Патентная документация ЕАПВ

 
Запрос :  ea000020886b*\id

больше ...
Термины запроса в документе


Полный текст патента

(57) Реферат / Формула:

1. Выделенный антигенсвязывающий полипептид, специфично связывающийся с TL1A, который содержит: (а) вариабельную область тяжелой цепи гуманизированного антитела, которая содержит: (1) CDR-H1, которая содержит аминокислотную последовательность SEQ ID NO:7; (2) CDR-H2, которая содержит аминокислотную последовательность SEQ ID NO:8; (3) CDR-H3, которая содержит аминокислотную последовательность SEQ ID NO:9; (b) вариабельную область легкой цепи гуманизированного антитела, которая содержит: (1) CDR-L1, которая содержит аминокислотную последовательность SEQ ID NO:35; (2) CDR-L2, которая содержит аминокислотную последовательность SEQ ID NO:36; (3) CDR-L3, которая содержит аминокислотную последовательность SEQ ID NO:37.

2. Полипептид по п.1, где вариабельная область тяжелой цепи гуманизированного антитела содержит аминокислотную последовательность SEQ ID NO:10.

3. Полипептид по п.1, где вариабельная область легкой цепи гуманизированного антитела содержит аминокислотную последовательность SEQ ID NO:38.

4. Антигенсвязывающий полипептид, специфично связывающийся с TL1A, который содержит вариабельную область тяжелой цепи гуманизированного антитела, раскрытую в п.2, и вариабельную область легкой цепи гуманизированного антитела, раскрытую в п.3.

5. Полипептид по любому из пп.1-4, где полипептид выбран из группы, состоящей из молекулы антитела, фрагмента Fab, фрагмента Fab', фрагмента F(ab') 2 и молекулы scFv.

6. Полипептид по п.5, где молекула представляет собой молекулу антитела.

7. Полипептид по п.6, который содержит: (a) вариабельную область легкой цепи, имеющую последовательность SEQ ID NO:38; (b) вариабельную область тяжелой цепи, имеющую последовательность SEQ ID NO:10.

8. Полипептид по п.7, который представляет собой химерное антитело, которое содержит константную область тяжелой цепи человека и константную область легкой цепи человека.

9. Полипептид по п.8, где антитело представляет собой молекулу IgG (например, молекулу IgG1 или IgG4).

10. Полипептид по п.5, где полипептид представляет собой молекулу scFv.

11. Полипептид по п.10, где scFv имеет формулу NH 2 -L-VH-X-VK-COOH или NH 2 -L-VK-X-VH-COOH, где L представляет собой лидерную последовательность; VH представляет собой вариабельную область тяжелой цепи гуманизированного антитела; X представляет собой линкерный полипептид и VK представляет собой вариабельную область легкой цепи гуманизированного антитела.

12. Полипептид по п.5, представляющий собой фрагмент Fab, слитый с HSA.

13. Полипептид по п.12, где фрагмент Fab, слитый с HSA, содержит: (i) тяжелую цепь, представленную NH 2 -VH-CH1-HSA-COOH или NH 2 -HSA-CH1-VH-COOH, и (ii) легкую цепь, представленную NH 2 -VK-CK-COOH, где: (a) VH представляет собой вариабельную область тяжелой цепи гуманизированного антитела; (b) CH1 представляет собой константный домен 1 тяжелой цепи человека; (c) HSA представляет собой сывороточный альбумин человека; (d) VK представляет собой вариабельную область легкой цепи гуманизированного антитела; (e) CK представляет собой константный домен κ-цепи человека.

14. Полипептид по любому из пп.1-13, конъюгированный с терапевтическим или диагностическим средством.

15. Полипептид по п.14, где терапевтическое средство выбрано из группы, состоящей из цитотоксического средства, радиоактивной метки, иммуномодулятора, гормона, фермента, олигонуклеотида, фотоактивного терапевтического средства или их сочетания.

16. Полипептид по п.14, где диагностическое средство выбрано из группы, состоящей из радиоактивной метки, фотоактивного диагностического средства, активируемого ультразвуком средства или нерадиоактивной метки.

17. Полипептид по любому из пп.1-16, где полипептид является антагонистом TL1A.

18. Полипептид по любому из пп.1-16, где полипептид не является агонистом TL1A.

19. Полипептид по любому из пп.1-18, где полипептид связывается с TL1A с константой связывания, составляющей по меньшей мере приблизительно 10 6 М -1 .

20. Полипептид по п.19, где полипептид связывается с TL1A с константой связывания по меньшей мере приблизительно 10 7 M -1 .

21. Полипептид по п.19, где полипептид связывается с TL1A с константой связывания по меньшей мере приблизительно 10 8 M -1 .

22. Полипептид по п.19, где полипептид связывается с TL1A с константой связывания по меньшей мере приблизительно 10 9 M -1 .

23. Фармацевтическая композиция для лечения или диагностирования воспалительного, иммунного или злокачественного заболеваний или состояний, содержащая любой из полипептидов по пп.1-22 в эффективном количестве и носитель.

24. Композиция по п.23, которая также содержит дополнительное терапевтическое средство, выбранное из группы, состоящей из цитотоксического средства, радиоактивной метки, иммуномодулятора, гормона, фермента, олигонуклеотида, фотоактивного терапевтического средства или их сочетаний, или диагностическое средство, выбранное из группы, состоящей из радиоактивной метки, фотоактивного диагностического средства, активируемого ультразвуком средства или нерадиоактивной метки.

25. Применение композиции по п.23 или 24 для изготовления лекарственного средства для лечения или диагностирования воспалительного заболевания или состояния.

26. Применение композиции по п.23 или 24 в изготовлении лекарственного средства для лечения или диагностирования иммунного заболевания или состояния.

27. Применение композиции по п.23 или 24 в изготовлении лекарственного средства для лечения или диагностирования злокачественного заболевания или состояния.

28. Применение по любому из пп.25-27, где заболевание или состояние выбрано из группы, состоящей из аутоиммунного заболевания (например, обыкновенной волчанки), воспалительного заболевания кишечника (IBD), хронического обструктивного заболевания легких (COPD), артрита (например, ревматоидного артрита), рассеянного склероза, отторжения трансплантата, повреждения центральной нервной системы, Th1-опосредованных заболеваний кишечника, таких как болезнь Крона, псориаза, лейкемии или лимфомы (например, хронический лимфолейкоз (CLL)), атеросклероза, карциномы легких и карциномы толстой кишки.

29. Полинуклеотид, кодирующий любой из полипептидов по пп.1-22.

30. Рекомбинантный полинуклеотид, который содержит промоторную последовательность, функционально связанную с любым полинуклеотидом по п.29.

31. Выделенная клетка, трансформированная полинуклеотидом по п.30.

32. Способ получения полипептида, кодируемого рекомбинантным полинуклеотидом по п.30, где способ включает: a) культивирование клетки, трансформированной рекомбинантным полинуклеотидом для того, чтобы экспрессировать кодируемый полипептид; b) выделение экспрессированного таким образом полипептида.


