DHS-альфа колонии собирали и выделяли ДНК. В мышиных конструкциях (mFc) человеческий IgG1 заменяли мышиным IgG2a. Затем подтверждали последовательности всех мутантов.
Все мутанты продуцировали в клетках HEK293Т путем временной трансфекции. Вкратце, во вращающийся 500-мл сосуд высевали клетки HEK293Т при плотности 6х105 клеток/мл в среде Freestyle (In-vitrogen) в объеме 250 мл и культивировали в течение ночи. На следующий день эти клетки обрабатывали комплексом ДНК:ПЭИ (1:1) при конечной концентрации ДНК, составляющей 0,5 мкг/мл. Через 4 ч добавляли 250 мл среды,ии и клетки культивировали в течение 7 дней. Кондиционированную среду собирали путем центрифугирования клеток, а затем эту среду концентрировали.
Мутанты очищали различными методами, включая, например, очистку на колонке с белком А, которую элюировали глициновым буфером с низким рН (3,0). После нейтрализации мутанты диализовали против PBS.
Мутанты были также продуцированы в клетках СНО аналогичным методом.
Мутанты тестировали в анализах и/или в биоанализах на связывание, описанных ниже. В некоторых случаях анализы проводили с использованием кондиционированной среды, а не очищенных белков.
Пример 2. Биоанализ на передачу сигнала, опосредуемую GDF-11 и активином.
Анализ с использованием репортерного гена А-204 проводили для оценки влияния белков ActRIIB-Fc на передачу сигнала GDF-11 и активином А. Клеточная линия: человеческая рабдомиосаркома (образованная из мышечной ткани). Репортерный вектор: pGL3(CAGA)12 (описанный Dennler et al, 1998, EM-BO 17: 3091-3100.) См. фиг. 5. Мотив CAGA12 присутствует на TGF-бета-чувствительных генах (гене PAI-1), а поэтому такой вектор обычно применяется для передачи сигнала факторов под действием
Smad2 и 3.
День 1. Клетки А-204 распределяли по лункам 48-луночного планшета.
День 2. Клетки А-204 трансфицировали 10 мкг pGL3(CAGA)12 или pGL3(CAGA)12(10 мкг)+pRLCMV (1 мкг) и реагентом Fugene.
День 3. Добавляли факторы (разведенные в среде+0,1% BSA). Ингибиторы перед их добавлением в клетки должны быть предварительно инкубированы с факторами в течение 1 ч. Через 6 ч клетки промывали PBS и подвергали лизису.
После этого проводили анализ с использованием люциферазы. В отсутствие любых ингибиторов активин А способствует 10-кратной стимуляции экспрессии репортерного гена с ED50 ~2 нг/мл. GDF-11: 16-кратная стимуляция, ED50 ~1,5 нг/мл.
В этом анализе ActRIIB (R64, 20-134) представляет собой сильный ингибитор активности активина, GDF-8 и GDF-11. В этом анализе также были протестированы варианты.
Пример 3. Ингибирование GDF-11 с N- и С-концевыми усечениями.
Был получен белок ActRIIB-Fc (R64, 20-134), в котором ActRIIB-часть имела N- и С-концевые усечения, и этот белок тестировали на активность в качестве ингибиторов GDF-11 и активина. Активности представлены ниже (измеренные в кондиционированных средах).
С-концевые усечения ActRIIB-hFc
SKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTP
ICso (нг/мл)
GDF-11
Активин
ActRIIb-hFc (R64, 20-134)
ActRIIb-hFc (R64, 20-132)
ActRIIb-hFc (R64, 20-131)
120
ActRIIb-hFc (R64, 20-128)
130
158
Следует отметить, что усечения в три аминокислоты (заканчивающиеся ...РРТ), шесть аминокислот (заканчивающихся ...YEP) или более аминокислот у С-конца приводят к трехкратному или к еще более значительному снижению активности данной молекулы. Усечение 15 конечных аминокислот в ActRIIB-части приводит к значительной потере активности (см. WO 2006/012627).
Аминоконцевые усечения были сделаны в контрольном белке ActRIIB-hFc (R64 20-131). Полученные активности представлены ниже (измеренные в кондиционированных средах).
В соответствии с этим усечения в две, три или четыре аминокислоты у N-конца приводят к образованию более активного белка, чем варианты, содержащие полноразмерный внеклеточный домен. Дополнительные эксперименты показали, что ActRIIB-hFc (R64, 25-131) с усечениями в пять аминокислот обладает активностью, эквивалентной активности неусеченной формы, а дополнительные делеции у N-конца способствуют дальнейшему снижению активности белка. Поэтому оптимальные конструкции имеют у С-конца последовательность, заканчивающуюся в положениях аминокислот 133-134 SEQ ID NO:4, а у N-конца - начинающуюся в положениях аминокислот 22-24 SEQ ID NO:4.
Конструкция, в которой N-конец, соответствующий аминокислотам 21 или 25, обладает активностью, аналогичной активности конструкции ActRIIB-hFc (R64, 20-134).
Пример 4. Варианты ActRIIB-Fc и их активность в клетках.
Активность белков ActRIIB-Fc тестировали в клеточном анализе, описанном выше. Результаты систематизированы ниже в табл. 1. Некоторые варианты тестировали в различных конструкциях с С-концевыми усечениями. Как обсуждалось выше, усечения в пять или пятнадцать аминокислот приводили к снижению активности. Интересно отметить, что варианты L79D и L79E, по существу, не обладали способностью связываться с активином, но почти полностью сохраняли способность ингибировать GDF-11 дикого типа.
Связывание растворимого ActRIIB-Fc с GDF11 и активином А
лы дикого типа. Если учесть более длительное время полужизни этого варианта, то это означает, что в течение всего этого времени вариант A24N будет давать лучший эффект на единицу активности белка, чем молекула дикого типа.
Интересно отметить, что введение кислотных аминокислот (аспарагиновой или глутаминовой кислоты) в положение 79 приводит к селективному снижению способности связываться с активином, но сохраняет способность связываться с GDF11/GDF8. Как обсуждается ниже, белки ActRIIB-Fc дикого типа, очевидно, действуют на ткани, но не на мышцы, причем некоторые из этих эффектов могут быть нежелательными. Как описано в настоящей заявке, предполагается, что такие эффекты заключаются в том, что различные лиганды связываются с ActRIIB-Fc и ингибируются под действием ActRIIB-Fc, включая, вероятно, связывание с активином и ингибирование активином. Предварительные данные показали, что у мышей варианты L79E и L79D оказывают меньшее влияние на ткани, чем на мышцы, но при этом они сохраняют свое воздействие на мышцы. Хотя варианты такого типа могут рассматриваться как варианты ActRIIB, однако следует отметить, что эти белки больше не обладают истинной функцией как рецепторы активина, а поэтому присвоенное обозначение "ActRIIB" служит только указанием на происхождение этих полипептидов. Хотя кислотные остатки в положении 79 вызывают снижение способности связывания с активином, сохраняя при этом способность связывания с GDF11, однако другие модификации в этом положении не дают такого эффекта. Замена L79A приводит к повышению способности связываться с активином, но не с GDF11. Замена L79P приводит к снижению способности связываться с активином и с GDF11.
Пример 5. Связывание с GDF-11 и с активином А.
Связывание некоторых белков ActRIIB-Fc с лигандами тестировали в анализе BiaCore(tm).
Варианты ActRIIB-Fc или белок дикого типа иммобилизовали на системе с использованием анти-hFc антитела. Лиганды инжектировали и пропускали через колонку с иммобилизованными белками рецептора. Результаты систематизированы в нижеследующей таблице.
Полученные данные подтверждают данные клеточного анализа, и указывают на то, что вариант A24N сохраняет лигандсвязывающую активность, аналогичную активности молекулы ActRIIB-hFc (R64 20-134), и что молекулы L79D или L79E сохраняют способность связываться с миостатином и GDF11, но вызывают значительное снижение уровня (не поддающееся количественной оценке) связывания с акти-вином А.
Другие варианты получали и тестировали, как сообщалось в WO 2006/012627, с использованием иммобилизованных на данном устройстве лигандов и с последующим пропусканием рецепторов над указанными иммобилизованными лигандами. Ниже приводится таблица данных, относящихся к этим вариантам.
- <1/5 от связывания дикого типа (WT);
1/2 от связывания WT;
+ - WT;
++ - <2-кратное увеличение уровня связывания; +++ - ~5-кратное увеличение уровня связывания; ++++ - ~10-кратное увеличение уровня связывания; +++++ - ~40-кратное увеличение уровня связывания.
