Патентная документация ЕАПВ

 
Запрос :  ea000020841b*\id

больше ...
Термины запроса в документе


Полный текст патента

(57) Реферат / Формула:

1. Бифункциональная молекула, содержащая полипептидный партнер связывания, специфический для данного эпитопа рМНС, и полипептид иммунного эффектора, при этом N-конец рМНС партнера связывания связывается с С-концом полипептида иммунного эффектора, при условии, что вышеуказанный полипептидный партнер связывания не является Т-клеточным рецептором, содержащим альфа цепь SEQ ID No:7 и бета цепь SEQ ID No:9.

2. Бифункциональная молекула по п.1, отличающаяся тем, что рМНС партнер связывания представляет собой гетеродимерную α β полипептидную пару TCR, или одноцепочечный α β полипептид TCR, и N-конец α или β цепей гетеродимерной полипептидной пары TCR, или N-конец scTCR полипептида, связывается с С-концом аминокислоты иммунного эффекторного полипептида.

3. Бифункциональная молекула по п.2, отличающаяся тем, что рМНС партнер связывания представляет собой гетеродимерную α β полипептидную пару TCR, в которой α и β каждого полипептида имеют вариабельную и константную области TCR, но не имеют трансмембранной и цитоплазматической областей TCR.

4. Бифункциональная молекула по п.3, отличающаяся тем, что константные области α и β полипептидов связаны дисульфидными мостиками между остатками цистеина, заменяющего Trh 48 экзона 1 TRAC1 и Ser 57 экзона 1 TRAC1 или TRAC2, или нативными дисульфидными связями между Cys4 экзона 2 TRAC1 и Cys2 экзона 2 TRAC1 или TRAC2.

5. Бифункциональная молекула по п.1, отличающаяся тем, что рМНС партнер связывания представляет собой одноцепочечный α β полипептид TCR.

6. Бифункциональная молекула по любому из предшествующих пунктов, отличающаяся тем, что иммунный эффекторный полипептид представляет собой антитело, которое специфически связывается с антигеном, презентированным Т-клеткой.

7. Бифункциональная молекула по п.6, отличающаяся тем, что антитело представляет собой scFv антитело.

8. Бифункциональная молекула по п.6 или 7, отличающаяся тем, что антитело представляет собой анти-CD3 антитело.

9. Бифункциональная молекула по п.8, отличающаяся тем, что антитело представляет собой ОКТ3.

10. Бифункциональная молекула по п.8, отличающаяся тем, что антитело представляет собой UCHT-1.

11. Бифункциональная молекула по п.8, отличающаяся тем, что антитело представляет собой ВМА031.

12. Бифункциональная молекула по п.8, отличающаяся тем, что антитело представляет собой 12F6.

13. Бифункциональная молекула по любому из предшествующих пунктов, отличающаяся тем, что эффекторный полипептид представляет собой цитокин, который модулирует иммуносупрессорную или иммуностимулирующую активность лимфоцитов.