Евразийское 020886 (13) B1
патентное
ведомство
(12) ОПИСАНИЕ ИЗОБРЕТЕНИЯ К ЕВРАЗИЙСКОМУ ПАТЕНТУ
(45) Дата публикации и выдачи патента 2015.02.27
(21) Номер заявки 201070596
(22) Дата подачи заявки 2008.11.13
(51) Int. Cl.
C07K16/28 (2006.01) A61K39/395 (2006.01) A61P37/06 (2006.01) A61P35/00 (2006.01)
(54) ГУМАНИЗИРОВАННЫЕ АНТИТЕЛА ПРОТИВ TL1A
(31) 60/987,651
(32) 2007.11.13
(33) US
(43) 2010.12.30
(86) PCT/US2008/083362
(87) WO 2009/064854 2009.05.22
(71) (73) Заявитель и патентовладелец:
ТЕВА БИОФАРМАСЬЮТИКАЛЗ ЮЭсЭй, ИНК. (US)
(72) Изобретатель:
Смит Роджер, Канакарадж Паланисами, Рошке Виктор, Роузен Крейг, Кукси Бриджет А. (US)
(74) Представитель:
Медведев В.Н. (RU)
(56) WO-A-2006127900
BAMIAS GIORGOS ET AL.: "Expression, localization, and functional activity of TL1A, a novel Th1-polarizing cytokine in inflammatory bowel disease", JOURNAL OF IMMUNOLOGY, AMERICAN ASSOCIATION OF IMMUNOLOGISTS, US, vol. 171, no. 9, 1 November 2003 (2003-11-01), pages 4868-4874, XP002425310, ISSN: 0022-1767, the whole document
WO-A-2005018571
YU Y. ET AL.: "Modulation of endothelial cell growth arrest and apoptosis by vascular endothelial growth inhibitor", CIRCULATION RESEARCH, GRUNE AND STRATTON, BALTIMORE, US, vol. 89, 1 January 2001 (2001-01-01), pages 1161-1167, XP002977779, ISSN: 0009-7330, the whole document
WO-A-2008106451
(57) В изобретении раскрыты гуманизированные антитела, которые специфично связываются с 15 членом надсемейства TNF (TNFSF 15), также известным как TL1A. Также описаны способы получения и применения антител против TL1A. Гуманизированные антитела могут представлять собой антагонисты и могут применяться для лечения или диагностирования заболеваний, связанных с функциями TL1A.
По данной заявке испрашивается преимущество приоритета к временной патентной заявке США № 60/987651, которая подана 13 ноября 2007 г. Таким образом, содержание этой заявки включено в качестве ссылки в полном объеме.
Краткое изложение сущности изобретения
Настоящее изобретение относится к антителам против TL1A и способам получения и применения таких антител. Ожидается, что эти антитела можно использовать, в частности, для лечения воспалительных состояний, таких как болезнь Крона.
Предпосылки создания изобретения
Белки, обладающие структурным сходством с фактором некроза опухоли (TNF), в совокупности обозначаются как надсемейство TNF. TL1A, член надсемейства TNF, представляет собой TNF-подобный цитокин, который связывается с рецептором с доменом смерти (DR)3 и предоставляет костимуляторные сигналы активированным лимфоцитам. Посредством этого взаимодействия TL1A индуцирует секрецию IFN-Y и, следовательно, может принимать участие в развитии эффекторных ответов Т-хелперов 1 типа.
TL1A представляет собой трансмембранный белок II типа и обозначается как 15 член надсемейства TNF (TNFSF15). TL1A экспрессируется преимущественно эндотелиальными клетками и моноцитами, и его экспрессия индуцируется под действием TNF-a и IL-1a; Migone et al., Immunity, 16:479-92 (2002). TL1A поддается повышающей регуляции провоспалительными цитокинами TNF и IL-1, а также иммунными комплексами (IC); Hsu et al., Exp. Cell Res., 292:241-51 (2004).
TL1A опосредует передачу сигналов через свой рецептор узнавания - рецептор смерти DR3, активация которого, как известно, индуцирует как факторы смерти, так и факторы выживания. Также предполагается, что TL1A, подобно TNF, циркулирует в гомотримерной растворимой форме; Kim et al., J. Immunol. Methods, 298(1-2):1-8 (Mar. 2005).
TL1A с высокой аффинностью связывается рецептором смерти 3 (DR3), являющимся членом семейства рецепторов TNF, содержащих домен смерти, а также называется Wsl-1, Apo-3, TRAMP и LARD и в настоящее время обозначается как 25 член надсемейства рецепторов TNF (TNFRSF25). В зависимости от клеточного окружения связывание DR3 с TL1A может запускать один или два пути передачи сигнала, активацию фактора транскрипции NF-KB или активацию каспаз и апоптоз. TL1 участвует в кости-муляции Т-клеток и поляризации Th1-клеток. На активированные Т-клетки TL1A действует, в частности, через свой поверхностный рецептор DR3, чтобы стимулировать клеточное выживание и секрецию про-воспалительных цитокинов. Секретируемый рецептор-приманка 3 (DcR3), растворимый белок из семейства рецепторов фактора некроза опухоли (TNFR), блокирует действие TL1A; Kim et al., "Identification of naturally secreted soluble form of TL1A, a TNF-like cytokine", J. Immunol. Methods, 298:1-8 (2005).
Вероятные мишени терапевтического воздействия
Аллергия и астма.
Th2-поляризация CD4 Т-клеток при повышенных уровнях IgE и образовании IL-13 NKT-клетками является основной причиной воспаления легкого при аллергии и астме. TL1A играет основную роль в аллергическом воспалении легкого (Fang et al. J. Exp. Med. 2008). TL1A костимулирует образование IL-4 и IL-13 в NKT-клетках. Блокирование взаимодействия TL1A и DR3 антителами против TL1A или доминантным отрицательным мутантом TL1A снимает воспаление легкого.
Карцинома легких и карцинома толстой кишки.
Члены надсемейства TNF и надсемейства рецепторов TNF регулируют иммунологические реакции и индуцируют апоптоз. DR3 предпочтительно экспрессируется Т-лимфоцитами и подвергается повышающей регуляции в процессе активации Т-клеток. Лигандом для DR3 является TL1A. TL1A также связывается с рецептором-приманкой DcR3/TR6, который экспрессируется некоторыми карциномами легких и карциномами толстой кишки и в некоторых здоровых тканях. TL1A подвергается повышающей регуляции под действием провоспалительных цитокинов TNF и IL-1. TL1A является более длинным вариантом TL1 (также обозначается как VEGI).
Атеросклероз.
Кроме того, также сообщалось, что TL1A обладает ангиостатическим действием и индуцирует экспрессию генов металлопротеиназы и IL-8 (Su et al., Exp. Cell Res., 312:266-277 (2006); Kang et al., Cytokine, 29:229-235 (2005)). Действительно, TL1A и DR3 могут быть вовлечены в патогенез атеросклероза путем увеличения образования провоспалительных цитокинов и хемокинов и снижения стабильности бляшек, индуцируя ферменты, разрушающие внеклеточный матрикс (Kang et al., Cytokine, 29:229-235
(2005)).
Ревматоидный артрит.
Также существуют данные, которые указывают на то, что TL1A/DR3 вовлечены в этиологию ревматоидного артрита (Bossen et al., J. Biol. Chem., 281 (20):13964-13971 (May 19, 2006). Воспалительное заболевание кишечника.
Исследователи обнаружили связь между экспрессией TL1A и воспалительным заболеванием кишечника (Prehn et al., Clin. Immunol., 112:66-77 (2004); Bamias et al., J. Immunol. 171:4868-4874 (2003)).
Th1-опосредованные заболевания кишечника, такие как болезнь Крона.
Болезнь Крона представляет собой тяжелое воспалительное расстройство кишечника, которое поражает молодых взрослых людей (в возрасте от 20 до 30 лет). Полагают, что причинами этого состояния являются генетическая предрасположенность и факторы внешней среды, которые вызывают дисбаланс эффекторных (провоспалительных) и регуляторных реакций Т-клеток, что приводит к воспалению слизистой желудочно-кишечного тракта и расстройству.
Путь TL1A/DR3 играет важную роль в Th1-опосредованных заболеваниях кишечника, таких как болезнь Крона, Konstantinos et al., The Journal of Immunology, 2005, 174: 4985-4990 (2005); Bamias et al., J. Immunol. 171:4868-74 (2003). Следовательно, блокирование пути TL1A/DR3 может дать возможность лечения болезни Крона.
TL1A увеличивает образование IFN-y посредством анти-CD3 плюс анти-CD28 и IL-12/IL-18-стимулированных Т-клеток периферической крови (ПК). Активация DR3 под действием TL1A индуцирует образование сигнального комплекса, включая TRADD, TRAF2 и RIP и активированные NF-KB и ERK, JNK и р38 митоген-активированные протеинкиназные пути; Kang et al., Cytokine, 29:229-35 (2005). TL1A может высвобождаться и циркулировать в гомотримерной растворимой форме; Wen et al., "TL1A-induced NF-KB activation and C-IAP2 production prevent DR3-mediated apoptosis in TF-1 cells", J. Biol. Chem., 278:39251-8 (2003).
Рецепторы смерти и их лиганды играют ключевую роль в поддержании тканевого гомеостаза и физиологическом регулировании запрограммированной клеточной смерти. Связывание лигандов смерти индуцирует олигомеризацию рецептора, вовлечение адаптерного белка посредством консервативного цитоплазматического сигнального элемента, который называется доменом смерти, активацию каспаз и индукцию апоптоза; Young et al., Proc. Natl. Acad. Sci. USA, 103(22):8303-8304 (May 30, 2006).