Пример 6. Влияние белков ActRIIB-Fc на мышечную массу у мышей дикого типа. Заявителями была определена способность белка ActRIIB-Fc увеличивать мышечную массу у мышей дикого типа.
Мышам С57В110 два раза в неделю вводили дозу (10 мг/кг; внутрибрюшинно (i.p.)) человеческого белка ActRIIB (R64 20-134) или человеческого ActRIIB (K74A 20-134). Мышей подвергали ЯМР-сканированию на день 0 и на день 28 для определения процента изменения безжировой массы ткани всего организма. У мышей, обработанных ActRIIB (R64 20-134)-Fc, наблюдалось значимое 31,1% увеличение массы безжировой ткани по сравнению с массой мышей в контрольной группе, обработанной носителем. У мышей, обработанных человеческим белком ActRIIB (K74A 20-134)-Fc, наблюдалось значимое увеличение массы безжировой ткани по сравнению с массой, наблюдаемой у контрольной группы, хотя и в меньшей степени, чем у группы, обработанной человеческим ActRIIB (R64 20-134). В аналогичном исследовании мышей внутрибрюшинно два раза в неделю обрабатывали PBS, 1, 3 или 10 мг/кг мышиного ActRIIB (WT, 20-134)-Fc. По окончании исследований мышцы бедра, икроножные мышцы, мышцы грудной клетки и мышцы диафрагмы иссекали и взвешивали. Результаты систематизированы ниже в табл. 3.
Таблица 3
Массы ткани у мышей дикого типа, обработанных носителем и мышиным ActRIIB (WT, 20-134)-Fc
ному увеличению мышечной массы у мышей дикого типа. У мышей, обработанных мышиным ActRIIB (WT, 20-134)-Fc, масса икроножных мышц увеличивалась на 26,5%, масса мышц бедра увеличивалась на 28,9%, а масса мышц грудной клетки увеличивалась на 40,0%. Авторами настоящего изобретения были также обнаружены изменения массы мышц диафрагмы, которая на 63% превышала массу мышц диафрагмы у контрольных мышей, обработанных носителем. Уменьшение массы мышц диафрагмы ассоциируется с осложнениями, которые обычно наблюдаются при различных мышечных дистрофиях. Поэтому увеличение массы диафрагмы, наблюдаемое после обработки мышиным ActRIIB (WT, 20-134)-Fc, может иметь клинически важное значение.
Пример 7. Влияние длительного времени полужизни белков ActRIIB-Fc на мышечную массу мышей дикого типа.
Заявителями было определено влияние длительного времени полужизни варианта белка ActRIIB-mFc (R64, A24N 20-134) на увеличение мышечной массы у мышей дикого типа.
Мышам С57В110 два раза в неделю вводили дозу (10 мг/кг; внутрибрюшинно (i.p.)) человеческого белка ActRIIB-mFc (R64 20-134) или человеческого ActRIIB-mFc (R64, A24N 20-134). Мышей подвергали ЯМР-сканированию в различные периоды: времени вплоть до 25-го дня для определения процента изменения массы безжировой ткани всего организма. Обе молекулы способствовали эквивалентному увеличению массы всего организма и мышечной массы, при этом масса икроножных мышц, бедра и грудной клетки увеличивалась на 40-70% (см. фиг. 5 и 6).
Полученные данные показали, что более длительное время полужизни данной молекулы стимулирует рост мышц за короткий период исследований с эффективностью, эквивалентной эффективности молекулы дикого типа.
Пример 8. Влияние белков ActRIIB-Fc с пониженной способностью связываться с активином на мышечную массу мышей дикого типа.
Заявителями была определена способность варианта белка ActRIIB-mFc (R64, L79D 20-134) с длительным временем полужизни увеличивать мышечную массу у мышей дикого типа.
Мышам С57В110 два раза в неделю вводили дозу (10 мг/кг; внутрибрюшинно (i.p.)) человеческого белка ActRIIB-mFc (R64 20-134) или человеческого ActRIIB-mFc (R64, L79D 20-134). Мышей подвергали ЯМР-сканированию в различные периоды времени вплоть до 24-го дня исследований для определения процента изменения массы безжировой ткани всего организма. Данные представлены ниже в таблице.
Масса тела День 0 (г)
Масса тела День 24 (г)
Икроножная мышца (L+R)
Бедро (L+R)
Грудная клетка (L+R)
Мод. TBS (масс./об.)
24,4±1,51
26,8±1,43
0,29±0,02
0,17±0,02
0,24+0,05
R64, 20-134 (10 мг/кг)
25,0±1,36
31,2*±1,53
0,40*+0,02
0,24*±0,02
0,37*+0,07
R64, L79D
20-134 (10 мг/кг)
25,3+1,22
28,1+1,64
0,32*±0,02
0,20*+0,02
0,27+0,05
*р <0,05
Эти данные продемонстрировали, что вариант L79D ActRIIB (с пониженной способностью связываться с активином А) обладает активностью in vivo, направленной на стимуляцию роста мышц, однако этот вариант дает меньшее количество прироста мышц, чем ActRIIB дикого типа. Такое снижение эффекта может быть отчасти вызвано небольшим снижением уровня связывания миостатина или потерей способности связываться с другим еще неизвестным негативным регулятором роста мышц. Способность стимулировать рост мышц в отсутствие влияния на передачу сигнала активина А является особенной желательной, поскольку активин представляет собой широко экспрессируемую регуляторную молекулу, которая, как известно, оказывает влияние на репродуктивную систему, кости, печень и многие другие ткани. У мышей ActRIIB-mFc (R64 20-134) оказывает значительное влияние на репродуктивную систему, а в некоторых случаях способствует увеличению размера селезенки. Молекула ActRIIB-mFc (R64, L79D 20-134) оказывает значительно более слабое влияние на репродуктивные ткани и селезенку, что указывает на то, что эта молекула является особенно подходящей для стимуляции роста мышц у пациентов с хорошей репродуктивной способностью или у пациентов, у которых желательно минимизировать влияние на репродуктивную систему.
Пример 9. Влияние белка ActRIIB-Fc на мышечную массу и силу мышц у мышей Mdx.
Для определения способности мьгшиного белка ActRIIB (WT, 20-134)-Fc увеличивать мышечную массу при патологических состояниях заявителями была определена способность белка ActRIIB-Fc увеличивать мышечную массу у мышей mdx с моделью мышечной дистрофии.
Взрослых мышей mdx два раза в неделю обрабатывали мышиным белком ActRIIB (WT, 20-134)-Fc (1, 3 или 10 мг/кг; внутрибрюшинно) или PBS-носителем, используемым в качестве контроля. Для определения сокращения мышц передних конечностей определяли силу, которую мышь прилагает при нажатии датчика мышечной силы. Для сравнения силы сокращения мышц у различных групп мышей была использована средняя сила из 5 испытаний с нажатием датчика. В конце исследований мышцы бедра, икроножные мышцы, мышцы грудной клетки и диафрагмы иссекали и взвешивали.
Измерения силы мышечных сокращений также указывали на значимое увеличение этой силы. Ре
зультаты измерения мышечной массы систематизированы ниже в таблице.
Массы ткани у мышей mdx, обработанных носителем и мышиным ActRIIB (WT, 20-134)-Fc
Обработанные
Икроножная
Бедро
Грудная
Диафрагма
носителем
мышца (L+R)
(L+R)
клетка (L+R)
Среднее
0,413+0,040
0,296+0,019
0,437+0,060
0, Ш±0, 030
(граммы)+ст.
KB.откл.
muActRIIB
Икроножная
Бедро
Грудная
Диафрагма
(WT, 20-
мышца
(L+R)
клетка
134)-Fc {10
(L+R)
(L+R)
мг/кг)
Среднее
0,52+0,050
0,39±0,05
0, 807±0,21
0, 149+0,020
{граммы)±ст.
кв.откл.
Величина р
0,0006
0,0006
0, 002
0, 05
Т-критерия
Как показано в таблице, у групп мышей mdx, обработанных мышиным ActRIIB (WT, 20-134)-Fc, наблюдается увеличение массы безжировой ткани по сравнению с массой у мышей, обработанных PBS. ActRIIB-Fc-обработка по сравнению с контрольной группой, обработанной носителем, приводила к увеличению размера икроножных мышц на 25,9%, мышц бедра - на 31,8%, а грудной клетки - на 85,4%. Возможный клинический интерес состоит в том, что авторами настоящего изобретения было также обнаружено, что массы диафрагмы мышей, обработанных мышиным ActRIIB (WT, 20-134)-Fc, по сравнению с контрольной группой увеличивались на 34,2%. Полученные данные показали, что белок ActRIIB-Fc является эффективным для лечения такого патологического состояния, как мышечная дистрофия.