Евразийское 020841 (13) B1
патентное
ведомство
(12) ОПИСАНИЕ ИЗОБРЕТЕНИЯ К ЕВРАЗИЙСКОМУ ПАТЕНТУ
(45) Дата публикации и выдачи патента 2015.02.27
(21) Номер заявки 201101660
(22) Дата подачи заявки 2010.05.19
(51) Int. Cl.
C07K14/705 (2006.01) C12N15/62 (2006.01) A61K38/17 (2006.01) A61K 38/00 (2006.01)
(54) БИФУНКЦИОНАЛЬНЫЕ ПОЛИПЕПТИДЫ
(31) 0908613.3
(32) 2009.05.20
(33) GB
(43) 2012.05.30
(86) PCT/GB2010/000988
(87) WO 2010/133828 2010.11.25
(71) (73) Заявитель и патентовладелец:
ИММУНОКОР ЛТД. (GB)
(72) Изобретатель:
Якобсен Бент Карстен, Вьюдепо Аннелис Бриджит, Ли Йи (GB)
(74) Представитель:
Угрюмов В.М. (RU) (56) WO-A2-0193913
US-A1-2004253632
WO-A2-2006037960
WO-A1-2004074322
WO-A-03020763
WO-A2-2005113595
BIBOLLET-RUCHE FREDERIC ET AL.: "The Quality of Chimpanzee T-Celi Activation and Simian Immunodeficiency Virus/Human Immunodeficiency Virus Susceptibility Achieved via Antibody-Mediated T-Cell Receptor/CD3 Stimulation Is a Function of the Anti-CD3 Antibody Isotype" JOURNAL OF VIROLOGY, vol. 82, no. 20, October 2008 (2008-10), pages 10271-10278, XP002600945 ISSN: 0022-538X * abstract page 10272, column 1, paragraph 4
SCHLITT H. J. ET AL.: "DIFFERENT ACTIVATION STATES OF HUMAN LYMPHOCYTES AFTER ANTIBODY-MEDIATED
STIMULATION VIA CD3 AND THE ALPHA-BETA T CELL RECEPTOR-SCANDINAVIAN JOURNAL OF IMMUNOLOGY, vol. 32, no. 6, 1990, pages 717-726, XP002600946 ISSN: 0300-9475 * abstract
LI BOHUA ET AL.: "Construction and
characterization of a humanized anti-human CD3 monoclonal antibody 12F6 with effective immunoregulation functions" IMMUNOLOGY, vol. 116, no. 4, December 2005 (2005-12), pages 487-498, XP002600947 ISSN: 0019-2805 * abstract
WO-A2-9960120
(57) Бифункциональный полипептид, содержащий специфический партнер связывания для элитопа пептида-МНС, такой как антитело или Т клеточный рецептор (TCR), и иммунный эффектор, такой как антитело или цитокин, при этом имунноэффекторная часть слита с N-концом связывающейся части пептида-МНС.
Изобретение относится к бифункциональному полипептиду, содержащему специфический партнер связывания для эпитопа пептида-МНС, такой как антитело или Т клеточный рецептор ("TCR"), и иммунный эффектор, такой как антитело или цитокин, иммунноэффекторная часть которых связывается с N-концом пептид-МНС связывающей части.
Уровень техники
TCRs непосредственно распознают Специфический Главный Комплекс Гистосовместимости (МНС) - пептидные комплексы ("рМНС комплексы"), которые представлены в виде эпитопов на антиген-презентирующих клетках (АРС), и TCRs непосредственно распознают подобные эпитопы рМНС Т клеток. В связи с этим, TCRs необходимы для функционирования клеточного звена иммунной системы.
Также известно, что антитела специфически связываются с эпитопами рМНС, представленных на антиген-презентирующих клетках (см., например: Neethling F.A. et al., Vaccine (2008) 26 (25): 3092-102). Существуют антиген-связывающие фрагментные антитела (Fab) (см., например: Chames P. et al., Proc NatlAcad Sci USA (2000) 97 (14): 7969-74; Willemsen RA. et al., J Immunol (2005) 174 (12): 7853-8; Willem-sen R. et al., Cytometry A (2008) 73 (11): 1093-9) или одноцепочечные фрагменты антител (scFv) (см., например: Denkberg G. et al., J Immunol (2003) 171 (5): 2197-207; Marget M. et al., Mol Immunol (2005) 42 (5): 643-9), которые специфически связывают элитопы рМНС.
Нативные TCR - это гетеродимерные поверхностные клеточные белки суперсемейства иммунног-лобулинов, которые ассоциированы с инвариантными белками комплекса CD3, учавствующих в опосредованной сигнальной трансдукции. TCRs могут быть в ар и у5 формах, которые структурно похожи, но имеют совершенно разные анатомические локализации и, возможно, функции. Лиганды МНС I и II классов также представляют собой белки суперсемейства иммуноглобулинов, но они специализированы для презентации антигена с высокополиморфным сайтом связывания пептидов, который дает им возможность представлять разнообразную матрицу коротких пептидных фрагментов на поверхности антиген-презентирующей клетки (АРС).
Внеклеточная часть нативных гетеродимерных ар TCRs состоит из двух полипептидов (а и р цепей), каждая из которых имеет мембранно-проксимальный константный домен и мембранно-дистальный вариабельный домен. Каждый константный и вариабельный домены включают внутрицепочечные ди-сульфидные связи. Вариабельные домены содержат высоко полиморфные петли соответствующие гипервариабельному участку (CDRs) антител. CDR3 ар TCRs взаимодействует с пептидом, представленным МНС, а 1 и 2 CDRs ар TCRs взаимодействуют с пептидом и с МНС. Разнообразие последовательностей TCRs образуется через соматическую перестройку взаимосвязанных вариабельных (V), разнообразных (D), соединенных (J) и постоянных генов (С).
Функциональная а цепь полипептидов формируется путем перестройки V-J-C областей, в то время как р цепи состоят из V-D-J-C областей. Внеклеточный константный домен имеет мембранную проксимальную область и иммуноглобулиновую область. При этом одна а цепь константного домена известна как TRAC. р цепь константного домена состоит из двух различных р константных доменов, известных как TRBC1 и TRBC2 (IMGT номенклатура). Встречается четыре аминокислотных замены между этими р константными доменами. Эти замены все находятся внутри экзона 1 TRBC1 и TRBC2: N4K5 -> K4N5 и F37 -> Y (IMGT нумерация, различие TRBC1 -> TRBC2), конечная аминокислотная замена между двумя р цепями константной области TCR находятся в экзоне 3 TRBC1 и TRBC2: V1 -> Е.
Многие конструкции были изобретены на сегодняшний день для производства рекомбинантных TCRs. Эти конструкции делятся на два больших класса: одноцепочечные TCRs и димерные TCRs. Одно-цепочечные TCRs (scTCRs) являются искусственными конструкциями, состоящими из одной аминокислотной нити, которая, подобно нативному гетеродимерному TCRs, связывается с МНС-пептидным комплексом. scTCRs может состоять из комбинации а и р вариабельных областей TCR (Va и VP, соответственно) и а и р константных областей TCR (Cx и Ср, соответственно), связанных линкерной последовательностью (L) в нескольких возможных ориентациях, например, но не ограничиваясь этим, следующих Va-L-VP, Vр-L-Va, Va-Ca-L-VP или Vр-Cр-L-Va.