Хотя рецепторы смерти, такие как Fas/Apo-1/CD95, TNF-R1, TRAIL-R1, TRAIL-R2 или DR3, изначально были описаны как индукторы апоптоза, увеличивается количество свидетельств того, что эти рецепторы также имеют функции, не связанные с апоптозом, включая регуляцию адаптивного иммунного ответа. В статье Bamias et al., Proc. Natl. Acad. Sci. USA, 103:8441-8446 (2006) сообщается о том, что TL1A экспрессируется дендритными клетками собственной пластинки слизистой, и о том, что он действует посредством усиления пролиферации клеток памяти, но не наивных CD4+ Т-клеток, и проявляет синергетический эффект вместе с IL-12 и/или в малых дозах стимулирует рецепторы Т-клеток для резкого повышения экспрессии гена IFN-y. Полагают, что экспрессия IFN-y в кишечнике является маркером воспаления и многие стратегии лечения болезни Крона основаны на многочисленных попытках подавлять активированное состояние иммунной системы. Однако такие попытки (лечение стероидами и имму-носупрессорными лекарственными средствами) не нацелены именно на кишечник и, таким образом, им присущи определенные сложности. Целенаправленная терапия, основанная на использовании антагонистов TNF-a, была успешно введена в 1990-х, и результаты, о которых сообщается в литературном источнике 1, говорят о том, что терапия, направленная именно против TL1A или его рецепторов, может обеспечить альтернативную целенаправленную терапию для этого изнуряющего заболевания.
Как сообщается в статье Bamias et al., Proc. Natl. Acad. Sex. USA, 103:8441-8446 (2006), похоже, TL1A обладает самым сильным эффектом, когда он экспрессируется в кишечнике при воспалении. TL1A в сочетании с IL-12/18 проявляет синергетическое действие при индукции экспрессии IFN-y Т-клетками человека, хотя увеличенная экспрессия также может наблюдаться в естественных киллерах (Migone et al., Immunity., 16:479-492 (2002); Papadakis et al., J. Immunol. 174:4985-4990 (2005); Papadakis et al., J. Immunol. 172:7002-7007 (2004)). В статье Bamias et al., Proc. Natl. Acad. Sci. USA, 103:8441-8446 (2006) впервые сообщалось о схожих наблюдениях, сделанных на моделях болезни Крона на мышах, что расширяет ранее полученные данные, так как указывает на то, что синергизм возникает, когда Т-клеточный рецептор стимулирован слабо или когда Т-клетки подвергаются воздействию IL-12. Несмотря на то что исследователи Bamias et al. не наблюдали синергетического эффекта, когда обработку белком TL1A комбинировали с IL-18, этот результат можно не считать удивительным, поскольку как IL-18, так и TL1A передают сигналы через NF-кВ. Тогда как в исходном сообщении исследователей Migone et al. было показано, что TL1A являлся костимуляторным сигналом для Т-клеток, исследователи Bamias et al. показали, что она является Т-клеткой памяти, которая отвечала более выраженно, в соответствии с увеличенной способностью этой Т-клеточной популяции экспрессировать IFN-y. В силу того, что эта популяция про-лиферирует, она также проявляет более высокие уровни экспрессии рецептора TL1A, таким образом дополнительно увеличивая способность клеток пролиферировать и экспрессировать IFN-y. Это открытие можно считать в некоторой степени неожиданным в связи с тем, что единственным известным рецептором TL1A является DR3-рецептор, содержащий домен смерти, и можно предположить, что включение этого рецептора приводит к клеточной смерти. (TL1A передает сигналы через DR3 - его единственный известный рецептор на поверхности клетки. TL1A также связывается с растворимым рецептором-приманкой (DcR3)). Однако было показано, что NF-кВ-зависимые антиапоптотические гены, такие как ингибитор апоптоза 2, индуцируются белком TL1A (Wen et al., J. Biol. Chem., 278:39251-39258 (2003)), и, следовательно, включение апоптоза или пролиферации может зависеть от типа клеток.
Существующие в настоящее время варианты лечения болезни Крона включают моноклональные антитела против TNF-a, инфликсимаб (Ремикейд; Centocor, Inc., Horsham, PA), моноклональные антитела Адалимумаб (торговое название Humira; Abbott), а также противовоспалительные средства (например, сульфасалазин), кортизон или стероиды (например, преднизон), иммунодепрессанты (например, 6-меркаптопурин) и антибиотики. Однако инфликсимаб является единственным вариантом лечения, который обладает высокой степенью направленности; остальные варианты лечения обладают низкой направленностью; Proc. Natl. Acad. Sci. U.S.A., 103(22): 8303-8304 (May 30, 2006). Это означает, что лечение не нацелено на область заболевания. В то время как инфликсимаб обладает высокой направленностью и, как правило, хорошо переносится, инфликсимаб может вызывать рецидивы туберкулезной инфекции и ухудшения при сердечной недостаточности, демиелинизирующих заболеваниях и увеличение частоты возникновения лимфом.
Следовательно, в данной области сохраняется потребность в композициях, которые можно использовать для лечения и диагностики различных воспалительных и иммунных заболеваний и расстройств, таких как аллергия/астма, ревматоидный артрит, рассеянный склероз, болезнь Крона, воспалительное заболевание кишечника, хроническое обструктивное заболевание легких, псориаз, диабет 1-го типа и отторжение трансплантата. Настоящее изобретение относится к моноклональным антителам против TL1A и удовлетворяет эту потребность.
Краткое изложение сущности изобретения
Раскрыты молекулы антигенсвязывающего полипептида, который специфично связывается с TNF-подобным цитокином TL1A (см. GenBank, инвентарный номер AF520785).
Настоящее изобретение относится к выделенному антигенсвязывающему полипептиду, специфично связывающемуся с TL1A, который содержит:
(a) вариабельную область тяжелой цепи гуманизированного антитела, которая содержит:
(1) CDR-H1, которая содержит аминокислотную последовательность SEQ ID NO:7;
(2) CDR-H2, которая содержит аминокислотную последовательность SEQ ID NO:8;
(3) CDR-H3, которая содержит аминокислотную последовательность SEQ ID NO:9;
(b) вариабельную область легкой цепи гуманизированного антитела, которая содержит:
(1) CDR-L1, которая содержит аминокислотную последовательность SEQ ID NO:35;
(2) CDR-L2, которая содержит аминокислотную последовательность SEQ ID NO:36;
(3) CDR-L3, которая содержит аминокислотную последовательность SEQ ID NO:37.
В одном из вариантов осуществления полипептид по изобретению содержит вариабельную область тяжелой цепи гуманизированного антитела, содержащую аминокислотную последовательность SEQ ID
NO:10.
В другом варианте осуществления полипептид по изобретению содержит вариабельная область легкой цепи гуманизированного антитела, содержащую аминокислотную последовательность SEQ ID
NO:38.
Также настоящее изобретение относится к антигенсвязывающему полипептиду, специфично связывающемуся с TL1A, который содержит вариабельную область тяжелой цепи гуманизированного антитела, содержащую аминокислотную последовательность SEQ ID NO:10, и вариабельную область легкой цепи гуманизированного антитела, содержащую аминокислотную последовательность SEQ ID NO:38.
В одном из вариантов осуществления полипептид по изобретению относится к полипептиду, выбранному из группы, состоящей из молекулы антитела, фрагмента Fab, фрагмента Fab', фрагмента F(ab')2 и молекулы scFv.
В другом варианте осуществления полипептид по изобретению представляет собой антитело. Настоящее изобретение относится также к выделенному антигенсвязывающему полипептиду, специфично связывающемуся с TL1A, который содержит:
(a) вариабельную область легкой цепи, имеющую последовательность SEQ ID NO:38;
(b) вариабельную область тяжелой цепи, имеющую последовательность SEQ ID NO:10.
Одним вариантом осуществления является также полипептид по изобретению, который представляет собой химерное антитело, содержащее константную область тяжелой цепи человека и константную область легкой цепи человека, предпочтительно указанное антитело представляет собой молекулу IgG (например, молекулу IgG1 или IgG4).
Еще одним вариантом осуществления является полипептид по изобретению, представляющий собой молекулу scFv, при этом предпочтительно scFv имеет формулу NH2-L-VH-X-VK-COOH или NH2-L-VK-X-VH-COOH; где L представляет собой лидерную последовательность; VH представляет собой вариабельную область тяжелой цепи гуманизированного антитела; X представляет собой линкерный полипептид и VK представляет собой вариабельную область легкой цепи гуманизированного антитела.
Другим вариантом осуществления является полипептид по изобретению, представляющий собой фрагмент Fab, слитый с HSA, при этом предпочтительно фрагмент Fab, слитый с HSA, содержит (i) тяжелую цепь, представленную NH2-VH-CH1-HSA-COOH или NH2-HSA-CH1-VH-COOH, и (ii) легкую цепь, представленную NH^VK-CK-СООН, где:
(a) VH представляет собой вариабельную область тяжелой цепи гуманизированного антитела;
(b) CH1 представляет собой константный домен 1 тяжелой цепи человека;
(c) HSA представляет собой сывороточный альбумин человека;
(d) VK представляет собой вариабельную область легкой цепи гуманизированного антитела;
(e) CK представляет собой константный домен к-цепи человека.
Настоящее изобретение относится к также к полипептиду, конъюгированному с терапевтическим или диагностическим средством. Примерами терапевтического средства являются цитотоксическое средство, радиоактивная метка, иммуномодулятор, гормон, фермент, олигонуклеотид, фотоактивное терапевтическое средство или их сочетания. Примерами диагностического средства являются радиоактивная метка, фотоактивное диагностическое средство, активируемое ультразвуком средство или нерадиоактивная метка.