Кроме того, у мышей mdx, обработанных белком ActRIEB-Fc, по сравнению с контролем, обработанным носителем, наблюдались более сильные мышечные сокращения. Через 16 недель у групп мышей, которым вводили 1, 3 и 10 мг/кг ActRIIB, по сравнению с контрольными группами, которым вводили носитель, наблюдалось 31,4%-ное, 32,3%-ное и 64,4%-ное увеличение силы мышечных сокращений соответственно. Увеличение силы мышечных сокращений у групп, обработанных мышиным ActRIIB (WT, 20-134)-Fc, подтвердило предположение о том, что увеличение мышечной силы, обнаруженное у групп обработки, является физиологически релевантным. Мыши mdx были восприимчивыми к поражениям, индуцированным мышечными сокращениями, и претерпевали значительно большее число циклов дегенерации и регенерации, чем мыши дикого типа. Несмотря на присутствие таких мышечных фенотипов у мышей mdx, обработанных мышиным ActRIIB (WT, 20-134)-Fc, наблюдались более сильные мышечные сокращения.
Мышечная дистрофия Дюшенна начинает развиваться в раннем детстве, чаще всего в возрасте до пяти лет. В соответствии с этим представленные выше данные, полученные для взрослых мышей, необязательно отражают эффекты, которые дает молекула ActRIIB у детей с МДД. Для подтверждения этих данных исследования проводили на молодых мышах mdx.
У молодых мышей (4-недельных) C57BL/10 и у мышей mdx обработка белком ActRIIB-mFc (R64, 20-134) приводила к значительному увеличению массы тела. Анализ состава веществ в организме, проводимый с помощью ЯМР-спектроскопии in vivo, указывал на увеличение массы безжировой ткани, сопровождающееся увеличением массы тела. У мышей C57BL/10, обработанных ActRIIB-mFc (R64, 20134), наблюдался 35,2% прирост массы безжировой ткани, а у обработанных групп mdx такой прирост массы безжировой ткани составлял 48,3% по сравнению с соответствующими контрольными группами. Кроме того, было оценено влияние ActRIIB-mFc (R64, 20-134)-обработки на мышечную силу. У обработанных носителем мышей mdx показатели силы мышечных сокращений были на 15,7% ниже, чем у групп C57BL/10, обработанных носителем, что указывает на то, что мышечная слабость ассоциируется с дефицитом дистрофина. В противоположность этому у мышей mdx, обработанных ActRIIB-mFc (R64, 20-134), сила мышечных сокращений превышала силу, наблюдаемую у группы мышей mdx, обработанных носителем, и величины измерений достигаемой силы мышечных сокращений превышали величины, полученные для мышей C57BL/10, обработанных носителем, и достигали уровня величин силы мышечных сокращений у обработанных мышей C57BL/10 (мыши mdx, обработанные носителем: 0,14 0±0,01 кгС; обработанные мыши mdx: 0,199±0,02 кгС; мыши C57BL/10, обработанные носителем: 0,166±0,03; 0,205±0,02 кгС). Интересно отметить, что такая обработка приводила к восстановлению силы мышечных сокращений у молодых мышей mdx до уровней, наблюдаемых у мышей дикого типа. Поэтому молекула ActRIIB-mFc (R64, 20-134), вероятно, играет важную роль в клинической практике лечения мышечной дистрофии Дюшенна, в частности у молодых пациентов в возрасте, близком к возрасту, при котором начинается развитие данного заболевания.
Пример 7. Влияние белка ActRIIB-Fc на мышечную силу и выживаемость у мышей SOD1.
Для определения способности полипептидов ActRIIB увеличивать мышечную силу и выживаемость мышей с моделью АБС заявителями был протестирован белок ActRIIB-Fc на мышах SOD1.
Мыши B6.Cg-Tg(SOD1-G93A)1Gur/J или SOD1 имели большое число копий мутантного аллеля человеческого трансгена супероксид-дисмутазы. Высокие уровни этого белка сообщают мышам фенотип, сравнимый с фенотипом, наблюдаемым у человека с АБС. У мышей SOD1 развивался прогрессирующий
паралич, а первые признаки заболевания проявлялись на 91-й день. Такое заболевание приводило к преждевременной гибели мышей в возрасте 19-23 недель.
Мышам SOD1, начиная с возраста 10 недель, вводили дозу носителя в качестве контроля или ActRIIB-mFc (K74A 20-134) (i.p., 5 мг/кг, два раза в неделю). Для определения силы сокращения мышц передних конечностей измеряли силу, которую мышь прилагает при нажатии датчика мышечной силы. Для сравнения силы сокращения мышц у различных групп мышей была использована средняя сила из 5 испытаний с нажатием датчика. Выживаемость определяли как число дней, начиная с рождения мыши и до дня, когда мышь, положенная на один бок, не могла сама встать за 30 с. На фиг. 7 представлены результаты: измерения силы сокращения мышц, а на фиг. 8 проиллюстрированы данные по выживаемости.
Мышам на последней стадии заболевания трудно поддерживать чистоту тела, что преимущественно обусловлено прогрессированием паралича, и они становятся неопрятными на вид. Поверхностное наблюдение этих мышей показало, что мыши в группе обработки мышиным ActRIIB (K74A 20-134)-Fc являются опрятными на вид даже в конечной стадии заболевания по сравнению с PBS-группой. Это наблюдение дает основание предположить, что обработанные мыши имеют лучшее здоровье и более высокое качество жизни, чем контрольные животные.
Как видно на фиг. 7, у мышей SOD1, которых обрабатывали мышиным ActRIIB (K74A 20-134)-Fc, по сравнению с контрольной группой, которой вводили PBS, наблюдались значительно более сильные мышечные сокращения. Это наблюдение отмечалось на день 117, то есть на ранней стадии заболевания, а также после прогрессирования заболевания на день 14 9. На фиг. 8 показано, что ActRIIB (K74A 20-134)-Fc-обработаннь:е мыши имели большую продолжительность жизни, чем контрольные животные, обработанные носителем. Такое исследование продемонстрировало возможность применения мышиного ActRIIB(K74A 20-134) у мышей с моделью АБС в целях увеличения мышечной силы и повышения выживаемости.
Аналогичный эксперимент проводили на мышах SOD1, однако, для более точной имитации лечения человеческого АБС после появления значимых симптомов заболевания обработку осуществляли более медленно до тех пор, пока не наблюдались едва заметные признаки заболевания (день 130). На день 130 мышей SOD1 распределяли на группы, которые обрабатывали либо носителем (модифицированным TBS), либо ActRIIB (R64 20-134)-mFc (10 мг/кг). Мышам подкожно вводили дозу один раз в неделю. Затем этих мышей подвергали ЯМР-сканированию на дни исследования -1 и 27 (в возрасте 129 и 157 дней соответственно). Измерения силы мышечных сокращений проводили на дни исследования 0 и 20. По окончании исследования у самцов контрольной группы потеря массы тела со дня исследования 0 составляла 4,3%, а у группы обработки прирост массы тела со дня исследования 0 составлял 7,8%. Потеря массы тела у самок контрольной группы по сравнению с их массой на день исследования 0 составляла 1,5%, тогда как у самок группы обработки наблюдался 15%-ный прирост массы тела.
У самцов и самок мышей SOD1 силу мышечных сокращений измеряли на дни 0 и 20. Верхний индекс "а" означает значимое различие по сравнению с соответствующим измерением на день 0 (р <0,05). Верхний индекс "b" означает значимое различие между величинами измерений для групп, которым вводили PBS (группа 1) и ActRIIB (R64 20-134)-mFc (группа 2) на день 20 (р <0,05).
Мышей подвергали ЯМР-сканированию для определения изменений состава веществ в организме после обработки. На протяжении всего исследования у самок контрольных мышей потеря массы безжировой ткани составляла 6,0% (день 1: 18,2 г±1,28; день 27: 17,1 г±1,10), у самцов обработанных мышей дня исследования 0 прирост массы безжировой ткани составлял 9,1% (день -1: 19,17 г±0,77; день 27: 20,92 г±0,74). У самок контрольных мышей снижение безжировой массы с начала исследования составляло 0,83% (день 1: 13,18 г±0,84; день 27: 13,08 г±0,71), а у самок обработанных мышей прирост массы тела со дня исследования 0 составлял 10,7% (день 1: 13,66 г±0,83; день 27: 15,12 г±1,21). У самцов и самок групп обработки наблюдался значимый прирост массы безжировой ткани по сравнению с массой, наблюдаемой у соответствующих контрольных групп, обработанных PBS (р <0,001).