Многие статьи описывают получение гетеродимерных TCR, которые включают нативный дисуль-фидный мостик, соединяющий соответствующие субъединицы. Однако хотя такие TCR могут распознаваться TCR-специфичными антителами, было показано, что ни одно из них не распознает его нативный лиганд в какой либо мере, за исключением относительно высоких концентраций и/или были нестабильны.
В WO 03/020763 описан растворимый TCR с правильной укладкой, так что он обладает способностью распознавать его нативный лиганд, является стабильным на протяжении периода времени и может быть получен в разумных количествах. Эти TCR состоят из внеклеточного домена а цепи димеризован-ного TCR к внеклеточному домену р цепи TCR соответственно, посредством межцепочечной дисуль-фидной связи между цистеинами, введенными в константные области соотвествующих цепей.
Специфический рМНС партнер связывания, то есть антитела специфические для эпитопов рМНС, и оба типа гетеродимерного и одноцепочечного TCRs были предложены в качестве направленности векторов для доставки терапевтического средства к антиген-презентирующим клеткам. С этой целью терапев
тический агент должен быть связан с рМНС-партнером связывания каким-либо образом. Терапевтические агенты, которые были предложены для такой направленной доставки, совместно с рМНС-партнерами связывания, включают антитела (см., например: Mosquera L.A. et al., J Immunol (2005) 174 (7): 4381-8), cytokines (см., например: Belmont H.J. et al., Clin Immunol (2006) 121 (1): 29-39; Wen J. et al., Cancer Immunol Immunother (2008) 57 (12): 1781-94), и цитотоксические агенты. В случае, если терапевтическим агентом представляет собой полипептид, способом связывания с рМНС-партнером связывания может быть пептидное слияние, либо прямое слияние или слияние посредством линкерной последовательности к рМНС партнеру связывания. В тех случаях существует в основном только две возможности слияния. Относительно одноцепочечных антител или TCRs, слияние возможно в основном С- или N-концом цепи TCR; относительно гетеродимерных антител или TCRs, слияние возможно в основном С-или N-концом любой цепи. На практике, тем не менее, получается из всех известных примеров рМНС партнер связывания - терапевтический агент слияний, с терапевтическим агентом слияние было С-концом (см., например Mosquera L.A. et al., J Immunol (2005) 174 (7): 4381-8; Belmont HJ. et al., Clin Immunol (2006) 121 (1): 29-39; Wen J. et al., Cancer Immunol Immunother (2008) 57 (12): 1781-94). Это потому, что функциональное назначение антител или TCR, любого из одноцепочечного или гетеродимерного, зависит от правильной укладки и ориентации вариабельной области. Слияние терапевтического средства с N-концом рМНС партнера связывания располагает его впереди одной из вариабельных областей, и в данной области существует предположение, что терапевтическое средство, расположенное на N-конце будет мешать связыванию антитела или TCR с комплексом рМНС, тем самым снижая его эффективность связывания.
Сущность изобретения
В отличие от предположения в данной области, в настоящее время обнаружено, что бифункциональные молекулы, в которых иммуноэффекторная часть слита с N-концом рМНС-партнером связывания, являются более эффективными в индукции ими релевантного иммунного ответа, чем соответствующая конструкция, в которой слияние осуществляется с С-концом рМНС партнером связывания. Этот усиленный иммунный ответ конструкции N-слияния обеспечивается, несмотря на похожую рМНС связывающую способность версий N- и С-слияния.
Подробное описание изобретения
Таким образом, в настоящем изобретении предложена бифункциональная молекула, содержащая полипептидный партнер связывания, специфический для данного эпитопа рМНС, и полипептид иммунного эффектора, N-конец рМНС партнера связывания связывается с С-концом полипептида иммунного эффектора, при условии, что вышеуказанный полипептидный партнер связывания не является Т-клеточным рецептором, содержащим альфа цепь SEQ ID No:7 и бета цепь SEQ ID No:9.
Как указано, полипептидный рМНС партнер связывания может быть антителом или TCR. Таким образом, в одном из вариантов осуществления настоящего изобретения рМНС партнер связывания представляет собой гетеродимерную полипептидную пару ар TCR, или одноцепочечный ар полипептид TCR, и N-конец а или р цепи гетеродимерной полипептидной пары TCR, или N-конец полипептида scTCR связывается с С-концевой аминокислотой полипептида иммунного эффектора.
Соединение рМНС партнера связывания и полипептида иммунного эффектора может быть прямым или косвенным посредством последовательности линкера. Последовательности линкера обычно легко приспосабливаются, в том отношении, что они состоят из аминокислот, таких как глицин, аланин и се-рин, которые не имею больших боковых цепей, способных ограничивать пластичность. Применяемую или оптимальную длину последовательности линкера не трудно определить в отношении той или иной конструкции рМНС партнера связывания - иммунного эффектора. Обычно последовательность линкера менее чем примерно 12, как например менее чем 10, или из 5-10 аминокислот в длину.
В некоторых вариантах осуществления настоящего изобретения рМНС партнер связывания представляет собой гетеродимерную ар полипептидную пару TCR, в которой каждый а и р полипептиды имеет вариабельную и константную области TCR, но не имеют трансмембранной и цитоплазматической областей TCR. Часть TCR в таких случаях являются растворимыми. В особенности предпочтительны бифункциональные молекулы этого типа с ненативными дисульфидными связями между остатками, находящимися в константных областях а и р полипептидов TCR. В особенности, константные области а и р полипептидов могут быть связаны дисульфидными связями между остатками цистеина, заменяющего Thr 48 экзона 1 TRAC1 и Ser 57 экзона 1 TRBC1 или TRBC2, или нативные дисульфидные связи между Cys4 экзона 2 TRAC*01 и Cys2 экзона 2 TRBC1 или TRBC2.