В одном из вариантов осуществления полипептид по изобретению является антагонистом TL1A.
В следующем варианте осуществления полипептид по изобретению не является агонистом TL1A.
В еще одном варианте осуществления полипептид по изобретению связывается с TL1A с константой связывания, составляющей по меньшей мере приблизительно 106M-1, предпочтительно по меньшей мере приблизительно 107M-1, более предпочтительно по меньшей мере приблизительно 108M-1 и наиболее предпочтительно по меньшей мере приблизительно 109M-1.
Изобретение также относится к фармацевтической композиции для лечения или диагностирования воспалительного, иммунного или злокачественного заболеваний или состояний, содержащей полипептид по изобретению в эффективном количестве и носитель.
Фармацевтическая композиция по изобретению может также содержать дополнительное терапевтическое средство, выбранное из группы, состоящей из цитотоксического средства, радиоактивной метки, иммуномодулятора, гормона, фермента, олигонуклеотида, фотоактивного терапевтического средства или их сочетаний, или диагностическое средство, выбранное из группы, состоящей из радиоактивной метки, фотоактивного диагностического средства, активируемого ультразвуком средства или нерадиоактивной метки.
Настоящее изобретение также относится к применению фармацевтической композиции по изобретению для изготовления лекарственного средства для лечения или диагностирования воспалительного, иммунного, злокачественного заболеваний или состояний. Примерами заболеваний или состояний являются аутоиммунное заболевание (например, обыкновенная волчанка), воспалительное заболевание кишечника (IBD), хроническое обструктивное заболевание легких (COPD), артрит (например, ревматоидный артрит), рассеянный склероз, отторжение трансплантата, повреждение центральной нервной системы, Th1-опосредованные заболевания кишечника, такие как болезнь Крона, псориаз, лейкемия или лим-фома (например, хронический лимфолейкоз (CLL)), атеросклероз, карцинома легких и карцинома толстой кишки.
Настоящее изобретение также относится к полинуклеотиду, кодирующему полипептид по изобретению, рекомбинантному полинуклеотиду, который содержит промоторную последовательность, функционально связанную с указанным полинуклеотидом, и выделенной клетке, трансформированной указанным рекомбинантным полинуклеотидом.
Также раскрыт способ получения полипептида, кодируемого рекомбинантным полинуклеотидом по изобретению, где способ включает:
a) культивирование клетки, трансформированной рекомбинантным полинуклеотидом для того, чтобы экспрессировать кодируемый полипептид; и
b) выделение экспрессированного таким образом полипептида.
Как предшествующее общее описание, так и следующее краткое описание чертежей и подробное описание являются иллюстративными и объяснительными и предназначены для того, чтобы предоставить дополнительное объяснение по изобретению, как заявлено. Другие объекты, преимущества и новые признаки будут без труда поняты специалистами в данной области из следующего подробного описания изобретения.
Краткое описание чертежей
На фиг. 1 показано ингибирование активности каспаз, индуцированных с использованием TL1A человека (huTL1A), в клетках TF-1 антителами мыши и хомяка против TL1A. AT № 1 - 19Е06; AT № 2 -12D01; AT № 3 - 15Е09; AT № 4 - 16H02; AT № 5 - 14A03; AT № 6 - 04H08A; AT № 7 - 12F11; AT № 8 -
12D08.
На фиг. 2 показано выравнивание домена VH антитела мыши 16Н02 против TL1A с ближайшим геном зародышевой линией человека, IGHV7-4-1-02. Выравнивание использовали в качестве шаблона для создания 2 различных версий гуманизированной VH 16Н02, обозначенных на чертеже как New Hum
16H02 VH № 1 и 2.
На фиг. 3 показано количество мутаций, отличающих VH мыши от VH человека, и процент гуманизации двух версий VH гуманизированного антитела против TL1A.
На фиг. 4 показано выравнивание домена VK антитела мыши 16Н02 против TL1A с ближайшим геном зародышевой линии человека, А17. Выравнивание использовали в качестве шаблона для создания 2 различных версий гуманизированной VH 16H02, обозначенных на чертеже как New Hum 16H02 VK № 1
и 2.
На фиг. 5 показано количество мутаций, отличающих VK мыши от VK человека, и процент гуманизации двух версий VK гуманизированного антитела 16Н02 против TL1A.
На фиг. 6 показаны результаты временной трансфекции клеток 293F с использованием VH № 1 и 2 антитела человека 16Н02 против TL1A и VK № 1 и № 2 антитела человека 16Н02 против TL1A для получения полноразмерной молекулы гуманизированного антитела.
На фиг. 7 показана активность моноклональных антител 16Н02 против TL1A после одного цикла гуманизации, исходя из ингибирования активности каспаз, индуцированных с помощью TL1A, в клетках TF-1 гуманизированными антителами по сравнению с контрольными антителами мыши против TL1A. 12D01=отрицательный контроль для антитела мыши против TL1A; 16Н02=положительный контроль для антитела мыши против TL1A; 19Е06=контрольное антитело хомяка против TL1A; 3009=гуманизированное антитело 16Н02 VH № 1+VK № 1 против TL1A; 3010=гуманизированное антитело VH № 2+VK № 1 16Н02 против TL1A; 3011=гуманизированное антитело VH № 1+VK № 2 16Н02 против TL1A; 3012 - гуманизированное антитело VH № 2+VK № 2 16Н02 против TL1A.
На фиг. 8 показаны окончательные мутации, которые необходимы для полной гуманизации каркаса VK 16H02. Для создания полностью гуманизированной легкой цепи 16Н02 New Hum 16Н02 VK № 2 (см. фиг. 4) исходную последовательность выравнивали с последовательностью гена зародышевой линии А17 и идентифицировали 3 отдельных области или блока (закрашенные круги) для последующего мутагенеза. Конструировали синтетические легкие цепи, которые содержали все возможные сочетания или из немутированной последовательности дикого типа VK № 2 (=W), или из последовательности гена зародышевой линии А17 (=М) в каждой из 3 областей или блоков.
На фиг. 9 показана временная трансфекция ID и LDC # для окончательных версий VK гуманизированного 16Н02. Создавали синтетические легкие цепи, которые содержали все возможные сочетания или из последовательности дикого типа (W), или из мутантной последовательности (М) в 3 отдельных областях или блоках в New Hum 16H02 VK № 2 с фиг. 8. Затем проводили котрансфекцию синтетическими легкими цепями и New Hum 16H02 VH № 1 с фиг. 2 и полученные антитела тестировали на ингибирова-ние активности каспаз, индуцированных с помощью huTL1A.
На фиг. 10 показано ингибирование активности каспаз, индуцированных с использованием TL1A человека (huTL1A), в клетках TF-1 с помощью набора различных гуманизированных антител против TL1A с фиг. 9. Активность полностью гуманизированного антитела 16Н02 против TL1A, обозначенного как 3038, сравнивали с активностью исходного антитела мыши 16Н02 против TL1A.
На фиг. 11 показано выравнивание последовательностей домена VH пяти ведущих кандидатных антител мыши против TL1A: 1В4, 25В9, 11D8, 27А8 и 38D6.
На фиг. 12 показано выравнивание последовательностей домена VK пяти ведущих кандидатных антител мыши против TL1A: 1В4, 25В9, 11D8, 27А8 и 38D6.
На фиг. 13 показано выравнивание последовательностей гуманизированного домена VH 1В4 (hum 1В4 VH АА) с исходным доменом VH мыши (1В4 VH АА) и ближайшим совпадающим доменом VH зародышевой линии человека (VH2-70-10).
На фиг. 14 показано выравнивание последовательностей гуманизированного домена VK 1В4 (hum 1В4 VK АА) с исходным доменом VK мыши (1В4 VK АА) и ближайшим совпадающим доменом VK зародышевой линии человека (VK-L8).
На фиг. 15 показано ингибирование активности каспаз, индуцированных с использованием TL1A, полученного из млекопитающего, в клетках TF-1 гуманизированными антителами (1В4, 11D8, 25В9) против TL1A в сравнении с антителом мыши 11D8.
Подробное описание предпочтительных вариантов осуществления
Определения.
Антитело, как описано в настоящем документе, относится к полноразмерной (т.е. встречающейся в природе или полученной обыкновенными рекомбинантными процессами с использованием фрагментов генов иммуноглобулинов) молекуле иммуноглобулина (например, к антителу IgG) или к иммунологиче-ски активной (т.е. специфично связывающейся) части молекулы иммуноглобулина, такой как фрагмент антитела.
Фрагмент антитела представляет собой часть антитела, такую как F(ab')2, F(ab)2, Fab', Fab, Fv, scFv и т.п. Независимо от структуры, фрагмент антитела связывается с тем же антигеном, который распознается интактным антителом. Термин "фрагмент антитела" включает аптамеры, шпигельмеры и диатела. Термин "фрагмент антитела" также включает любые синтетические или полученные способами генной инженерии белки, которые ведут себя как антитела, связываясь со специфическим антигеном с образованием комплекса. Например, фрагменты антител включают выделенные фрагменты, состоящие из вариабельных областей, таких как фрагменты "Fv", состоящие из вариабельных областей тяжелой и легкой цепей, рекомбинантные одноцепочечные полипептидные молекулы, в которых вариабельные области легкой и тяжелой цепей соединены пептидным линкером ("белки scFv"), слитые полипептиды Fab HSA, в которых VH-CH1 получен в слитом с HSA виде, который затем укладывается с его родственными VK-CK легкой цепи гуманизированного антитела человека с образованием Fab, и минимальные распознаю