Полученные данные показали, что ActRIIB-Fc-обработка может оказывать благоприятный эффект при лечении пациентов с активной формой АБС как в отношении улучшения мышечной функции, так и в отношении повышения качества жизни.
Пример 8. Влияние белка ActRIIB-Fc на развитие ожирения и диабета у мышей с ожирением.
Для определения способности ActRIIB-Fc снижать степень ожирения у мышей с моделью ожирения заявителями были протестированы белки ActRIIB-mFc на мышах, которым давали корм с высоким содержанием жира (HFD).
Диабет типа II является серьезным осложнением при ожирении и характеризуется инсулинорези-стентностью. Характерными признаками инсулинорезистентности являются повышенные уровни инсулина натощак, и по этим признакам можно определить наличие у животного инсулинорезистентности. Заявителями было определено влияние обработки мышиным ActRIIB (R64 1С74А 20-134)-Fc на нормализацию уровней инсулина натощак у мышей с моделью ожирения.
Мышам C57BL/6 давали корм HFD, который состоял из 35% жира, при этом считалось, что мыши имеют ожирение, если их масса тела приблизительно на 50% выше массы тела мышей этого же возраста, которым давали стандартный корм (с 4,5% жира). Мышам с ожирением два раза в неделю вводили дозу носителя в качестве контроля или человеческого ActRIIB (R64 1С74А 20-134)-Fc (10 мг/кг; i.p.). Мышей с ожирением подвергали ЯМР-сканированию для определения состава веществ в организме сразу после введения дозы и через 3 недели после введения дозы. Изменения состава веществ в организме по сравнению со стандартом систематизированы на фиг. 9.
Мышам давали корм с высоким содержанием жира, при этом считалось, что мыши имеют ожирение, если их масса тела на 50% выше, чем масса тела мышей, которым давали стандартный корм. Мышам, которым давали корм HFD, в течение 35 недель вводили либо носитель в качестве контроля, либо мышиный ActRIIB (R64 1С74А 20-134)-Fc (5 мг/кг, два раза в неделю; i.p.). По окончании исследования мышей поддерживали в условиях голодания в течение ночи. По окончании периода голодания брали кровь и выделяли сыворотку. Затем сыворотку использовали для определения уровней инсулина натощак у мышей обеих групп. Результаты влияния мышиного ActRIIB (K74A 20-134)-Fc на уровни инсулина натощак у мышей с ожирением систематизированы ниже в таблице.
Уровни инсулина натощак у мышей, обработанных носителем и мышиным ActRIIB (К74А 20-134)-Fc
HFD, PBS
HFD, мышиный ActRIIB (К74Д 20-134)-mfc
Среднее (нг/мл) ± ст.кв.откл.
2,27±1,64
0,7 8+0,4 0
т-критерий
N/A
0, 012
На фиг. 9 проиллюстрировано снижение степени ожирения у группы мышей, которым вводили мышиный ActRIIB (R64 Ю4А 20-134)-Fc, по сравнению с контрольной группой, обработанной носителем. Было обнаружено, что жировая масса у обработанных мышей на 25,9% ниже, чем их исходная жировая масса. Кроме того, у мышей этой обработанной группы безжировая масса на 10,1% превышала исходную безжировую массу. Процентное изменение массы жировой ткани и безжировой ткани у мышей, обработанных ActRIIB (R64 Ю4А 20-134)-mFc, было значительно выше, чем процентное изменение такой массы у группы, обработанной PBS.
Мышам этой модели давали корм с высоким содержанием жира до тех пор, пока их масса более чем на 50% не превышала массу таких же мышей, которым давали стандартный корм. Исходя из заметного увеличения массы тела и степени ожирения можно сделать вывод, что эта модель будет соответствовать человеческой модели, которая характеризуется как явно выраженная степень ожирения. Поэтому установление того факта, что обработка мышей с ожирением человеческим белком ActRIIB (R64 Ю4А 20-134)-Fc приводит к снижению степени ожирения, может оказаться клинически релевантным для лечения человека с явно выраженной степенью ожирения.
Полученные результаты, систематизированные в табл. 5, дают основание предполагать, что обработка мышиным белком ActRIIB (K74A 20-134)-Fc будет значительно снижать повышенные уровни инсулина в сыворотке натощак, ассоциированные с ожирением. Полученные данные подтверждают возможную клиническую релевантность применения полипептидов ActRIIB для лечения диабета типа II.
Последующие эксперименты проводили на HFD-мышах с моделью ожирения и диабета, которым вводили ActRIIB-mFc (R64 20-134). 30-недельных мышей C57BL/6, которым давали корм HFD, распределяли на две группы (PBS и 10 мг/кг ActRIIB-mFc (R64 20-134)). Затем мышей взвешивали, и два раза в неделю в течение 12 недель внутрибрюшинно вводили нужную дозу. Мышей оценивали с помощью ЯМР на дни исследования 0 и 94.
У обработанных мышей потеря массы тела составляла 1,9% от их массы на день исследования 0, а у PBS-обработанных мышей прирост массы тела во время исследования составлял 6,7% от их массы на день исследования 0. Во время исследования у обработанных мышей также наблюдалось значительное увеличение массы безжировой ткани по сравнению с массой, наблюдаемой у PBS-группы (21,1%±6,28 и 3,7%±4,08 соответственно). У обработанных мышей также наблюдалась значительная потеря жировой ткани (-34%±10,95) по сравнению с PBS-группой (+10,2%±10,18).
Увеличение мышечной массы также наблюдалось у отдельных мышей в группе, обработанной ActRIIB-mFc (R64 20-134)
Икроножная мышца (1+R)
Бедро (L+R)
Грудная клетка (L+R)
PBS
0,33±0,05
0,1810,03
0,31±0,05
ActRIIB-mFc (R64 20-134)
0,44±0,08*
0,25±0,02*
0,44+0,13*
*р <0,05
Помимо позитивных эффектов, наблюдаемых в отношении массы жира и мышечной массы, которые ассоциировались с ActRIIB-Fc-обработкой этих мышей, наблюдались также позитивные эффекты в отношении изменения уровней липидов в сыворотке. Уровни холестерина и триглицеридов в сыворотке заметно снижались, что дает основание предположить, что слитые белки ActRIIB-Fc могут быть использованы для снижения уровней этих липидов у пациентов.
Пример 9. Влияние белка ActRIIB-Fc на мышечную массу у мышей с кахексией.
Заявителями была протестирована способность ActRIIB (R64 20-134)-mFc снижать потерю мышечной массы у мышей с моделью гипотрофии мышц, индуцированной глюкокортикоидами.
Мышам ежедневно в течение 13 дней подкожно вводили дозу PBS или дексаметазона (2 мг/кг) для индуцирования гипотрофии мышц. В течение этих же 13 дней группам, обработанным PBS или дексаме-тазоном, вводили носитель или ActRIIB (R64 20-134)-mFc (10 мг/кг; i.p.; два раза в неделю) так, чтобы были представлены все комбинации обработки. Мышей подвергали ЯМР-сканированию на дни 0 и 13 для определения изменений массы безжировой ткани для всех групп. Результаты ЯМР-анализа представлены ниже в табл. 6.
ЯМР-сканирование выявило значимое 2,5%-ное снижение массы безжировой ткани у животных группы "дексаметазон:PBS" по сравнению с животными PBSiPBS-группы. В противоположность этому, у животных группы "дексаметазон:ActRIIB (R64 20-134)-mFc" наблюдалось 13,5%-ное увеличение массы безжировой ткани, и такое увеличение было значимо более высоким по сравнению с группой "PBS:PBS" и "дексаметазон:PBS". Кахексия представляет собой нежелательный побочный эффект, возникающий при проведении различных терапевтических процедур, включая длительную терапию глюкокортикоида-ми. Поэтому тот факт, что лечение с использованием человеческого белка ActRIIB (R64 20-134)-mFc может снижать уровень гипотрофии мышц, ассоциированной с кахексией, должен иметь клинически важное значение.
Пример 10. Влияние ActRIIB-Fc на мышечную массу и ожирение у старых мышей или у мышей, подвергнутых овариэктомии.
Саркопения представляет собой одну из форм потери мышечной массы, ассоциированных со старением относительно здоровых людей. Это расстройство ассоциируется с прогрессирующей потерей массы скелетных мышц и снижением мышечной силы и подвижности. Этиология саркопении почти неизвестна. У женщин в период менопаузы потеря мышечной массы ускоряется так же, как и потеря кости. В соответствии с этим ActRIIB (R64, 20-134)-mFc тестировали у очень старых (двухлетних) мышей и у мышей с овариэктомией (модели климактерического состояния).