В других вариантах осуществления настоящего изобретения рМНС партнер связывания представляет собой одноцепочечный ар полипептид TCR Vа-L-Vр, Vр-L-Va, Va-Ca-L-Vр или Vр-Cр-L-Va типов, где Va и Vр это вариабельные области а и р TCR соответственно, Са и Ср это константные области а и Р TCR соответственно, и L это последовательность линкера.
Иммунные эффекторные полипептиды известны. Они являются молекулами, которые вызывают или стимулируют иммунный ответ путем прямой или косвенной активации гуморального или клеточного звена иммунной системы, как например активация Т-клеток. Примеры включают: IL-1, П> 1а, IL-3, IL
4, IL-5, IL-6, IL-7, IL-10, IL-11, IL-12, IL-13, IL-15, IL-21, IL-23, TGF-р, IFN-y, TNFa, Анти-CD2 антитело, Анти-CD3 антитело, Анти-CD4 антитело, Анти-CD8 антитело, Анти-CD44 антитело, Анти-CD45RA антитело, Анти-CD45RB антитело, Анти-CD45RO антитело, Анти-CD49а антитело, АНТИ-CD49B антитело, Анти-CD49c антитело, Анти-CD49d антитело, Анти-CD49e антитело, Анти-CD49f антитело, Анти-CD16 антитело, Анти-CD28 антитело, Анти-IL-2R антитела, вирусные белки и пептиды, и бактериальные белки или пептиды. В случае, если иммунный эффекторный полипептид представляет собой антитело, оно может быть scFv антителом, одним из которых является анти-CD3 scFv. Примеры анти-CD3 антител включают, но не ограничеваются ими, ОКТ3, UCHT-1, BMA031 и 12F6.
Сущность настоящего изобретения иллюстрируется следующими примерами.
Примеры
Пример А. Получение растворимого ар TCR, имеющего эффекторные полипептиды, сливающиеся с С- или N-концами р цепи TCR.
А1. Растворимый NY-ESO TCR с анти-CD3 антителом как эффекторный полипептид.
Растворимый NY-ESO TCR в этом примере обладает свойством связываться с SLLMWITQV пептидом, находящимся на HLA-A2 молекуле.
SEQ ID No: 1 (фиг. 1) представляет собой аминокислотную последовательность альфа цепи NY-ESO TCR, в которой С162 (использование нумерации SEQ ID No: 1) заменяет Т48 ее TRAC константной области.
SEQ ID No: 2 (фиг. 2) представляет собой аминокислотную последовательность бета цепи NY-ESO TCR, в которой С170 (использование нумерации SEQ ID No: 2) заменяет S57 ее TRBC2 константной области.
SEQ ID No: 3 (фиг. 3) представляет собой аминокислотную последовательность анти CD3 UCHT-1 scFv антитела, с подчеркнутой последовательностью внутри линкера.
Фиг. 4 показывает в стуктурной схеме форму структуры растворимого NY-ESO ар TCR, имеющего
а цепь SEQ ID No: 1 и р цепь SEQ ID No: 2, и имеющего анти CD3 UCHT-1 scFv антитела SEQ ID No: 3
сливающегося в N конце р цепи SEQ ID No: 2 TCR посредством линкерной последовательности L1, а
именно GGEGS (SEQ ID No: 4).
SEQ ID No: 14 (фиг. 16) представляет собой аминокислотную последовательность бета цепи на фиг. 2 с N-концом анти-CD3 scFv сливается С-конец бета цепи TCR посредством других пептидных линкер-ных последовательностей (подчеркнута).
SEQ ID No: 15 (фиг. 17) представляет собой аминокислотную последовательность бета цепи на фиг. 2 с С-концом анти-CD3 scFv сливается N-конец бета цепи TCR посредством одинаковых пептидных лин-керных последовательностей, а именно SEQ ID No: 14 (вновь подчеркнута).
Конструкцию на фиг. 4 приготавливали следующим образом.
Лигирование
Синтетические гены кодируют (а) а цепь SEQ ID No: 1 TCR и (б) слияние последовательности SEQ ID No: 2 и SEQ ID No: 3, по отдельности лигированных в pGMT7 - основные экспресснные плазмиды, которые содержат Т7 промотер для высокого уровня экспрессии в Е. coli штамма BL21-DE3(pLysS) (Pan et al., Biotechniques (2000) 29 (6): 1234-8).
Экспрессия
Экспрессионные плазмиды трансформировали раздельно в E.coli штамма BL21-DE3 Rosetta pLysS и отобранные ампицилин-резистентные колонии выращивали при 37°С в TYP (ампициллина 100 мкг/мл) среде при OD600 ~0.6-0.8 перед индуктированием экспрессии белка с 0.5 мМ IPTG. Клетки собирали после трехчасового индуктирования с помощью центрифугирования в течение 30 мин при 4000 об/мин в Beckman J-6B. Клеточную массу лизировали с 25 мл Bug Buster (NovaGen) в присутствии MgCl2 и ДНКа-зы. Осадок внутриклеточных включений извлекали с помощью центрифугирования в течение 30 мин при 13000 об/мин в центрифуге Beckman J-6B. Затем проводили тройное промывание детергентом для удаления клеточных остатков и мембранных компонентов. Каждый раз осадок внутриклеточных включений гомогенизировали в Тритон буфере (50 мМ Tris-HCl pH 8.0, 0,5% Тритон-Х100, 200 мМ NaCl, 10 мМ Na ЭДТА) перед центрифугированием осдака в течение 15 мин при 13000 об/мин в Beckman J-6B. Детергент и соли удаляли подобным промыванием в следующем буфере: 50 мМ Tris-HCl pH 8.0, 1 мМ Na ЭДТА. В заключении, внутриклеточные включения подразделяли на 30 мг аликвоты и замораживают при -70°С.
Рефолдинг
Примерно 20 мг а цепи TCR и 40 мг р цепи scFv-TCR растворяли внутриклеточными включениями, оттаившими от низкотемпературного хранения, разводили в 20 мл раствора гуанидина (6М гуанидин-гидрохлорида, 50 мМ Tris-HCl pH 8.1, 100 мМ NaCl, 10 мМ ЭДТА, 20 мМ ДТТ) и инкубировали при 37°С в водяной бане в течение 30 мин - 1 ч до полной денатурации цепи. Раствор гуанидина, содержащий полностью редуцированные и денатурированные цепи TCR, затем вводили в 1 л следующего буфера для рефолдинга: 100 мМ Tris pH 8.1, 400 мМ L-Аргинина, 2 мМ ЭДТА, 5М мочевины. Редокс пару (гидрохлорид цистамина и дигидрохлорид цистамина (конечной концентрации 16 мМ и 1.8 мМ, соответственно) добавляли приблизительно за 5 мин перед добавлением денатурированных a TCR и р scFv-TCR це
пей. Раствор оставляли на ~30 мин. Рефолдинговые scFv-TCR диализировали в диализной трубке с целлюлозной мембраной (Sigma-Aldrich; Товар No. D9402) против 10 л Н2О в течение 18-20 ч. После этого времени диализный буфер меняют дважды на свежий 10 мМ Tris pH 8.1 (10 л) и диализирование продолжают при 5°С ± 3°С в течение ~8 ч. Растворимые и правильной укладки scFv-TCR отделяют от неправильно свернутых продуктов распада и примесей методом 3-ступенчатой очистки, описанным ниже. Второй этап очистки может быть ионнообменной хроматографией или аффинной хроматографией, в зависимости от pl растворенного анти-CD3 scFv-TCR слияния.