щие единицы, состоящие из аминокислотных остатков, которые имитируют гипервариабельную область.
Гуманизированное антитело представляет собой рекомбинантный белок, в котором CDR из антитела от животного одного вида, например из антитела грызуна, переносят из вариабельных областей тяжелой и легкой цепей антитела грызуна в вариабельные домены тяжелой и легкой цепей человека или вариабельные домены тяжелой и легкой цепей, которые мутировали таким образом, что они содержат по меньшей мере часть аминокислотной последовательности вариабельных доменов тяжелой и легкой цепей человека (что отражено в "проценте гуманизации"). Константные домены молекулы антитела могут быть получены из константных доменов антитела человека.
Как применяют в настоящем документе, "процент гуманизации" вычисляют по количеству аминокислот в каркасной области, различающихся (т.е. различия не в CDR) между гуманизированным доменом и доменом зародышевой линии, которое вычитают из общего количества аминокислот и затем делят разность на общее количество аминокислот, умноженное на 100.
Как применяют в настоящем документе, "CDR" обозначает "гипервариабельный участок", который присутствует в вариабельном домене тяжелой цепи (VH) антитела или в вариабельном домене легкой цепи антитела (VL или VK). Каждый вариабельный домен содержит по три CDR, среди них CDR, которые присутствуют в вариабельном домене тяжелой цепи, обозначаются как CDR-H1, CDR-H2 и CDR-H3, и CDR, которые присутствуют в вариабельном домене легкой цепи, обозначаются как CDR-L1, CDR-L2 и CDR-L3. В настоящем документе используется система нумерации по Кабату. По существу, CDR-H1 начинается приблизительно с 31-й аминокислоты (т.е. приблизительно через 9 остатков после первого остатка цистеина), содержит приблизительно 5-7 аминокислот и заканчивается на следующем остатке триптофана. CDR-H2 начинается с пятнадцатого остатка после конца CDR-H1, содержит приблизительно 16-19 аминокислот и заканчивается на следующем остатке аргинина или лизина. CDR-Ю начинается приблизительно с тридцать третьего аминокислотного остатка после конца CDR-H2; содержит 3-25 аминокислот и заканчивается на последовательности W-G-X-G, где X обозначает любую аминокислоту. CDR-L1 начинается приблизительно с 24 остатка (т.е. после остатка цистеина); содержит приблизительно 10-17 остатков и заканчивается на следующем остатке триптофана. CDR-L2 начинается приблизительно с шестнадцатого остатка после конца CDR-L1 и содержит приблизительно 7 остатков. CDR-L3 начинается приблизительно с тридцать третьего остатка после конца CDR-L2 (т.е. после остатка цистеи-на); содержит приблизительно 7-11 остатков и заканчивается на последовательности F или W-G-X-G, где X обозначает любую аминокислоту.
Конъюгирование с терапевтическим или диагностическим средством.
Антигенсвязывающие полипептиды, описываемые в настоящем документе, можно конъюгировать или слить с терапевтическим средством, которое может включать радиоактивные метки, иммуномодуля-торы, гормоны, фотоактивные терапевтические средства, цитотоксические средства, которые могут представлять собой лекарственные средства или токсины, и их сочетания. Лекарственные средства могут включать любые лекарственные средства, которые обладают фармакологическими свойствами, выбранными из группы, состоящей из антимитотических, антикиназных, алкилирующих, антиметаболических средств, антибиотиков, алкалоидов, антиангиогенных, апоптотических средств и их сочетаний. Более конкретно, эти лекарственные средства выбраны из группы, состоящей из азотистых ипритов, производных этиленимина, алкилсульфонатов, нитрозомочевин, триазенов, аналогов фолиевой кислоты, ингибиторов ЦОГ-2, аналогов пиримидина, аналогов пурина, антибиотиков, ферментов, эпиподофиллотокси-нов, координационных комплексов платины, алкалоидов барвинка, замещенных мочевин, производных метилгидразина, супрессоров коры надпочечников, антагонистов, эндостатина, таксолов, камптотецинов, антрациклинов, таксанов и их аналогов, и их сочетаний. Токсины, включенные в настоящее изобретение, могут быть выбраны из группы, состоящей из рицина, арбина, а-токсина, сапорина, рибонуклеазы (РНКазы), например онконазы, ДНКазы I, стафилококкового энтеротоксина-А, антивирусного белка ла-коноса, гелонина, дифтерийного токсина, экзотоксина Pseudomonas и эндотоксина Pseudomonas.
Иммуномодуляторы могут быть выбраны из группы, состоящей из цитокинов, факторов роста стволовых клеток, лимфотоксина, гемопоэтического фактора, колониестимулирующих факторов (CSF), интерферонов (IFN), эритропоэтина, тромбопоэтина и их сочетаний. Особенно эффективны такие лим-фотоксины, как фактор некроза опухоли (TNF), гемопоэтические факторы, такие как интерлейкины (IL), колониестимулирующие факторы, такие как гранулоцитарный колониестимулирующий фактор (G-CSF) или гранулоцитарно-макрофагальный колониестимулирующий фактор (GM-CSF)), интерфероны, такие как интерфероны-а, -р или -у, и факторы роста стволовых клеток, например фактор, обозначаемый как "фактор S1". Более конкретно, иммуномодуляторы могут включать IL-1, IL-2, IL-3, IL-6, IL-10, IL-12, IL-18, IL-21, интерферон-у, TNF-а или их сочетания.
Антигенсвязывающие полипептиды, описываемые в настоящем документе, могут быть конъюгиро-ваны или слиты с диагностическим средством. Диагностические средства могут включать фотоактивные диагностические средства или радиоактивные метки, которые обладают энергией между 60 и 4000 кэВ, или нерадиоактивные метки. Радиоактивные метки предпочтительно представляют собой у-, р- и позитрон испускающие изотопы, выбранные из группы, состоящей из 125I, 131I, 123I, 124I, 86Y, 186Re, 188Re, 62Cu,
64Cu, 111In, 67Ga, 68Ga, 99mTc, 94mTc, 18F, 11C, 13N, 15O, 76Br и их сочетаний. Диагностические средства могут включать контрастные средства, например, такие как марганец, железо или гадолиний.
Типичные способы получения антител против TL1A с использованием гибридомной технологии.
Мышей BALB/C можно иммунизировать рекомбинантным белком TL1A (внеклеточный домен). В типичной процедуре 10 мг белка в 50 мл полного адъюванта Фрейнда (Sigma) вводят подкожно. Через 2-недельные интервалы можно вводить от двух до четырех дополнительных инъекций в неполном адъю-ванте Фрейнда, за которыми следует конечная иммунизация антигеном в PBS. Альтернативно, инъекции можно вводить в подушечку стопы. Через три дня мышей забивают, удаляют селезенки или подколенные лимфатические узлы, а лимфоциты можно выделять для слияния. Лимфоциты можно сливать с клетками плазмоцитомы P3X63Ag8.653 в соотношении 5:1 с использованием PEG/DMSO (Sigma) в качестве средства для слияния. После слияния клетки можно ресуспендировать в селективной среде HAT и высеять по 106 клеток на лунку в 96-луночные планшеты. Используя супернатанты от гибридом, которые выжили при отборе в HAT, можно проводить скрининг в прямом ELISA на присутствие антител, связывающихся с TL1A. Можно идентифицировать гибридомы, которые секретируют антитела, связывающиеся с TL1A, и можно проводить дополнительный скрининг из супернатантов на антитела, ингибирующие связывание TL1A с его рецептором DR3, посредством ингибирования связывания в ELISA. Затем гибридомы, для которых подтверждено ингибирование связывания TL1A, можно использовать в скрининге на ингибиро-вание активности каспаз, индуцированных с использованием TL1A, в клетках TF-1, чтобы идентифицировать клоны, продуцирующие антагонисты TL1A.
Типичная стратегия гуманизации антитела.
Одной из задач гуманизации антител против TL1A является получение доменов VH и VK, которые гуманизированы на 70-100% и сохраняют исходную аффинность и специфичность связывания на 90100%. Сайт-специфический мутагенез отдельных положений с высоким риском в VH и VK можно использовать для дальнейшей гуманизации антител при сохранении аффинности и специфичности связывания.
Гуманизацию можно осуществлять посредством переноса CDR и структурного анализа и воссоздания поверхности вариабельной области (см. Jones et ah, NATURE (1986) May 29-Jun. 4; 321(6069):522-5; Roguska et al., PROTEIN ENGINEERING, 1996, 9(10):895-904 и Studnicka et ah, Humanizing Mouse Antibody Frameworks While Preserving 3-D Structure. PROTEIN ENGINEERING, 1994, vol. 7, с. 805). Данные об исходной последовательности антитела и трехмерной структуре можно использовать для того, чтобы идентифицировать ключевые каркасные остатки, которые необходимы для сохранения аффинности и специфичности связывания. Веб-сайт "Blast for Ig sequences", поддерживаемый NCBI, можно использовать для того, чтобы идентифицировать ближайшие совпадения с областями VH и VK мыши, использованными в исследовании. Гены VH и VK зародышевой линии человека можно выбрать в качестве генов, лучше всего совпадающих с последовательностями VH и VK мыши. Альтернативно, последовательности из естественно экспрессируемого репертуара антител человека можно использовать в качестве шаблона для гуманизации в отдельности или в сочетании с ближайшим совпадающим геном зародышевой линии человека.