8-недельных самок мышей C57BL/6 подвергали операции овариэктомии (OVX) или ложной операции, а затем оставляли в покое на 16 недель до начала исследования. В начале исследования каждую группу мышей, подвергнутых ложной операции, и мышей, подвергнутых овариэктории, разделяли на группу обработки и группу, которой вводили носитель. Мышей всех групп взвешивали, и еженедельно в течение 11 недель вводили дозу либо ActRIIB (R64, 20-134)-mFc, либо буфера в качестве контроля. Всех исследуемых мышей на дни 0 и 83 подвергали ЯМР-сканированию для определения состава веществ в организме.
По окончании исследования у ложнооперированных PBS-мышей наблюдалась 4,7%-ная потеря безжировой массы от исходной массы, а у ложнообработанных мышей в течение всего исследования безжировая масса увеличивалась на 21%. По окончании исследования у контрольных OVX-мышей наблюдалась 12,1% потеря безжировой массы (значительно большая, чем у ложнооперированных мышей, которым вводили носитель), тогда как у обработанных OVX-мышей прирост массы составлял 12,9%.
Полученные данные показали, что слитые белки ActRIIB-Fc могут быть использованы для предотвращения потери мышечной массы, которая обычно наблюдается у женщин в климактерическом периоде.
Для оценки эффектов ActRIIB-Fc у естественно стареющих животных, самцов мышей C57BL/6 оставляли на 70 недель до начала обработки. Мышей распределяли на 2 группы (PBS и 10 мг/кг ActRIIB (R64, 20-134)-mFc). Мышей каждой группы взвешивали и 2 раза в неделю в течение 10 недель вводили нужную дозу. В течение всего исследования прирост массы безжировой ткани у обработанной группы был значительно выше, чем у PBS-группы.
% изменения безжировой массы
PBS
10 мг/кг
Среднее (% от фонового уровня)
101,76
117,27
Ср.кв.откл.
3,83
3, 91
Р-величина для PBS
<0,001
Было также обнаружено, что целостность мышц у животных группы обработки выше, чем у животных PBS-группы, на что указывает явное снижение уровня внутримышечного жира и улучшение структуры цитоскелета (см. фиг. 10).
Полученные данные показали, что слитые белки ActRIIB-Fc могут быть использованы для лечения гипотрофии мышц, ассоциированной со старением мужчин и женщин.
Пример 11. Влияние ActRIIB-Fc на потерю мышечной массы, ассоциированную с кастрацией.
Рак предстательной железы обычно подвергают лечению методом антиандрогенной терапии. Побочными эффектами такого лечения являются потеря мышечной массы и увеличение степени ожирения. У кастрированных мышей наблюдаются аналогичные изменения, а поэтому такие мыши представляют собой хорошую модель для проведения исследования на возможность применения ActRIIB-Fc в медицине.
8-недельных самцов мышей C57BL/6 кастрировали или подвергали ложной кастрации, а затем оставляли на 3 недели до начала исследований. Затем ложнокастрированных и кастрированных мышей подразделяли на группы, которым вводили PBS и ActRIIB (R64, 20-134)-mFc (10 мг/кг). Мышей взвешивали и один раз в неделю в течение 12 недель подкожно вводили нужную дозу. Мышей подвергали ЯМР-сканированию на дни исследования 0 и 83.
Во время исследования у ложнокастрированных PBS-мышей прирост массы безжировой ткани со дня исследования 0 в среднем составлял 9,72%±3,67, а у ложнокастрированных мышей, которым вводили ActRIIB (R64, 20-134)-mFc, прирост составлял 35,79%±3,1. У кастрированных PBS-обработанных мышей потеря массы безжировой ткани со дня 0 составляла 8,1%±4,22, а у обработанных кастрированных мышей наблюдался прирост массы, составляющий 17,77%±3,86. Кроме того, кастрация приводила к увеличению степени ожирения, a ActRIIB (R64, 20-134)-mFc-обработка способствовала уменьшению прироста жировой массы.
Масса икроножных мышц и мышц грудной клетки у кастрированных мышей, обработанных носителем, была меньше, чем масса ложнокастрированных мышей PBS-группы (масса икроножных мышц у кастрированных мышей 0,275+0,03 г, масса мышц грудной клетки у кастрированных мышей 0,196+0,06 г; масса икроножных мышц у ложнокастрированных мышей 0,313+0,02 г, масса мышц грудной клетки у ложнокастрированных мышей 0,254+0,03 г). ActRIIB (R64, 20-134)-mFc-обработка приводила к значительному ослаблению скорости снижения мышечной массы, индуцированного кастрацией (масса икроножных мышц у кастрированных мышей 0,421 +0,03 г, масса мышц грудной клетки у кастрированных
мышей 0,296+0,06 г).
Пример 12. Влияние ActRIIB-Fc на кахексию при раке.
Многие опухоли ассоциируются с потерей аппетита и со значительной потерей мышечной массы. У пациентов с кахексией прогноз хуже, чем у пациентов, не страдающих кахексией. Клеточная линия рака толстой кишки СТ26 индуцирует развитие тяжелой кахексии у мышей. У этой модели ActRIIB(R64 20134) тестировали на его воздействие на кахексию, индуцированную ксенотрансплантацией.
В эксперименте участвовало шесть групп мышей.
Группа
Опухоль
Обработка
Доза
Парадигма лечения
VEH
06. /об.
Терапевтическое
ActRIIB-Fc
10 мг/кг
Терапевтическое
VEH
Об. /об.
Терапевтическое
ActRIIB-Fc
10 мг/кг
Терапевтическое
ActRIIB-Fc
30 мг/кг
Терапевтическое
ActRIIB-Fc
10 мг/кг
Превентивное
Животным групп 3-6 подкожно вводили 5х106 опухолевых клеток. Группу 6 сразу обрабатывали ActRIIB-Fc два раза в неделю. Группам 1-5 начинали вводить дозу на 28-й день исследования, когда опухоли достигали размера 300-500 мм3. Как показано на фиг. 11, ActRIIB-Fc вызывал значительное снижение потери мышечной массы, ассоциированной с опухолями СТ26, как у мышей с диагностированными опухолями, так и у мышей, используемых в качестве превентивной модели до введения им опухолевых клеток.
Пример 13. Влияние вариантов ActRIIB-Fc на мышечную массу у мышей дикого типа.
Это исследование продемонстрировало влияние нижеследующих ActRIIB-конструкций, конъюги-рованных с Fc, на мышечную массу и другие ткани у 6-недельных самцов мышей C57BL/6. Мышей взвешивали и этим мышам два раза в неделю внутрибрюшинно инъецировали либо PBS, либо ActRIIB-конструкции, конъюгированные с Fc (10 мг/кг):
Мышей подвергали ЯМР-сканированию в начале, в середине и в конце исследования. Мышцы бедра, мышцы грудной клетки и икроножные мышцы, а также печень, почки и селезенку взвешивали и хранили в формалине.
Первый анализ данных показал, что ActRIIB (R64 20-134)-Fc вызывал значительное увеличение мышечной массы и безжировой массы тела, а также оказывал более эффективное действие на другие ткани. Варианты L79D и L79E способствовали увеличению мышечной массы в меньшей степени, и при этом оказывали незначительное влияние на другие ткани. Конструкции A24N и R64K оказывали промежуточное действие на мышцы и другие ткани. Полученные данные подтвердили, что варианты ActRIIB, обладающие пониженной способностью связываться с активином, имеют желательные свойства, в частности оказывают селективное действие на мышечную ткань.
Введение путем ссылки.
Все упомянутые здесь публикации и патенты во всей своей полноте вводятся в настоящее описание посредством ссылки так, как если бы каждая отдельная публикация или патент были конкретно и отдельно введены в настоящее описание посредством ссылки.
Хотя в настоящей заявке обсуждаются конкретные варианты рассматриваемых объектов изобретения, однако вышеуказанное описание имеет лишь иллюстративный, а не ограничительный характер. Многие варианты будут очевидны специалистам в данной области исходя из описания изобретения и прилагаемой ниже формулы изобретения. Полный объем изобретения вместе с полным объемом эквивалентов и вместе с указанными вариантами в описании изобретения должен быть определен формулой изобретения.
Список последовательностей
<110> ACCELERON PHARMA INC.