Первый этап очистки
Диализированный свернутый белок (в 10 мМ Tris, pH 8.1) погружают на анионобменную колонку POROS 50HQ и элюируют связанный белок градиентом 0-500 мМ NaCl 6 объемами колонки с использованием очистителя Akta (GE Healthcare). Пиковые фракции (элюирование при проводимости ~20 м См/см) хранили при 4°С. Пиковые фракции изучали путем Instant Blue Stain (Novexin) окрашивания SDS-ПЭГ перед объединением.
Второй этап очистки
Ионообменная хроматография. Катионообменная очистка.
Анионообменные смешанные фракции буфера обмена разводили с 20 мМ MES рН 6-6.5, в зависимости от pl scFv-T CR слияния. Растворимые и правильной укладки scFv-TCR отделяли от неправильно свернутых продуктов разложения и примесей путем загрузки растворимых смешанных фракций (в 20 мМ MES рН 6-6.5) на катионнообменную колонку POROS 50HS и элюировали связанный белок градиентом 0-50 мМ NaCl 6 объемами колонки с использованием очистителя Akta (GE Healthcare). Пиковые фракции (элюирование при проводимости ~10 мСм/см) хранили при 4°С.
Кроме того, ионнообменная очистка с использованием матриксного гидроксиапатита может быть использована как описано ниже.
Гидроксоапатитовая хроматография
Анионообменные смешанные фракции буфера обмена разводили с 10 мМ NaH2PO4 рН 6.0. Растворимые и правильной укладки scFv-TCR отделяли от неправильно свернутых продуктов разложения и примесей путем загрузки разведенных смешанных фракций (в 10 мМ NaH2PO4 рН 6.0) на гидроксиапа-титную колонку и элюировали связанный белок с градиентом 10-500 мМ NaH2PO4/1M NaCl 6 объемами колонки с использованием очистителя Akta (GE Healthcare). Пиковые фракции (элюирование при проводимости ~20 мСм/см) хранили при 4°С.
Аффинная хроматография
Для некоторых scFv-TCR слияний с pl, близкой к 6-6.5, ионообменный этап не может быть использован, но его можно заменить этапом аффинной хроматографии. Белок L аффинной хроматографической колонки (Pierce, продукт номер 89928) выделяет и очищает определенные классы иммуноглобулинов посредством их каппа легкой цепи. Белок L также связывает одноцепоченые различные фрагменты (scFv). Анионообменные смешанные фракции обменного буфера разбавляли с PBS /0.02% азида натрия. Растворимые и правильной укладки scFv-TCR отделяли от неправильно свернутых продуктов разложения и примесей путем загрузки разведенных смешанных фракций на колонку белка L и элюировали связанный белок градиентом 0-25мМ глицина рН 2.3/0.02% азида натрия 6 объемами колонки с использованием очистителя Akta (GE Healthcare). scFv элюировали в самом конце градиента и рН элюирования фракций нейтрализовали добавлением Tris рН 8.1 (100 мМ Tris рН 8.1 конечной концентрации). Пиковые фракции хранили при 4°С.
Окончательная очистка
Пиковые фракции из второго этапа очистки изучали путем Instant Blue Stain (Novexin) окрашивания SDS-ПЭГ перед объединением. Смешанные фракции затем концентрировали для стадии окончательной очистки, в то время как растворимые scFv-TCR очищали и отличали, используя Superdex S200 гель-фильтрационную колонку (GE Healthcare), предварительно уравновешенную в PBS буфере (Sigma). Пиковое элюирование с относительной молекулярной массой приблизительно 78 кДа исследовали путем Instant Blue Stain (Novexin) окрашивания SDS-ПЭГ перед объединением.
Аналогично, как описано для конструкции на фиг. 4, конструкции на фиг. 5, 6 и 7 были подготовлены.
На фиг. 5 показана в структурной схеме форма структуры растворимого NY-ESO ар TCR, имеющего а цепь SEQ ID No: 1 и р цепь SEQ ID No: 2, и имеющего анти CD3 UCHT-1 scFv антитела SEQ ID No: 3 слитые в N конце р цепи SEQ ID No: 2 TCR посредством последовательности линкера L2, а именно
AHHSEDPSSKAPKAP (SEQ ID No: 5).
На фиг. 6 показана в структурной схеме форма структуры растворимого NY-ESO ар TCR, имеющего а цепь SEQ ID No: 1 и р цепь SEQ ID No: 2, и имеющего анти CD3 UCHT-1 scFv антитела SEQ ID No: 3 слитые в N конце р цепи SEQ ID No: 2 TCR посредством последовательности линкера L3, а именно
GGEGGGSEGGGS (SEQ ID No: 6).
На фиг. 7 показана в структурной схеме форма структуры растворимого NY-ESO ар TCR, имеюще
го а цепь SEQ ID No: 1 и р цепь SEQ ID No: 2, и имеющего анти CD3 UCHT-1 scFv антитела SEQ ID No: 3 слитых в С конце р цепи SEQ ID No: 2 TCR посредством последовательности линкера L4, которая в данном случае является одной аминокислотой S.
Аналогично, как описано для конструкций на фиг. 4, 5, 6 и 7, белки слияния, имеющие а цепь SEQ ID No: 1 TCR и р цепь - анти-CD3 scFv SEQ ID No: 14TCR, где анти- CD3 scFv сливается в С-конце бета цепи TCR, или а цепь SEQ ID No:1 TCR и р цепь - анти^3 scFv SEQ ID No: 15 TCR, где анти^3 scFv сливается в N-конце бета цепи TCR, были получены.
А2. Растворимые химерные TCR с цитокинами как эффекторные полипептиды.
SEQ ID No: 7 (фиг. 8) представляет собой аминокислотную последовательность альфа цепи TCR, обладающая свойством связывать мышиный инсулин-производный пептид, LYLVCGERG (SEQ ID NO: 8), представляющий собой мышиный H-2K комплекс. (LYLVCGERG- H-2Kd), в котором С159 (использование нумерации SEQ ID No: 7) заменяет ее Т48 TRAC константной области.
SEQ ID No: 9 (фиг. 9) представляет собой аминокислотную последовательность бета цепи из числа TCR, которая связывает мышиный LYLVCGERG- H-2Kd комплекс, в котором С171 (использование нумерации SEQ ID No: 9) заменяет S57 ее TRBC2 константной области.
SEQ ID No: 7 и 9 TCR представляет собой химерный TCR, состоящий из альфа и бета цепи TCR, каждый из которых содержит вариабельную область мыши и константную область человека. Химерный вариант TCR конструировали для решения проблем рефолдинга, встречающихся с полностью мышиным TCR, и было показано, что химерный TCR обладает такой же аффинностью, как и мышиный TCR в отношении комплекса мышиного белка, прозводного инсулина и мышиного H-2Kd.
SEQ ID No: 10 (фиг. 10) представляет собой аминокислотную последовательность IL-4 полипептида мыши.