После выравнивания VH и VK антитела мыши против TL1A с ближайшими генами зародышевой линии человека или с генами из экспрессируемого репертуара можно оценить вероятное влияние каждого аминокислотного положения на связывание и иммуногенность. Эту информацию можно использовать для того, чтобы определить низкую, умеренную или высокую степень риска для мутации в каждом положении. В одном из вариантов осуществления мутациям подвергаются только положения с низким или умеренным риском и при этом избегают положений с высоким риском. При необходимости, можно использовать способ созревания аффинности посредством встраивания тирозинов попарно в каждое положение в CDR VH, VK или обоих.
Типичное клонирование и секвенирование доменов VH и VK антитела мыши против TL1A из гиб-ридомных клеточных линий.
Гибридомные клетки можно осадить, промыть три раза в PBS и выделить РНК с помощью тризола (Invitrogen, номер по каталогу 15596-026), придерживаясь протокола производителя. Из общей РНК можно получить кДНК с использованием набора 5' RACE (Rapid Amplification of cDNA Ends, Invitrogen, номер по каталогу 18374-058), придерживаясь протокола производителя. В кратком изложении РНК можно лигировать со случайным гексамерным праймером, Random N6, а одноцепочечную кДНК можно получить с использованием отрицательной РНК-зависимой ДНК-полимеразы Superscript II RNAase H. кДНК можно очистить с помощью картриджа для центрифугирования GlassMax, который предоставлен с набором, и провести реакцию с TdT (терминальная дезоксинуклеотидилтрансфераза) в присутствии dCTP, чтобы присоединить к 5'-концу кДНК пару оснований С. кДНК с dC на хвосте можно амплифици-ровать в ПЦР с использованием якорного праймера со специфичностью к dC-хвосту и праймеров со специфичностью к генам, которые гибридизуются с высококонсервативными последовательностями ДНК в константном домене 1 тяжелой цепи мыши (СН1) для получения VH и в константном домене к (CK) для получения VK. Полученный продукт ПЦР можно анализировать электрофорезом в геле, чтобы подтвердить соответствие размеров продуктов размерам интактных доменов VH или VK, затем очистить и лиги
ровать в вектор ТОРО ТА (Invitrogen, номер по каталогу K4575-01), придерживаясь протокола производителя. После трансформации в бактерии ДНК можно получить из клонов, содержащих вставку правильного размера, а последовательность ДНК можно определить с использованием реакционной смеси для секвенирования Big Dye Terminator (Applied Biosystems, номер по каталогу 4336699) и ДНК-анализатора 3700 ABI/Prism, придерживаясь протокола производителя. Типичная гуманизация антител мыши против TL1A.
Антитела мыши против TL1A можно идентифицировать на основе данных о связывании и данных о последовательности, полученных, как описано выше. Аминокислотную последовательность доменов VH и VK этих антител можно выровнять с доменами VH и VK зародышевой линии человека с использованием доступных на сегодняшний день публичных баз данных (т.е. "Blast for IgG" в NCBI и "V-base" в MRC). В тех положениях, в которых каркас последовательности мыши отличается от зародышевой линии человека, можно использовать итеративный процесс для того, чтобы превратить или мутировать каркас мыши так, чтобы он совпадал с соответствующим каркасом зародышевой линии человека. Кроме того, или альтернативно, определенные аминокислотные остатки в CDR VH и VK можно мутировать посредством замены на тирозин (т.е. сделать аффинно зрелыми), чтобы с некоторой вероятностью компенсировать любое снижение аффинности, вызванное изменениями каркасных остатков. Аффинно-зрелые и гуманизированные домены VH и VK мыши можно создать с помощью полимеразной цепной реакции с использованием набора перекрывающихся синтетических олигонуклеотидных ДНК. В качестве части процесса конструирования синтетического гена можно использовать способ оптимизации кодо-нов, другими словами, во все аминокислотные позиции можно встроить кодоны, которые предпочтительно используются клетками млекопитающих для экспрессии генов. Синтетические домены VH и VK можно клонировать в специализированные векторы для экспрессии в млекопитающих, которые делают возможной экспрессию соответствующих доменов в случае полностью гуманизированного остова антитела IgG1, G4 или к. Мелкомасштабное получение гуманизированных антител можно осуществить посредством котрансфекции клеток 293F конструкцией IgGl или IgG4 совместно с к-конструкцией с использованием Lipofectamine (Invitrogen), придерживаясь протокола производителя. Супернатанты от временно трансфицированных клеток можно пропустить через смолу с белком А или с белком G, и IgG можно очистить до гомогенности для тестирования в клеточных тестах.
Следующие примеры приведены для того, чтобы проиллюстрировать настоящее изобретение. Однако следует понимать, что изобретение не ограничивается конкретными условиями или деталями, описанными в этих примерах. Все опубликованные и/или общедоступные документы, описываемые в настоящем документе, в полном объеме включены по ссылке.
Пример 1.
Ранее продемонстрировано получение аминокислотных последовательностей доменов VH и VK моноклональных антител мыши и хомяка против TL1A, как описано в настоящем документе. Области CDR вариабельных доменов подчеркнуты.
12D08 VK:
DVLMTQTPLS LPVSLGDQAS ISCRSSQSIV HSNGMTYLDW YLQKPGQSPN LLIYKVSNRF SGVPDRFSGS GSGTDFTLKI SRVEAEDLGV YYCFQGSHVP LTFGAGTKLE LKR
16H02 VK:
DVLMTQTPLS LPVSLGDQAS ISCKSSQNIV HSDGNTYLEW YLQKPGQSPK LLIYKVSNRF SGVPDRFSGS GSGTDFTLKI SRVEAEDLGV YYCFQGSHVP LTFGSGTKLE IKR
15E09 VK:
ETTVTQSPAS LSMAIGEKVT IRCITSTDID DDMNWYQQKP GEPPKLLISE GNTLRPGVPS RFSSSGYGTD FVFTIENMLS EDVADYYCLQ SDNLPLTFGA GTKLELKR 19E06 VK:
DIVMTQSPSS LAVSTGGTVT LTCLSSQSLF SSDTNKNYLN WYLQKPGQSP KLLVYHASTR LTGVPDRFIG SGSGTDFTLT INSVQAEDLG DYYCQQHFRP PFTFGRGTKL БIKR
IB4 VK AA
QIVLTQSPAIMSASIXJAEITLTCSASSSVNYMHWYQQRSGTSPKLLIYSTSNLASGVP SRFSGSGSGTFYSLTISSVEAEDAADYYCHQWNHYGTFGGGTKLEIKR 25B9 VK AA
EHVLTQSPAILAASLCTOKVTMTCSASSSVSSGYLHWYQQKSGASPKPLIHRTSNIiASG VPPRFSGSGSGTSYSLSISSVEAEDDATYYCQQWSGFPFTFOSGTKLEIKR 27A8 VK AA
DIVLTQSPASLTVSIjGQPATISCRASQNVSTSSYSHMHWSQQKPgQPPKbLIKYASML DSGVPARFSGSGSGTDFTbHIHPVEEEDIATYYCQHSWEIPYTFGGGTKLEIKR 11D8 VK AA
DIVWrQSPASLWSLGQRATISC3tASQSVSTSSYSHMHWYQQKPGQPPKLLIRYASNL ESGVPARFSGSGSGTDFTLNIHPVBBBDTAIYYOQHSWELPYTFGGGTKLEIKR 38D6 VK AA
DIVLTQFPASLPVSLGQRATISCRASQSVSTSSYSHMHWYQQKPGQPPKLLITYASNL DSGVPARISGSGSGTDFTLNIHPVBBEDTATYYCHHSWELPYTFGGGTKLEIKR 12D08 VH:
QIQLVQSGPE LKKPGETVKI SCKASGYTFT NYGMNWVKQA PGKGLKWMGW INTYTGEPTY ADDFKGRFAF SLETSASTAY LQINNLKNED MATYFCAKDY
GKYGDYYAMD YWGQGTSVTV SS 16H02 VH:
QIQLVQSGPE LKKPGETVKI SCKASGYTFT LYGMNWVKQA PGKGLKWMGW INTYTGEPTY ADDFKGRFAF SLETSASTAY LQINTLKNED MATYFCARDT AMDYAMAYWG QGTSVTVSS
15E09 VH:
EVKLVD3GGG LVQPGDSLRL SCATSGFTFS DFYMEWVRQP PGKRLBWIAA SGNKANDYTT EYSASVKGRF IVSRDTSQSI LYLQMNDLRA EDTAIYYCVR DAGYGYWYFD VWGAGTTVTV SS
19E06 VH:
QIQLQESGPS LVKPSQSLSL TCSVTGYSIT SDSYWNWIRQ FPGKNLVWMG YISYRGSTNY HPSLKSRISI TRDTSRNQFF LQLNSVTTED TATYYCARYS GYSFWYFDFW GQGTQVTVSS
1B4 VH
QVTLKESGPGII^PSQTLSLTCSFSGFSLTTSmGVVWIRQPSGKGLEWIJJilLWPDREYSNP ALKSRLTISKDPFNNQVFLKIAHVDTADTATYYCARMSRWYYGSSYVMDYWGQGTSVTVSS 25B9 VH
EVQLQQSGPBLVKPGASVKMSCKASGYTFTSYVMHWVKQKTGQGLEWIGYINSNNDGT KYNEKFKGKATLTSDKSSSTAYMELSSLTSEDSAVYYCATGDYYGGTSYWYroVWGAGTTVTV SS
11D8 VH
EVQbQQSGPEbEKPGASVKISCKASGYSFTGYtmHWVKQSNGKSLEWIGNIDPYFGDT NYNQNFKGRATbTVDK^SNTAYMQbMSLTSEDSAVYYCAREGAARAKNYFDYWGQGTTL'rVSS 27A8 VH
EVQLQQSGPELETPGASWISCKASGYSFTGYHHHWVKQTNGKSLEWIGNIDPYFGDA NYNRKFKGKATLTVDKSSSTAYMQLRSLT3EDSAVYYCAKEGAARAKNYFDYWG0GTTLTVSS 38D6 VH AA
EVQIjQQSGPELEKPGASVKISCKASGYSFTGYNMWWVRQTNGKSLEWIGHIDPYYGDA TYRQKFKGKATLTVDKSSNTAYMQLKSLTSEDSAVYFCAREGAAPJUiNYFDYWGOGTTLTVSS
Пример 2.
В этом примере описан протокол теста для измерения ингибирования активности каспаз, индуцированных с использованием TL1A, в клетках TF-1.
Для определения нейтрализующей активности антител против TL1A определяли их влияние на активность каспаз, индуцированных с использованием TL1A, в клетках TF-1; см. фиг. 1. Клетки TF-1 высевали по 75000 клеток на лунку в черный 96-луночный планшет с прозрачным дном в среду RPMI, содержащую 1% эмбриональной телячьей сыворотки. Клетки обрабатывали 10 мкг/мл циклогексамидом и 100 нг/мл TL1A в присутствии или в отсутствие различных концентраций родительских антител мыши или хомяка против TL1A в течение 6 ч при 37°С. Активность каспаз измеряли с помощью Apo-One Homogeneous Caspase-3/7 Assay Kit (Promega). В каждую лунку с клетками добавляли равные объемы буфера Apo-One Homogeneous Caspase-3/7 Assay, содержащего субстрат каспаз Z-DEVD-Rhodamine. После инкубирования в течение ночи измеряли флуоресценцию во флуоресцентном ридере планшетов Wallac Vic-tor2 с фильтром для возбуждающего света 485 нм и фильтром для испускаемого света 535 нм.