<120> ВАРИАНТЫ, ПРОИСХОДЯЩИЕ ИЗ ACTRIIB И ИХ ПРИМЕНЕНИЕ
<130> PHPH-024-WO1
<14 0> PCT/US2008/001506 <141> 2008-02-04
<150> 60/899,304 <151> 2007-02-02
<150> 60/927,088 <151> 2007-05-01
<150> 60/931,880 <151> 2007-05-25
<160> 25
<170> Patentin Ver. 3.3
<210> 1 <211> 116 <212> PRT
<213> Homo sapiens
<400> 1
Ser Gly Arg Gly Glu Ala Glu Thr Arg Glu Cys He Туг Tyr Asn Ala
Asn Trp Glu Lea Glu Arg Thr Asn Gin Ser Gly Leu Glu Arg Cys Glu
20 25 30
Gly Glu Gin Asp Lys- Arg Leu His Cys Tyr Ala Ser Trp Arg Asn Ser
Ser Gly Thr He Glu Leu Val Lys Lys Gly Cys Trp Leu Asp Asp Phe
50 55 60
Asn Cys Tyr Asp Arg Gin Glu Cys Val Ala Thr Glu Glu Asn Pro Gin
65 70 75 80
Val Tyr Phe Cys Cys Cys Glu Gly Asn Phe Cys Asn Glu Arg Phe Thr
<210> 2 <211> 512 <212> PRT
<213> Homo sapiens
Pro Gly Ser Gly Arg Gly Glu Ala Glu Thr Arg Glu Cys He Tyr Tyr
20 25 30
Asn Ala Asn Trp Glu Leu Glu Arg Thr Asn Gin Ser Gly Leu Glu Arg
35 40 45
Cys Glu Gly Glu Gin Asp Lys Arg Leu His Cys Tyr Ala Ser Trp Arg
50 55 60
Asn Ser Ser Gly Thr He Glu Leu Val Lys Lys Gly Cys Trp Leu Asp
65 70 75 80
Asp Phe Asn Cys Tyr Asp Arg Gin Glu Cys Val Ala Thr Glu Glu Asn
Phe Thr His Leu Pro Glu Ala Gly Gly Pro Glu Val Thr Tyr Glu Pro
115 120 125
Pro Pro Thr Ala Pro Thr Leu Leu Thr Val Leu Ala Tyr Ser Leu Leu
130 135 140
Pro He Gly Gly Leu Ser Leu He Val Leu Leu Ala Phe Trp Met Tyr
145 150 155 160
Arg His Arg Lys Pro Pro Tyr Gly His Val Asp He His Glu Asp Pro
165 170 175
Gly Pro Pro Pro Pro 180
Pro Leu Val Gly Leu Lys Pro Leu Gin Leu 185 190
Leu Glu He Lys Ala Arg Gly Arg Phe Gly Cys Val Trp Lys Ala Gin
195 200 205
Leu Met A.sn Asp Phe Val Ala Val Lys He Phe Pro Leu Gin Asp Lys
210 215 220
His Glu Asn Leu Leu Gin Phe He Ala Ala Glu Lys Arg Gly Ser Asn
245 250 255
Leu Glu Val Glu Leu Trp Leu He Thr Ala Phe His Asp Lys Gly Ser
260 265 270
Leu Thr P.sp Tyr Leu Lys Gly Asn He He Thr Trp Asn Glu Leu Cys
275 280 285
His Val Ala Glu Thr Met Ser Arg Gly Leu Ser Tyr Leu His Glu Asp
290 295 300
Val Pro Trp Cys Arg Gly Glu Gly His Lys Pro Ser He Ala His Arg
305 310 315 320
Asp Phe Lys Ser Lys Asn Val Leu Leu Lys Ser Asp Leu Thr Ala Val
325 330 335
Leu Ala Asp Phe Gly Leu Ala Val Arg Phe Glu Pro Gly Lys Pro Pro
340 345 350
Glu Gly Tyr Ala Ala Asp
Gly Thr 360
Ala He Asn 375
Met Gly Leu ' 390
Gly Pro Val 405
Tyr Met 365
Arg Arg Arg Asp
Ala Phe
380
Trp Giu :
395
Ala Pro Glu
Leu Arg He
Ser Arg Cys 400
Phe Glu Glu 415
His Pro Ser
Glu Leu Gin Glu
Lvs Met 435
Thr He Glu Glu
A.rg Pro Thr He Lys Asp His
Ala Gin Leu Cys Val 455
?rp Leu 445
Cys Trp 460
Lys His Pro Asp His Asp
. Ala Arg
Arg Ser
Leu Ser Ala
470
Val Asn Gly ' 485
Val Glu i 475
Val Ser Leu
480
Val Ser Leu 4 95
Ser Val 500
Thr Asn Val
Asp Leu 505
Pro Pro Lys Glu Ser Ser He 510
gggaggctga gacacgggag tgcatctact acaacgccaa ctgggagctg 60
accagagcgg cctggagcgc tgcgaaggcg agcaggacaa gcggctgcac 120
cetggcgcaa cagctctggc accatcgagc tcgtgaagaa gggctgctgg 180
tcaactgcta cgataggcag gagtgtgtgg ccactgagga gaacccccag 240
gctgctgtga aggcaacttc tgcaacgagc gcttcactca tttgccagag 300
cggaagtcac gtacgagcca cccccgacag cccccacc 348
cctgggtggc ctgagacacg gcggcctgga : gcaacagctc gctacgatag gtgaaggcaa tcacgtacga tgcccatcgg agccccccta tggtgggcct tctggaaggc agcagtcgtg tgctacagtt
tcacggcctt ggaacgaact atgtgccctg gtaagaatgt ttcgatttga acatggctcc ttgacatgta acggacccgt tggaggagct ggttgaaaca atgcagaggc cggtcaacgg acctgccccc cctcgccctc ggagtgcatc gcgctgcgaa tggcaccatc gcaggagtgt cttctgcaac gccacccccg gggcctttcc cggtcatgtg gaagccactg ccagctcatg gcagagtgaa cattgctgcc
ccatgacaag gtgtcatgta gtgccgtggc attgctgaag gccagggaaa tgaggtgctc tgccatgggg ggatgagtac gcaggaggtg cccgggcctg tcgcttgtcc cactacctcg taaagagtca ctctggggat tactacaacg ggcgagcagg gagctcgtga gtggccactg gagcgcttca acagccccca ctcatcgtcc gacatccatg cagctgctgg aatgactttg cgggagatct gagaagcgag
ggctccctca gcagagacga gagggccaca agcgacctca cctccagggg gagggagcca ttggtgctgt atgctgccct gtggtgcaca gcccagcttt gcgggctgtg gactgtctcg agcatctaa cgctgtggcc ccaactggga acaagcggct agaagggctg aggagaaccc ctcattt gcc ccctgctcac tgctggcctt aggaccctgg agatcaaggc tagctgtcaa tcagcacacc gctccaacct
cggattacct tgtcacgagg agccgtctat cagccgtgct acacccacgg tcaacttcca gggagcttgt ttgaggaaga agaagatgag gtgtgaccat tggaggagcg tttccctggt cggctctggg gctggagcgc gcactgctac ctggctagat ccaggtgtac agaggctggg ggtgctggcc ttggatgtac gcctccacca tcgggggcgc gatcttccca tggcatgaag cgaagtagag
caaggggaac !
cctctcatac
tgcccacagg
ggctgacttt
acaggtaggc
gagagatgcc
gtctcgctgc
gattggccag
gcccaccatt
cgaggagtgc
ggtgtccctg
gacctctgtc :
<210> 5
<211> 343
<212> PRT
<213> Искусственная последовательность
<400> 5
Gly Arg Gly Glu Ala Giu Thr Arg Glu Cys He Tyr Tyr Asn Ala Asn
15 10 15
Trp Glu Leu Glu Arg Thr Asn Gin Ser Gly Leu Giu Arg Cys Glu Gly
20 25 30
Glu Gin Asp Lys Arg Leu His Cys Tyr Ala Ser Trp Arg Asn Ser Ser
35 4 0 4 5
Gly Thr He Glu Leu Val Lys Lys Gly Cys Trp Leu Asp Asp Phe Asn
50 55 60
Cys Tyr Asp Arg Gin Glu Cys Val Ala Thr Glu Glu Asn Pro Gin Val
65 70 75 80
Tyr Phe Cys Cys Cys Glu Gly Asn Phe Cys Asn Glu Arg Phe Thr His
Ala Pro Thr Gly Gly Gly Thr His Thr Cys Pro Pro Cys Pro Ala Pro
115 120 125
Glu Leu Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys
130 135 140
Asp Thr Leu Met He Ser Arg Thr Pro Glu Val Thr Cys Val Val Val
145 150 155 160
Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val .