SEQ ID No: 11 (фиг. 11) представляет собой аминоксилотную поледовательность IL-13 полипептида мыши.
На фиг. 12 показана в структурной схеме форма структуры растворимого химерного инсулина ар TCR, имеющего а цепь SEQ ID No:7 и р цепь SEQ ID No: 9 и имеющего мышиный IL-4 SEQ ID No: 10 слитый в N- конце р цепи SEQ ID No: 9 TCR посредством последовательности ленкера L5, а именно
GGEGGGP (SEQ ID No: 12).
На фиг. 13 показана в структурной схеме форма структуры растворимого химерного инсулина ар TCR, имеющего а цепь SEQ ID No:7 и р цепь SEQ ID No: 9 и имеющего мышиный IL-4 SEQ ID No: 10 слитый в С конце р цепи SEQ ID No: 9 TCR посредством линкерной последовательности L6, а именно
GSGGP (SEQ ID No: 13).
На фиг. 14 показана в структурной схеме форма структуры растворимого химерного инсулина ар TCR, имеющего а цепь SEQ ID No:7 и р цепь SEQ ID No: 9 и имеющего мышиный IL-13 SEQ ID No: 11 слитый в N- конце р цепи SEQ ID No: 9 TCR посредством линкерной последовательности L5, а именно
GGEGGGP (SEQ ID No: 12).
На фиг. 15 показана в структурной схеме форма структуры растворимого химерного инсулина ар TCR, имеющего а цепь SEQ ID No:7 и р цепь DEQ ID No: 9 и имеющего мышиный IL-13 SEQ ID No: 11 слитый в С конце р цепи SEQ ID No: 9 TCR посредством линкерной последовательности L6, а именно
GSGGP (SEQ ID No: 13).
Конструкции на фиг. 12-15 были получены следующим образом.
Лигирование
Синтетические гены кодируют (а) а цепь SEQ ID No:7 TCR и (б) слияние последовательности SEQ ID No: 9 и SEQ ID No: 10 или 11, по отдельности лигированных в pGMT7-основные экспрессионные плазмиды, которые содержат промотер Т7 для высокого уровня экспресии в E.coli штамма BL21-DE3(pLysS) (Pan et al, Biotechniques (2000) 29 (6): 1234-8).
Экспрессия
Экспрессионные плазмиды, содержащие а-цепь TCR и р-цепь цитокина, соответственно были трансформированы по отдельности в E.coli штамма BL21 (DE3) Rosetta pLysS и отобранные ампицилин-резистентные колонии выращивали при 37°С в TYP (ампицилин 100 цг/мл) среды OD600~0.6-0.8 перед стимуляцией экспресии белка с 0.5 мМ IPTG. Клетки собирали после трех часовой индукции методом центрифугирования в течении 30 мин при 4000 об/мин на Beckman J-6B. Клеточную массу лизировали с 25мл Bug Buster (NovaGen) в присутствии MgCl2 и ДНКазы. Осадок внутриклеточных включений получали методом центрифугирования в течение 30 мин при 13000 об/мин в центрифуге Beckman J2-21. Тройным промыванием детергентом проводили удаление клеточных остатков и мембранных компонентов. Каждый раз осадок клеточных включений гомогенизировали в Тритон буфере (50 мМ Tris-HCl pH 8.0, 0.5% Тритон-Х100, 200 мМ NaCl, 10 мМ №ЭДТА), предварительно центрифугировали в течении 15 мин при 13000 об/мин в Beckman J2-21. Детергент и соли удаляли подобным промыванием в следующем буфере: 50 мМ Tris-HCl pH 8.0, 1 мМ Na ЭДТА. В заключении, внутриклеточные включения разделяли на 30 мг аликвоты и замораживали при -70°С. Выход белковых телец включений подсчитывали путем
растворения с 6М гуанидин- HCl и при OD измеряли на Hitachi U-200 спектрофотометре. Концентрацию белка затем подсчитывали с использованием теоритического коэффициента поглощения.
Рефолдинг
Приблизительно 20 мг а цепи TCR и 40 мг 3 цепи цитокина-TCR растворяли клеточными включениями, оттаившими от низкотемпературной заморозки, и разводили в 20 мл раствора гуанидина (6М гуа-нидин-гидрохлорид, 50 мМ Tris HCl pH 8.1, 100 мМ NaCl, 10 мМ ЭДТА, 10 мМ ДТТ) и инкубировали при 37°С в водяной бане в течение 30 мин - 1 ч для обеспечения полной цепочечной денатурации. Раствор гуанидина, содержащий полностью редуцированные и денатурированные цепи TCR, был введен в 1 л холодного (5-10°С) рефолдингового буфера: 100 мМ Tris рН 8.1, 400 мМ L-Аргинина, 2 мМ ЭДТА, 5М мочевины. Редокс пары (цистамина гидрохлорид и цистамина дигидрохлорид (в конечной концентрации 10 мМ и 2.5 мМ. соответственно)) добавляли приблизительно за 5 мин до добавления денатурированных а TCR и 40 мг р цепей цитокина-TCR. Раствор оставляли на ~30 мин. Рефолдинговые цитокин-TCR диа-лизировали в диализной трубке с целлюлозной мембраной (Sigma-Aldrich; продукт No. D9402) против 10 л Н2О в течение 18-20 ч. После этого диализный буфер дважды меняли на свежий 10 мМ Tris рН 8.1 (10 л) и продолжали длительный диализ при 5°С±3°С в течение следующих ~8 ч.
Очистка
Растворимые цитокин-TCR слияния отделяли от продуктов распада и примесей путем 3-этапной очистки методом RT, описанным ниже.
Первый этап очистки
Диализированный свернутый белок фильтровали с использованием 0.2 мкм капсул Sartofore (Sarto-ruis) перед колоночной очисткой. Фильтрованный рефолдинг загружали на анионообменную колонку POROS 50HQ и элюировали связанный белок линейным градиентом 0-500 мМ NaCl 6 объемами колонки с использованием очистителя Akta (GE Healthcare). Пиковые фракции элюировали 250 мМ NaCl, содержащие белки правильной укладки, и хранили при 4°С. Пиковые фракции изучали с помощью Instant Blue Stain (Novexin) окрашивания SDS-ПЭГ перед объединением.
Второй этап очистки
Объединенные фракции, содержащие растворимый цитокин-TCR, смешивают с эквивалентным объемом 50 мМ Tris/1M (NH4)2SO4 pH 8 до конечной концентрации 0.5М (NH4)2SO4 и проводимостью 7580 сМс/см при RT. Растворимый цитокин-TCR отделяли от продуктов распада и примесей путем загрузки этого образца на предварительно уравновешенную (50 мМ Tris/0,5M (NH4)2SO4 pH8) колонку бутил гидрофобного взаимодействия и собирали элюат с использованием очистителя Akta (GE Healthcare). Образец элюата, содержащий растворимые цитокин-TCR, изучали с помощью Instant Blue Stain (Novexin) окрашивания SOS-ПЭГ перед объединением и хранили при 4°С.
Окончательная очистка
Смешанные фракции разводили с эквивалентным объемом 10 мМ Tris pH8 и концентрировали до 10 мл (концентрация <3 мг/мл). Растворимые цитокин-TCR очищали с использованием гель-фильтрационной колонки Superdex S200 (GE Healthcare) предварительно уровновешанной в буфере PBS (Sigma). Пиковое элюирование при относительной молекулярной массе около 63 кДа исследовали с помощью Instant Blue Stain (Novexin) окрашивания SDS-ЛЭГ перед объединением.