Результаты, приведенные на фиг. 1, показывают, что уровень флуоресценции, который коррелирует с активностью каспаз, снижается при увеличении концентрации четырех (4) различных антител против TL1A: AT № 1 - 19Е06, AT № 3 - 15Е09, AT № 4 - 16Н02 и AT №8 - 12D08.
Специалистам в данной области будет ясно, что различные модификации и изменения можно выполнять в способах и композициях по настоящему изобретению без отклонения от сущности или объема изобретения. Таким образом, подразумевается, что настоящее изобретение покрывает модификации и изменения по данному изобретению, предусмотренные объемом прилагаемыми пунктами формулы изобретения и их эквивалентами.
Список последовательностей
<110> SMITH, RODGER
KANAKARAJ, PALANISAMY ROSCHKE, VIKTOR ROSEN, CRAIG COOKSEY, BRIDGET A.
<120> ГУМАНИЗИРОВАННЫЕ АНТИТЕЛА ПРОТИВ TL1A
<130> 075977-0208
<140> 12/270,673 <141> 2008-11-13
<150> 60/987,651 <151> 2007-11-13
<160> 79
<170> Patentln version 3.5
<210> 1 <211> 5 <212> Белок
<213> Искусственная последовательность
<220>
<223> Описание искусственной последовательности: синтетический пептид
<220>
<221> MOD_RES
<222> (11.. <1]
<223> Leu, Ser или Asn
<220>
<221> MOD_RES <222> (3)..(3) <223> Gly или Ala
<400> 1
Хаа Туг Хаа Met Asn
<210> 2 <211> 17 <212> Еелок
<213> Искусственная последовательность <220>
<223> Описание искусственной последовательности: синтетический пептид <220>
<221> MOD_RES <222> {5)..(5) <223> Туг или Asn
<220>
<221> MOD_RES <222> (8)..(8) <223> Glu или Asn
<220>
<221> MOD RES <222> (ХЗТ..(13) <223> Asp или Gin
<220>
<221> M00_RES <222> (14).. (14) <223> Asp или Gly
<220>
<221> MOD_RES <222> (16)..(16) <223> Lys или Thr
<400> 2
Trp Не Asn Thr Хаа Thr Gly Хаа Pro Thr Туг Ala Хаа Хаа Phe Хаа
15 10 15
Gly
<210> 3 <211> 13 <212> Белок
<213> Искусственная последовательность <220>
<223> Описание искусственной последовательности: синтетический пептид <220>
<221> MOD_RES <222> (2)..(2) <223> Thr или Туг
<220>
<221> MOD_RES <222> (3)..(3) <223> Ala или Gly
<220>
<221> MOD_RES <222> (4).. (4) <223> Met или Lys
<220>
<221> MOD_RES <222> (5)..(5) <223> Asp или Туг
<220>
<221> MOD_RES <222> (6)..(6) <223> Туг или Gly
<220>
<221> MOD_RES <222> (7)..(7) <223> Ala или Asp
<220>
<221> MOD_RES <222> (8)..(8) <223> Met или Туг
<223> Описание искусственной последовательности: синтетический пептид
<220>
<221> MOD_RES <222> (6)..(6) <223> Phe или Asp
<400> 5
Lys Val Ser Asn Arg Xaa Ser 1 5
<210> 6 <211> 9 <212> Белок
<213> Искусственная последовательность <220>
<223> Описание искусственной последовательности: синтетический пептид
<220>
<221> MOD_RES <222> (1)..(1) <223> Phe или Met
<220>
<221> MOD_RES <222> (4).. (4) <223> Ser или Thr
<220>
<221> MOD_RES <222> (6)..(9)
<223> May или may not be present <400> 6
Xaa Gin Gly Xaa His Val Pro Leu Thr 1 5
<210> 7 <211> 7 <212> Белок
<213> Искусственная последовательность <220>
<223> Описание искусственной последовательности: синтетический пептид
<400> 7
Thr Ser Asn Met Gly Val Val 1 5
<210> 8 <211> 16 <212> Белок
<213> Искусственная последовательность <220>
<223> Описание искусственной последовательности: синтетический пептид
<211> 5 <212> Белок
<213> Искусственная последовательность <220>
<223> Описание искусственной последовательности: синтетический пептид
<400> 11
Leu Туг Gly Met Asn 1 5
<210> 12 <211> 5 <212> Белок
<213> Искусственная последовательность <220>
<223> Описание искусственной последовательности: синтетический пептид
<400> 12
Asn Туг Gly Met Asn 1 5
<210> 13 <211> 17 <212> Белок
<213> Искусственная последовательность <220>
<223> Описание искусственной последовательности: синтетический пептид
<400> 13
Trp Не Asn Thr Туг Thr Gly Glu Pro Thr Tyr Ala Asp Asp Phe Lys
15 10 15
Gly
<210> 14 <211> 10 <212> Белок
<213> Искусственная последовательность <220>
<223> Описание искусственной последовательности: синтетический пептид <400> 14
Asp Thr Ala Met Asp Tyr Ala Met Ala Tyr
1 5 10
<210> 15 <211> 13 <212> Белок
<213> Искусственная последовательность <220>
<223> Описание искусственной последовательности: синтетический пептид
<400> 15
Asp Туг Gly Lys Туг Gly Asp Туг Туг Ala Met Asp Туг 15 10
<210> 16 <211> 16 <212> Белок
<213> Искусственная последовательность <220>
<223> Описание искусственной последовательности: синтетический пептид
<400> 16
Lys Ser Ser Gin Asn He Val His Ser Asp Gly Asn Thr Tyr Leu Glu
15 10 15
<210> 17 <211> 16 <212> Белок
<213> Искусственная последовательность <220>
<223> Описание искусственной последовательности: синтетический пептид <400> 17
Arg Ser Ser Gin Ser He Val His Ser Asn Gly Asn Thr Tyr Leu Asp
15 10 15
<210> 18 <211> 7 <212> Белок
<213> Искусственная последовательность <220>
<223> Описание искусственной последовательности: синтетический пептид <400> 18
Lys Val Ser Asn Arg Phe Ser 1 5
<210> 19 <211> 9 <212> Белок
<213> Искусственная последовательность <220>
<223> Описание искусственной последовательности; синтетический пептид
<400> 19
Phe Gin Gly Ser His Val Pro Leu Thr 1 5
<210> 20 <2U> 122 <212> Белок
<213> Искусственная последовательность <220>
<223> Описание искусственной последовательности: синтетический полипептид
<220>
<221> "0D_RES <222> (2)..(2) <223> Val или Не
<220>
<221> MOD_RES <222> (9)..(9) <223> Ser или Его
<220>
<221> MOD_RES <222> (16)..(16) <223> Ala или Glu
<220>
<221> MOD_RES <222> (17)..(17) <223> Ser или Thr
<220>
<221> MOD_RES <222> (20)..(20) <223> Val или Не
<220>
<221> MOD_RES <222> (31)..(31) <223> Leu, Ser или Asn
<220>
<221> MOD_RES <222> (33)..(33) <223> Gly или Ala
<220>
<221> MOD RES <222> (387..(38) <223> Arg или Lys
<220>
<221> MOD_RES <222> (43)..(43) <223> Gin или Lys
<220>
<221> MOD_RES <222> (46)..(46) <223> Glu или Lys
<220>
<221> MOD_RES <222> (54)..(54) <223> Туг или Asn
<220>
<221> MOD_RES <222> (57) , . (57) <223> Glu или Asn
<220>
<221> MOD_RES <222> (62).,(62) <223> Asp или Gin
<220>
<221> MOD_RES <222> (63)..(63) <223> Asp или Gly
<220>
<221> MOD_RES <222> (65)..(65) <223> Lys или Thr
<220>
<221> MOD_RES <222> (69)..(69) <223> Val или Ala
<220>
<221> MOD_RES <222> (73)..(73) <223> Asp или Glu
<220>
<221> MOD_RES <222> (76) .. (76) <223> Val или Ala
<220>
<221> MOD_RES <222> (84) .. (84) <223> Ser или Asn
<220>
<221> MOD_RES <222> (85)..(85) <223> Ser или Thr
<220>
<221> MOD__RES <222> (88).. (88) <223> Ala или Asn
<220>
<221> MOD_RES <222> (91)..(91) <223> Thr или Met
<220>
<221> MOD_RES <222> (93)..(93) <223> Val или Thr
<220>
<221> MOD_RES <222> (95)..(95) <223> Туг или Phe
<220>
<223> Описание искусственной
: синтетический полипептид
<220>
<221> MODJIES <222> (7)..(7) <223> Thr или Ser
<220>
<221> MOD_RES <222> (14) . . (14) <223> Thr или Ser
<220>
<221> MOD_RES <222> (15)..(15) <223> Pro или Leu
<220>
<221> MOD_RES <222> (17)..(17) <223> Glu, Asp или Gin
<220>
<221> MOD_RES <222> (18)..(18) <223> Его или Gin
<220>
<221> MOD_RES <222> (24)..(24) <223> Lys или Arg
<220>
<221> MOD_RES <222> (28)..(28) <223> Asn или Ser
<220>
<221> MOD_RES <222> (29)..(29) <223> Не или Leu
<220>
<221> MOD_RES <222> (31)..(31) <223> His или Туг
<220>
<221> MOD_RES <222> (39)..(39) <223> Glu или Asn
<220>
<221> MOD_RES <222> (41),.(41) <223> Туг или Phe
<220>
<221> MOD_RES <222> (42)..(42) <223> Leu или Gin
<220>
<221> MOD_RES <222> (44). . (44) <223> Lys или Arg
<220>
<221> HOD_RES <222> (50) .. (50) <223> Gin, Lys или Arg
<220>
<221> MOD_RES <222> (51)..(51) <223> Leu, Val или Arg
<220>
<221> MOD_RES <222> (60)..(60) <223> Phe или Asp
<220>
<221> MOD_RES <222> 181)..(81) <223> Ser или Asn
<220>
<221> MOD_RES <222> (88)..(88) <223> Leu или Val
<220>
<221> MOD_RES <222> (92)..(92) <223> Туг или Phe
<220>
<221> MOD_RES <222> (94)..(94) <223> Phe или Met
<220>
<221> MOD_RES <222> (97).,(97) <223> Ser или Thr
<220>
<221> MOD_RES
<222> (99)..(102)
<223> May или may not be present
<220>
<221> MOD_RES <222> (103).. (103) <223> Phe или Trp
<220>
<221> MOD_RES <222> (105)..(105) <223> Gly, Ser или Gin
<220>
<221> MOD_RES <222> (109)..(109)
<222> (39)..(39)
<223> Glu, Asn или Asp
<220>
<221> MOD_RES <222> (41)..(41) <223> Туг или Phe
<220>
<221> MOD_RES <222> (42)..(42) <223> Leu или Gin
<220>
<221> MOD_RES <222> (44)..(44) <223> Lys или Arg
<220>
<221> MOD_RES
<222> (50)..(50)
<223> Gin, Lys или Arg
<220>
<221> MOD_RES
<222> (51)..(51)
<223> Leu, Val или Arg
<220>
<221> MOD_RES <222> (60)..(60) <223> Phe или Asp
<220>
<221> MOD_RES <222> (81)..(81) <223> Ser или Asn
<220>
<221> MOD_RES <222> (88)..(88) <223> Leu или Val
<220>
<221> MOD_RES <222> (92)..(92) <223> Туг или Phe
<220>
<221> MOD_RES <222> (94)..(94) <223> Phe или Met
<220>
<221> MOD_RES <222> (97)..(97) <223> Ser или Thr
<220>
<221> MOD RES <222> (997- .(102)
<223> Может присутствовать или не присутствовать <220>
<210> 78
<211> 95
<212> Белок
<213> Homo sapiens
<400> 73
Asp lie Gin Leu Thr Gin Ser Pro Ser Phe Leu Ser Ala Ser Val Gly
15 10 15
Asp Arg Val Thr He Thr Cys Arg Ala Ser Gin Gly He Ser Ser Tyr
20 25 30
Leu Ala Trp Tyr Gin Gin Lys Pro Gly Lys Ala Pro Lys Leu Leu He
35 40 45
Tyr Ala Ala Ser Thr Leu Gin Ser Gly Val Pro Ser Arg Phe Ser Gly
50 55 60