165 170 175
Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gin Tyr
180 185 190
Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gin Asp
195 200 205
<210> 12 <211> 344 <212> PRT
<213> Искусственная последовательность <220>
<223> Описание искусственной последовательности: синтетическая конструкция <400> 12
Ser Gly Arg Gly Glu Ala Glu Thr Arg Glu Cys He Tyr Tyr Asn Ala
Asn Trp Glu Leu Glu Arg Thr Asn Gin Ser Gly Leu Glu Arg Cys Glu
20 25 30
Gly Glu Gin Asp Lys Arg Leu His Cys Tyr Ala Ser Trp Arg Asn Ser
35 40 45
Ser Gly Thr He Glu Leu Val Lys Lys Gly Cys Trp Leu Asp Asp Phe
Asn Cys Tyr Asp Arg Gin Glu Cys Val Ala Thr Glu Glu Asn Pro Gin
65 70 75 30
Val Tyr Phe Cys Cys Cys Glu Gly Asn Phe Cys Asn Glu Arg Phe Thr
His Leu Pro Giu Ala Gly Gly Pro Glu Val Thr Tyr Glu Pro Pro Pro
100 105 110
Thr Ala Pro Thr Gly Gly Gly Thr His Thr Cys Pro Pro Cys Pro Ala
115 120 125
Pro Glu Leu Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro
130 135 140
Lys Asp Thr Leu Met He Ser Arg Thr Pro Glu Val Thr Cys Val Val
145 150 155 160
Val Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val
165 170 175
Asp Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gin
180 185 190
Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gin
195 200 205
Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala
210 215 220
Leu Pro Val Pro He Glu Lys Thr He Ser Lys Ala Lys Gly Gin Pro
225 230 235 240
Arg Glu Pro Gin Val Tyr Thr Leu Pro Pro Ser Arg Glu Glu Met Thr
245 250 255
Lys Asn Gin Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser
260 265 270
Asp He Ala Val Glu Trp Glu Ser Asn Gly Gin Pro Glu Asn Asn Tyr
275 280 285
Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr
290 295 300
Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gin Gin Gly Asn Val Phe
305 310 315 320
Ser Cys Ser Val Met His Glu Ala Leu His Asn His Tyr Thr Gin Lys
325 330 335
Ser Leu Ser Leu Ser Pro Gly Lys 340
<210> 13 <211> 225 <212> PRT
<213> Искусственная последовательность
<220>
<221> M0D_RES
<222> (43)
<223> Asp или Ala
<220>
<221> MOD_RES
<222> (100)
<223> Lys иди Ala
<220>
<221> MOD_RES
<222> (212)
<223> Asn или Ala
<400> 13
Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro
15 10 15
Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met He Ser
20 25 30
Arg Thr Pro Glu Val Thr Cys Val Val Val Xaa Val Ser His Glu Asp
35 40 45
Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn
50 55 60
Ala Lys Thr Lys Pro Arg Glu Glu Gin Tyr Asn Ser Thr Tyr Arg Val
65 70 75 80
Val Ser Val Leu Thr Val Leu His Gin Asp Trp Leu Asn Gly Lys Glu
Tyr Lys Cys Xaa Val Ser Asn Lys Ala Leu Pro Val Pro He Glu Lys
100 105 110
Thr He Ser Lys Ala Lys Gly Gin Pro Arg Glu Pro Gin Val Tyr Thr
115 120 125
Leu Pro Pro Ser Arg Glu Glu Met Thr Lys Asn Gin Val Ser Leu Thr
130 135 140
<212> PRT
<213> Homo sapiens
<400> 17
He Leu Gly Arg Ser Glu Thr Gin Glu Cys Leu Phe Phe Asn Ala Asn
Trp Glu Lys Asp Arg Thr Asn Gin Thr Gly Val Glu Pro Cys Tyr Gly
20 25 30
Asp Lys Asp Lys Arg Arg His Cys Phe Ala Thr Trp Lys Asn He Ser
35 4 0 4 5
Gly Ser He Glu He Val Lys Gin Gly Cys Trp Leu Asp Asp He Asn
50 55 60
Cys Tyr Asp Arg Thr Asp Cys Val Glu Lys Lys Asp Ser Pro Glu Val
65 70 75 80
Tyr Phe Cys Cys Cys Glu Gly Asn Met Cys Asn Glu Lys Phe Ser Tyr
Phe Pro Glu Met Glu Val Thr Gin Pro Thr Ser Asn Pro Val Thr Fro
100 105 110
Lys Pro Pro Thr 115
<210> 18 <211> 115 <212> PRT
<213> Homo sapiens <400> 18
Gly Arg Gly Glu Ala Glu Thr Arg Glu Cys He Tyr Tyr Asn Ala Asn
15 10 15
Trp Glu Leu Glu Arg Thr Asn Gin Ser Gly Leu Glu Arg Cys Glu Gly
20 25 30
Glu Gin Asp Lys Arg Leu His Cys Tyr Ala Ser Trp Arg Asn Ser Ser
35 40 45
Gly Thr He Glu Leu Val Lys Lys Gly Cys Trp Leu Asp Asp Phe Asn
Cys Tyr Asp Arg Gin Glu Cys Val Ala Thr Glu Glu Asn Pro Gin Val
65 70 75 80
Tyr Phe Cys Cys Cys Glu Gly Asn Phe Cys Asn Glu Arg Phe Thr His
Leu Pro Glu Ala Gly Gly Pro Glu Val Thr Tyr Glu Pro Pro Pro Thr
100 105 110
<210> 19 <211> 150 <212> PRT <213> Rattus sp.
<400> 19
Met Thr Ala Pro Trp Ala Ala Leu Ala Leu Leu Trp Gly Ser Leu Cys
Ala Gly Ser Gly Arg Gly Glu Ala Glu Thr Arg Glu Cys He Tyr Tyr
20 25 30
Asn Ala Asn Trp Glu Leu Glu Arg Thr Asn Gin Ser Gly Leu Glu Arg
35 40 45
Cys Glu Gly Glu Gin Asp Lys Arg Leu His Cys Tyr Ala Ser Trp Pro
50 55 60
Asn Ser Ser Gly Thr He Glu Leu Val Lys Lys Gly Cys Trp Leu Asp
65 7 0 75 SO
Asp Phe Asn Cys Tyr Asp Arg Gin Glu Cys Val Ala Thr Glu Glu A.sn
Pro Gin Val Tyr Phe Cys Cys Cys Glu Gly Asn Phe Cys Asn Glu Arg
100 105 110
Phe Thr His Leu Pro Glu Pro Gly Gly Pro Glu Val Thr Tyr Glu Pro
115 120 125
Pro Pro Thr Ala Pro Thr Leu Leu Thr Val Leu Ala Tyr Ser Leu :
130 135 140
Pro He Gly Gly Leu Ser 145 150
<210> 20 <211> 150 <212> PRT <213> Sus sp.