Пример Б. Свойства растворимого ар TCR, имеющего эффекторное полипептидное слияние в С-или N-конце р цели TCR
Б1. Растворимый NY-ESO TCR с анти-CD3 антителами как эффекторный полипептид.
а. Перенаправление и активация CD8+ Т клеток растворимым NY-ESO TCR, слитым с анти-CD3 антителом, против NY-ESO пептид-презентирующих клеток.
Следующее исследование проводилось для демонстрации активации цитотоксических Т лимфоцитов (CTLs) анти-CD3 scFv-TCR слиянием посредством специфического пептид-МНС комплекса. Выработку IFN-Y, измеренную с использованием анализа ELISPOT, использовали в качестве считывания для активации цитотоксических Т лимфоцитов (CLT) и для оценки активности анти-CD3 scFv части слияния.
Реагенты
Испытательная среда: 10% FCS (Gibco, Cat# 2011-09), 88% RPMI 1640 (Gibco, Cat#42401), 1% глю-тамина (Gibco, Cat# 25030) и 1% пеницилин/стрептомицин (Gibco, Cat# 15070-063).
Пептид: (SLLMWITQV) первоначально растворяли в DMSO (Sigma, cat# D2650) на 4 мг/мл и замораживали. Т2 клетки активируются с описанным пептидом и используются в качестве клеток-мишеней.
Промывочный буфер: 0.01 М PBS/0.05% Tween 20 PBS (Gibco Cat# 10010).
IFNy человека ELISPOT PVDF-ферментный набор (Diaclone, France:Cat# 856.051.020) содержит все другие необходимые реагенты. (Сбор и обнаружение антител, сухое обезжиренное молоко, BSA, стреп-тавидин-щелочная фосфатаза и раствор BCIP/NBT, а также IFNy человека PVDF ELISPOT 96 луночные планшеты.
Метод
Получение клеток-мишеней.
Клетки-мишени, используемые в данном методе, были либо (1) натуральные эпитоп-презентирующие клетки (например, клетки Mel624 или Mel526) или (2) Т2 клетки, активированные с пептидом, представляющим интерес, описанным в части реагентов. Достаточное количество клеток-мишеней (50 000 клеток/лунка) промывали путем центрифугирования три раза при 1200 об/мин, 10 мин в Megafuge 1.0 (Heraeus). Клетки затем ресуспендировали в испытательной среде при 105 клетка/мл.
Получение эффекторной клетки.
Эффекторная клетка (Т клетка) используется в этом методе как CD8+ Т клетки (полученные путем негативной селекции (с помощью набора Негативного выделения CD8, Dynal, Cat# 133.19) из PBL), Т клетки из клеточной линии EBV или PBMCs. Эффекторные клетки размораживали и помещали в испытательную среду, предварительно промывали с помощью центрифугирования при 1200 об/мин 10 мин в Megafuge 1.0 (Heraeus). Клетки затем ресуспендировали в испытательной среде при 4Х конечной требуемой концентрации.
Получение реагента/тестируемого состава.
Различные концентрации тестируемого состава (TCR-Анти-CD3 слияние; от 10 нМ до 0.03 пМ) получали путем разведения в испытательной среде при конечной концентрации 4Х.
ELISPOTs.
Планшеты получали следующим образом: 100 мкл иммобилизированых антител анти-IFN-y разводили в 10 мл стерильного PBS на планшет. 100 мкл разведенных иммобилизированных антител вносили в каждую лунку. Планшеты инкубировали всю ночь при 4°С. После инкубации планшеты промывали (программа 1, планшет 2 типа, Ultrawash Plus промывка 96-луночной планшеты; Dynex) для удаления иммобилизированных антител. Планшеты блокировали путем добавления 100 мкл 2% обезжиренного молока в стерильный PBS в каждую лунку и инкубировали планшеты при комнатной температуре в течение двух часов. Обезжиренное молоко затем вымывали из планшет (программа 1, планшет 2 типа, Ul-trawash Plus промывка 96-луночной планшеты; Dynex) и какие-либо остатки промывочного буфера удаляли путем стряхивания и постукивания планшет ELISPOT на бумажной салфетке.
Составляющие анализа затем добавляли в ELISPOT плашету в следующем порядке:
50 мкл клеток-мишеней 106 клеток/мл (что в общей сложности 50000 клеток-мишеней/лунка);
50 мкл реагента (слияние анти-CD3 scFv-TCR; различной концентрации) 50 мкл среды (исследовательская среда);
50 мкл эффекторных клеток (между 1000 и 50000 CD8+ ктеток/лунка; между 500 и 1000 EBV клеток/лунка; между 1000 и 50000 РВМС/лунка).
Затем планшеты инкубировали в течение ночи (37°С/5% СО2). На следующий день планшеты промывают трижды (программа 1, планшет 2 типа, Ultrawash Plus промывка 96-луночной планшеты, Dynex) с промывочным буфером и постукивали над бумажным полотенцем для удаления лишнего промывочного буфера. 100 мкл первично детектируемых антител добавляли в каждую лунку. Первично детектируемые антитела получали путем добавления 500 мкл дистилированной воды в сосуд для детекции антител, снабженный набором Diaclone. 100 мкл этого раствора разводили в 10 мл PBS/1% BSA (объем, необходимый для одной планшеты). Затем планшеты инкубировали при комнатной температуре в течение по меньшей мере 2 ч до того, как трижды промывали (программа 1, планшет 2 типа, Ultrawash Plus промывка 96-луночной планшеты,Dynex) с промывочным буфером, избыток промывочного буфера удаляли постукиванием над бумажным полотенцем.
Вторая детекция осуществлялась путем добавления 100 мкл разведенной стрептавидин-щелочной фосфатазы в каждую лунку и инкубирования планшеты при комнатной температуры в течение 1 ч. Стрептавидин-щелочная фосфатаза получена путем добавления 10 мкл стрептавидин-щелочной фосфа-тазы к 10 мл PBS/1% BSA (объем, необходимый для одной планшеты). Планшеты трижды промывали (программа 1, планшет 2 типа, Ultrawash Plus промывка 96-луночной планшеты, Dynex) с промывочным буфером и удаляли избыток промывочного буфера постукиванием над бумажным полотенцем. 100 мкл раствора BCIP/NBT, как есть в наборе Diaclone, добавляли в каждую лунку. В процессе проявления, планшеты покрывали фольгой, и оставляли на 5-15 мин. Проявление планшет регулярно проверяли на пятна в течении этого времени для определения оптимального времени завершения реакции. Планшеты промывали в раковине под водопроводной водой для прекращения развитии реакции и встряхивали насухо прежде, чем их разобрать на три составные части. Затем планшеты высушивали при 50°С в течение 1 ч перед тем, как посчитывать пятна, которые формируются на мембране при использовании спектрофотометра Immunospot (CLT; Cellular Technology Limited).