Ser Gly Ser Gly Thr Glu Phe Thr Leu Thr He Ser Ser Leu Gin Pro
65 70 75 80
Glu Asp Phe Ala Thr Tyr Tyr Cys Gin Gin Leu Asn Ser Tyr Pro
85 90 95
<210> 79
<211> 99
<212> Белок
<213> Homo sapiens
<400> 79
Gin Val Thr Leu Lys Glu Ser Gly Pro Ala Leu Val Lys Pro Thr Gin
1 5 10 15
Thr Leu Thr Leu Thr Cys Thr Phe Ser Gly Phe Ser Leu Ser Thr Ser
20 25 30
Gly Met Arg Val Ser Trp He Arg Gin Pro Pro Gly Lys Ala Leu Glu
35 40 45
Trp Leu Ala Arg lie Asp Trp Asp Asp Asp Lys Tyr Tyr Ser Thr Ser
50 55 60
Leu Lys Thr Arg Leu Thr He Ser Lys Asp Thr Ser Lys Asn Gin Val
65 70 75 80
Val Leu Thr Met Thr Asn Met Asp Pro Val Asp Thr Ala Thr Tyr Tyr
85 90 95
Cys Ala Arg
ФОРМУЛА ИЗОБРЕТЕНИЯ
1. Вьщеленный антигенсвязывающий полипептид, специфично связывающийся с TL1A, который
содержит:
(a) вариабельную область тяжелой цепи гуманизированного антитела, которая содержит:
(1) CDR-H1, которая содержит аминокислотную последовательность SEQ ID NO:7;
(2) CDR-H2, которая содержит аминокислотную последовательность SEQ ID NO:8;
(3) CDR-H3, которая содержит аминокислотную последовательность SEQ ID NO:9;
(b) вариабельную область легкой цепи гуманизированного антитела, которая содержит:
(1) CDR-L1, которая содержит аминокислотную последовательность SEQ ID N0:35;
(2) CDR-L2, которая содержит аминокислотную последовательность SEQ ID N0:36;
(3) CDR-L3, которая содержит аминокислотную последовательность SEQ ID N0:37.
2. Полипептид по п.1, где вариабельная область тяжелой цепи гуманизированного антитела содер-
жит аминокислотную последовательность SEQ ID N0:10.
3. Полипептид по п.1, где вариабельная область легкой цепи гуманизированного антитела содержит аминокислотную последовательность SEQ ID N0:38.
4. Антигенсвязывающий полипептид, специфично связывающийся с TL1A, который содержит вариабельную область тяжелой цепи гуманизированного антитела, раскрытую в п.2, и вариабельную область легкой цепи гуманизированного антитела, раскрытую в п.3.
5. Полипептид по любому из пп.1-4, где полипептид выбран из группы, состоящей из молекулы антитела, фрагмента Fab, фрагмента Fab', фрагмента F(ab')2 и молекулы scFv.
6. Полипептид по п.5, где молекула представляет собой молекулу антитела.
7. Полипептид по п.6, который содержит:
(a) вариабельную область легкой цепи, имеющую последовательность SEQ ID N0:38;
(b) вариабельную область тяжелой цепи, имеющую последовательность SEQ ID N0:10.
8. Полипептид по п.7, который представляет собой химерное антитело, которое содержит константную область тяжелой цепи человека и константную область легкой цепи человека.
9. Полипептид по п.8, где антитело представляет собой молекулу IgG (например, молекулу IgG1 или IgG4).
10. Полипептид по п.5, где полипептид представляет собой молекулу scFv.
11. Полипептид по п.10, где scFv имеет формулу NH2-L-VH-X-VK-C00H или NH2-L-VK-X-VH-C00H, где L представляет собой лидерную последовательность; VH представляет собой вариабельную область тяжелой цепи гуманизированного антитела; X представляет собой линкерный полипептид и VK представляет собой вариабельную область легкой цепи гуманизированного антитела.
12. Полипептид по п.5, представляющий собой фрагмент Fab, слитый с HSA.
13. Полипептид по п.12, где фрагмент Fab, слитый с HSA, содержит: (i) тяжелую цепь, представленную NH2-VH-CH1-HSA-C00H или NH2-HSA-CH1 -VH-C00H, и (ii) легкую цепь, представленную
NH2-VK-CK-C00H, где:
(a) VH представляет собой вариабельную область тяжелой цепи гуманизированного антитела;
(b) CH1 представляет собой константный домен 1 тяжелой цепи человека;
(c) HSA представляет собой сывороточный альбумин человека;
(d) VK представляет собой вариабельную область легкой цепи гуманизированного антитела;
(e) CK представляет собой константный домен к-цепи человека.
14. Полипептид по любому из пп.1-13, конъюгированный с терапевтическим или диагностическим средством.
15. Полипептид по п.14, где терапевтическое средство выбрано из группы, состоящей из цитоток-сического средства, радиоактивной метки, иммуномодулятора, гормона, фермента, олигонуклеотида, фотоактивного терапевтического средства или их сочетания.
16. Полипептид по п.14, где диагностическое средство выбрано из группы, состоящей из радиоактивной метки, фотоактивного диагностического средства, активируемого ультразвуком средства или нерадиоактивной метки.
17. Полипептид по любому из пп.1-16, где полипептид является антагонистом TL1A.
18. Полипептид по любому из пп.1-16, где полипептид не является агонистом TL1A.
19. Полипептид по любому из пп.1-18, где полипептид связывается с TL1A с константой связывания, составляющей по меньшей мере приблизительно 106М-1.
20. Полипептид по п.19, где полипептид связывается с TL1A с константой связывания по меньшей мере приблизительно 107M-1.
21. Полипептид по п.19, где полипептид связывается с TL1A с константой связывания по меньшей мере приблизительно 108M-1.
22. Полипептид по п.19, где полипептид связывается с TL1A с константой связывания по меньшей мере приблизительно 109M-1.
23. Фармацевтическая композиция для лечения или диагностирования воспалительного, иммунного или злокачественного заболеваний или состояний, содержащая любой из полипептидов по пп.1-22 в эффективном количестве и носитель.
24. Композиция по п.23, которая также содержит дополнительное терапевтическое средство, выбранное из группы, состоящей из цитотоксического средства, радиоактивной метки, иммуномодулятора, гормона, фермента, олигонуклеотида, фотоактивного терапевтического средства или их сочетаний, или диагностическое средство, выбранное из группы, состоящей из радиоактивной метки, фотоактивного диагностического средства, активируемого ультразвуком средства или нерадиоактивной метки.
25. Применение композиции по п.23 или 24 для изготовления лекарственного средства для лечения или диагностирования воспалительного заболевания или состояния.
26. Применение композиции по п.23 или 24 в изготовлении лекарственного средства для лечения или диагностирования иммунного заболевания или состояния.
27. Применение композиции по п.23 или 24 в изготовлении лекарственного средства для лечения или диагностирования злокачественного заболевания или состояния.
28. Применение по любому из пп.25-27, где заболевание или состояние выбрано из группы, состоя
14.
щей из аутоиммунного заболевания (например, обыкновенной волчанки), воспалительного заболевания кишечника (IBD), хронического обструктивного заболевания легких (C0PD), артрита (например, ревматоидного артрита), рассеянного склероза, отторжения трансплантата, повреждения центральной нервной системы, Th1-опосредованных заболеваний кишечника, таких как болезнь Крона, псориаза, лейкемии или лимфомы (например, хронический лимфолейкоз (CLL)), атеросклероза, карциномы легких и карциномы толстой кишки.
29. Полинуклеотид, кодирующий любой из полипептидов по пп.1-22.
30. Рекомбинантный полинуклеотид, который содержит промоторную последовательность, функционально связанную с любым полинуклеотидом по п.29.
31. Выделенная клетка, трансформированная полинуклеотидом по п.30.
32. Способ получения полипептида, кодируемого рекомбинантным полинуклеотидом по п.30, где способ включает:
a) культивирование клетки, трансформированной рекомбинантным полинуклеотидом для того, чтобы экспрессировать кодируемый полипептид;
b) выделение экспрессированного таким образом полипептида.
Конструкция HumVH#1 Hum VH#2
Количество
мутятшй % гуманизации
18 100
13 95
Фиг. 3
Наличии конструкций
Xt п дртни/СП)
Антитело Наш 16Н02 VH Jftl+VKJftl против ТЫ А
LOC3009
1,1 мг(0у4мг/мл)
АттгтелоНтп I6H02VH Л2+УК Jfrl против TL1A
LOC3010
0,76 мг (0,4 мг/мл)
Антитело Нтав 16Н02 УН JM+VK ЗЬ2 против TL1A
LDC3011
1? мг {1# мПчл)
Антитело Нм 14Н02 VH ЛК+VK №2 против TL1A
LDC 3012
2,3 мг (0,8 мг/мл)
Фиг. 6
16H02VK
ID тоансбекинн
LDC# 3030
WWWVer#2
New WWW
3031
WWM
3032
MWM
3033
WMW-1 (QL)
3034
WMW-2(RL)
3035
MWW
3036
MMW
3037
МММ
зозв
Фиг. 9
Фиг. 11
31 ~ - ~ - * "if M H
3i шшшшшшт н
31 TSSYSHMH 31 TSSYSHMH 31 TS SYSHHH
И Y Q Q 3L S S T S P E T. L I
IQQKSGiSPKifLIJ YQQKPGrQPPK L L I НЙ И Ш QQKPGQPPKLLI3S
QQKFGQPPK Ь L Т'Ш
"S 33 S Ы LA S
5 N L A S
S H L :jEfi S
S N L & S
Y A 5 К LiifetS
1B4 VK AA
25B9 VK AA
1XD8 VK AA
27A8 VK AA
38D6 VK AA
В T A T Y Y С ARM5RNYYGS S Y V M D YWGQG TS V 1B4 VH AA
DTATYYC ARMSRNYYGS SYVMD YRGQGTLV hum IS 4 VH AA
DTATYYC AR VH2 -70 - 10
121 T V S S 121 T V S S 99
1B4 VH AA hum IB 4 VH AA
VH2-70-10
Фиг. 13
Евразийская патентная организация, ЕАПВ Россия, 109012, Москва, Малый Черкасский пер., 2
020886
020886
- 1 -
- 1 -
(19)
020886
020886
- 1 -
- 1 -
(19)
020886
020886
- 1 -
- 1 -
(19)
020886
020886
- 4 -
- 3 -
(19)
020886
020886
- 9 -
- 9 -
020886
020886
- 10 -
- 10 -
020886
020886
- 11 -
- 11 -
020886
<220>
020886
- 13 -
- 14 -
020886
020886
- 16 -
- 16 -
020886
020886
- 19 -
- 19 -
020886
020886
- 20 -
- 20 -
020886
020886
- 25 -
- 25 -
020886
020886
- 26 -
- 26 -
020886
020886
- 49 -
- 49 -
020886
020886
- 50 -
- 50 -
020886
020886
- 58 -
- 58 -
020886
020886
- 60 -
- 60 -
020886
020886
- 62 -
- 62 -
020886
020886
- 62 -
- 62 -