<400> 20
Met Thr Ala Pro Trp Ala Ala Leu Ala Leu Leu Trp Gly Ser Leu Cys
15 10 15
Val Gly Ser Gly Arg Gly Glu Ala Glu Thr Arg Glu Cys He Tyr Tyr
20 25 30
Asn Ala Asn Trp Glu Leu Glu Arg Thr Asn Gin Ser Gly Leu Glu Arg
35 40 45
Cys Glu Gly Glu Gin Asp Lys Arg Leu His Cys Tyr Ala Ser Trp Arg
50 55 60
Asn Ser Ser Gly Thr He Glu Leu Val Lys Lys Gly Cys Trp Leu Asp
65 70 75 80
Asp Phe Asn Cys Tyr Asp Arg Gin Glu Cys Val Ala Thr Glu Glu Asn
Pro Gin Val Tyr Phe Cys Cys Cys Glu Gly Asn Phe Cys Asn Glu Arg
100 105 110
Phe Thr His Leu Pro Glu Ala Gly Gly Pro Glu Val Thr Tyr
115 120 125
Arg Ala
Gly
Ser 20
Gly
His
Asp
Glu
Val
Glu
Thr
Arg
Glu
Cys 30
Tyr
Tyr Asn
Ala 35
Asn
Trp
Glu
Leu
Glu
Lys
Thr
Asn
Gin
Ser 45
Gly
Val
Glu
Arg Leu
Val
Glu
Gly
Lys
Lys 55
Asp
Lys
Arg
Leu
His 60
Cys
Tyr
Ala
Ser
Trp Arg 65
Asn
Asn
Ser
Gly 70
Phe
Glu
Leu
Val
Lys
Lys
Gly
Cys
Trp
8 0
Leu Asp
Asp
Phe
Asn
Cys
Tyr
Asp
Arg
Gin 90
Glu
Cys
Ala
Lys 95
Glu
Glu Asn
Pro
Gin 100
Val
Phe
Phe
Cys
Cys 105
Cys
Glu
Gly
Asn
Tyr 110
Cys
Asn
Lys Lys
Phe 115
Thr
His
Leu
Pro
Glu 120
Val
Glu
Thr
Phe
Asp 125
Pro
Lys
Gin Pro 130
Ser
Ala
Ser
Val
Leu 135
Asn
Leu
Tyr
140
Ser
Leu
Leu
Pro
He Val 145
Gly
Leu
Ser
Met 150
<210> 25 <211> 150 <212> PRT
<213> Homo sapiens
<400> 25 Met Gly Ala 1
Ala
Ala 5
Lys
Leu
Ala
Phe
Ala 10
Val
Phe
Leu
Ser
Cys
Ser Ser
Gly
Ala 20
Leu
Gly
Arg
Ser
Glu
Thr
Gin
Glu
Cys
Leu
Phe
Phe Asn
Ala 35
Asn
Trp
Glu
Lys
Asp 40
Arg
Thr
Asn
Gin
Thr 45
Gly
Val
Glu
Pro Cys 50
Tyr
Gly
Asp
Lys
Asp
Lys
Arg
Arg
His
Cys
Phe
Ala
Thr
Trp
Lys Asn
Ser
Gly
Ser
Glu
Val
Lys
Gin
Gly
Cys
Trp
Leu
Asp Asp
Asn
Cys
Tyr
Asp
Arg
Thr
Asp
Cys
Val
Glu
Lys
Lys
Asp
Ser Pro
Glu
Val 100
Tyr
Phe
Cys
Cys
Cys 105
Glu
Gly
Asn
Met
Cys 110
Asn
Giu
Lys Phe
Ser 115
Tyr
Phe
Pro
Glu
Met
120
Glu
Val
Thr
Gin
Pro 125
Thr
Ser
Asn
Pro Val 130
Thr
Pro
Lys
Pro
Pro 135
Tyr
Tyr
Asn
Leu 140
Leu
Tyr
Ser
Leu
Val Pro 145
Leu
Met
Leu
He 150
ФОРМУЛА ИЗОБРЕТЕНИЯ
1. Вариант белка ActRIIB, содержащий аминокислотную последовательность, которая по меньшей мере на 80% идентична последовательности аминокислот 29-109 SEQ ID NO:2, где указанный белок содержит по меньшей мере одну последовательность N-X-S/T в положении, отличающемся от положения эндогенной последовательности N-X-S/T ActRIIB, и где указанная по меньшей мере одна последовательность N-X-S/T находится в положении, находящемся за пределами лигандсвязывающего кармана.
2. Вариант белка ActRIIB по п.1, где указанный белок содержит N в положении, соответствующем положению 24 SEQ ID NO:2, и S или Т в положении, соответствующем положению 26 SEQ ID NO:2, и где указанный белок ингибирует передачу сигнала под действием активина, миостатина и/или GDF11 в клеточном анализе.
3. Вариант белка ActRIIB по п.1, где указанный белок содержит R или K в положении, соответствующем положению 64 SEQ ID NO:2.
4. Вариант белка ActRIIB по п.1, где указанный белок содержит по меньшей мере одну дополнительную модификацию по отношению к последовательности SEQ ID NO:2 и где указанная по меньшей мере одна дополнительная модификация представляет собой консервативную модификацию, расположенную в лигандсвязывающем кармане.
5. Вариант белка ActRIIB по п.1, где указанный белок содержит по меньшей мере одну дополнительную модификацию по отношению к последовательности SEQ ID NO:2 и где указанная по меньшей мере одна дополнительная модификация представляет собой модификацию в одном или более положениях, выбранных из группы, состоящей из K74, R40, Q53, K55, F82 и L79 SEQ ID NO:2.
6. Вариант белка ActRIIB по п.1, где указанный белок содержит аминокислотную последовательность, начинающуюся в положении аминокислоты, соответствующем любой из аминокислот 22-25 SEQ ID NO:2, и заканчивающуюся в положении аминокислоты, соответствующем любой из аминокислот 131, 133 или 134 SEQ ID NO:2.
7. Вариант белка ActRIIB по любому из пп.1-6, где указанный белок представляет собой слитый белок, дополнительно содержащий гетерологичную часть.
8. Вариант слитого белка ActRIIB по п.7, где указанный белок представляет собой гомодимер.
9. Вариант слитого белка ActRIIB по п.7, где указанная гетерологичная часть содержит константную область тяжелой цепи IgG.
1.
10. Вариант белка ActRIIB по любому из пп.1-9, где указанный белок содержит аминокислотную последовательность, которая по меньшей мере на 90% идентична последовательности аминокислот 29109 SEQ ID NO:2.
11. Вариант белка ActRIIB по любому из пп.1-9, где указанный белок содержит аминокислотную последовательность, которая по меньшей мере на 95% идентична последовательности аминокислот 29109 SEQ ID NO:2.
12. Вариант белка ActRIIB по любому из пп.1-9, где указанный белок содержит аминокислотную последовательность, которая по меньшей мере на 99% идентична последовательности аминокислот 29109 SEQ ID NO:2.
Последовательность человеческого растворимого полипептида ActRIIB (внеклеточного), представленная как SEQ ID NO: 1 (116 аминокислот)
SGRGEAETRECIYYMAMWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKK GC
WLDDFNCYDRQECTATEENPQWFCCCEGNFCNERFTHLPEAGGPEVTYEPPPTAPT
Фиг. 1
Последовательность человеческого белка-предшественника ActRIIB, представленная как SEQ ID NO: 2 (NM 001106, 512 аминокислот)
MTAPKVALALLWGSLWPGSQRGEAETRECIYYMANWELERT^j^SGLERCEGBQDKRL НС
YASWS^SSGTIELVKKGCWLDDFNCYDRQECVATBEITPCEVYPCCCEGNPCNERFTHL РЕ
AaGFEVTYEPRPTAPTLLTVI^YSLLPIGGLSLIVLlAFWMYRHRKPPYGHVDIHED PG
PPPPSPLVGLKPLQLLEIKftRGRFGCVWKAQLMNDFVAVKIFPLQDKQSWQSEREIP
PGMKHENLLQFIAAEKUGSNLEVELWLITAFHDKGSLTDYLKGNIITWHELCHVAET MS
RGLSYLMEDVPWCRGEGHKPSIAHRDFKSKNVLLKSDLTAVLADFGIAVRFEPGKPP
THGQVGTRRYMAPEVLEGAIMFQRDAFLRrDMYAMGLVLWELVSRCKAADGPVDEYM LP
FEEEIGQHPSLEELQEWVHKKMRPTIKDHWbKHPGLAQLCVTIEECTOHDAEARLS AG
CVEBRVSLIRRSVNGTTSOCLVSLVTEVTNVDLPPKESSI
Фиг. 2
Последовательность нуклеиновой кислоты, кодирующая человеческий растворимый полипептид ActRIIB (внеклеточный) и представленная как SEQ ID NO: 3 (348 п.н.)
tctgggcgtggggaggctgagacacgggagtgcatctactacaacgccaactgggagctggagcgcacc aaccagagcggcctggagcgctgcgaaggcgagcaggacaagcggctgcactgctacgcntcctggcgc aacagctctggcaccatcgagctcgtgaagaagggctgctggctagatgacttcaactgctacgatagg caggagtgtgtggccactgaggagaacccccaggtgtacttetgctgctgtgaaggcaacttctgcaac gagcgcttcactcatttgccagaggctgggggcccggaagtca.cgtacgagccacccccgacagccccc acc
Фиг. 3
Евразийская патентная организация, ЕАПВ Россия, 109012, Москва, Малый Черкасский пер., 2
025891
- 1 -
025891
- 1 -
025891
- 1 -
025891
- 1 -
025891
- 4 -
025891
- 42 -
025891
- 42 -
025891
- 42 -
025891
- 42 -
025891
- 42 -
025891
- 42 -
025891
- 42 -
025891
- 42 -
025891
- 42 -
025891
- 43 -
025891
- 43 -
025891
- 43 -
025891
- 43 -
025891
- 45 -
025891
- 45 -
025891
- 45 -
025891
- 45 -
025891
- 47 -
025891
- 47 -
025891
- 47 -
025891
- 47 -
025891
- 47 -
025891
- 47 -
025891
- 47 -
025891
- 47 -
025891
- 47 -
025891
- 47 -
025891
- 47 -
025891
- 47 -
025891
- 49 -
025891
- 51 -
025891
- 53 -