Результаты
Конструкции анти-CD3 scFv-TCR слияния на фиг. 4-7 были протестированы с помощью исследования ELISPOT (как описано выше). Количество пятен ELISPOT, наблюдаемых в каждой лунке, наносили на график в зависимости от концентрации тестируемой конструкции, используя Prism (Graph Pad). Из этих кривых доза-эффект ЕС50 значения были определены (ЕС50 определяют при концентрации анти-CD3 scFv-TCR слияния, которое вызывает 50% максимального ответа).
Тестируемая конструкция
ЕС50
ЕС50
ЕС50
Фиг 7
С-концевов слияние
5.044е-9
1.864е-9
2.363е-9
Фиг 5
N-концееав слияние
8.502е-11
Фиг 4
Н-концевое слияние
4,825е-11
Фиг 6
N-концевое слияние
3.95e-11
Эти результаты показывают, что конструкции N-слияния на фиг. 4, 5 и 6 по меньшей мере в 2 раза более сильные в способности активации цитотоксических Т лимфоцитов, чем конструкции С-слияния на фиг. 7.
б. Перенаправление CD8+ Т клеток растворимым NY-ESO TCR слиянием с анти-CD3 антител для уничтожения IM9 EBV трасформированной В клеточной линией (нерадиоактивный цитотоксический анализ).
Следующий анализ осуществляется для демонстрации активации цитотоксических Т лимфоцитов (CLTs) TCR-анти-CD3 scFv слиянием посредством специфического пептид-МНС комплекса и оценки эффективности анти-CD3 scFv части слияния, активирующей CLTs для уничтожения IM9 клеток. Это исследование представляет собой колориметрическую альтернативу исследованиям цитотоксичности с высвобождением 51Cr и количественно измеряет лактатдегидрогеназу (LDH), которая является ферментом, высвобождаемым при лизисе клеток. Высвобожденную LDH в культуральных супернатантах измеряют с помощью 30-минутного объединенного ферментатативного анализа, результатом которого является превращение соли тетразолия (INT) в формазановый продукт красного цвета. Количество цвета формируется пропорционально количеству лизированных клеток. Данные поглощения собирают, используя стандартные 96-луночные планшеты для чтения при 490 нм.
Материалы
CytoTox96(r) Non-Radioactive Cytotoxicity Assay (Promega) (G1780) содержит субстрат Mix, испытуемый буфер, лизирующий раствор и стоп-реагент.
Испытательная среда: 10% FCS (термоинактивированная, Gibco, cat# 10108-165), 88% RPMI 1640 без фенолового красного (Invitrogen cat# 32404014),1% глютамин, 200 мM (Invitrogen, cat# 25030024), 1% пеницилин/стрептомицин (Invitrogen cat# 15070063).
Nunc микролуночный с круглым дном 96 лунок для культуры ткани (Nunc, cat# 163320).
Nunc-иммунопластины Maxisorb (Nunc, cat# 442404).
Метод
Получение клеток-мишеней.
Клетки-мишени, использованные в этом исследовании, были IM9 EBV трансформированной В клеточной линии, полученной от многоклеточной миеломы пациентов (HLA-A2+ NY-ESO). Mel526 клеточную линию миеломы использовали в качестве контроля и HLA-A2+ NY-ESO-. Клетки-мишени готовили в испытательной среде: клетки-мишени концентрировали, доводя от 2х105 клеток/мл до 1х104 клеток/лунку в 50 мкл.
Получения эффекторных клеток.
Эффекторными клетками, используемые в этом анализе, были CD8+ T клетки. Соотношение эффектор-мишень использовали 10:1 (2х106 клеток/мл до 1х105 клеток/лунка в 50 мкл). Получение реагента/тестируемого состава.
Различные концентрации NY-ESO TCR-анти-CD3 слияния, имеющие альфа цепь SEQ ID No:1 TCR и бета цепь анти-CD3 scFv слияния SEQ ID No:14 TCR, или имеющие альфа цепь SEQ ID No: 1 TCR и бета цепь анти-CD3 scFv слияния SEQ ID No:15 TCR, были получены как описано в примере А1 и получены для этого исследования путем разведения (10-13 до 10-8 М конечной концентрации) в испытательной среде.
Подготовка анализа.
Составляющие анализа добавляли в планшет в следующем порядке:
50 мкл клеток-мишеней, IM9 или Mel526 (полученных, как объяснялось выше), в каждую лунку. 50 мкл реагента (полученного, как объяснялось выше) в каждую лунку. 50 мкл эффекторных клеток (полученных, как объяснялось выше) в каждую лунку. Несколько контролей, полученных, как объясняется ниже.
Спонтанное освобождение эффектора: 50 мкл эффекторные клетки в чистом виде.
Спонтанное освобождение клеток-мишеней: 50 мкл клетки-мишени в чистом виде. Максимальное освобождение мишени: 50 мкл клеток-мишеней плюс 80 мкг/мл дигитонина в начале исследования лизиса клеток.
Контрольная испытуемая среда: 150 мкл только среда.
Экспериментальные лунки готовят в трех экземплярах, а контрольные лунки в двух экземплярах в конечном объеме 150 мкл.
Планшет центрифугировали при 250х г в течение 4 мин, затем инкубировали при 37°С в течение 24 часов.
Планшет центрифугировали при 250х г в течение 4 мин, 37.5 мкл супернатанта из каждой лунки испытуемого планшета переносили в соответствующую лунку с плоским дном 96 луночного Nunc Max-isorb планшета. Субстрат Mix растворяли с использованием испытательного буфера (12 мл). 37.5 мкл растворенного субстрата Mix добавляли в каждую лунку планшета. Планшет покрывали алюминиевой фольгой и инкубировали при комнатной температуре в течение 30 мин, 37.5 мкл стоп-реагента добавляли в каждую лунку планшета для прекращения реакции. Поглощение при 490 нм регистрировалось на ИФА планшете для чтения не позднее часа после добавления стоп-реагента.
Подсчет результатов.
Средняя величина значения поглощения культуральной среды вычиталась из всего значения поглощения экспериментального, спонтанного освобождения клеток-мишеней и спонтанного освобождения эффекторных клеток и максимального освобождения мишеней.
Скорректированные значения, полученные в первых двух этапах, использовались в следующей формуле вычисления процента цитотоксичности: % цитотоксичности = 100х (Экспериментальная -Спонтанный эффектор - Спонтанная мишень)/(Масимальное освобождение мишени - Спонтанная мишень).
Результаты
Конструкции NY-ESO TCR-Анти-CD3 scFv слияния имеют (i) альфа цепь SEQ ID No: 1 TCR и бета цепь - анти-CD3 scFv слияния SEQ ID No: 14 TCR (С-концевое слияние) или (ii) альфа цепь SEQ ID No: 1 TCR и бета цепь - анти-CD3 scFv слияния SEQ ID No: 15 TCR (N-концевое слияние) исследовали путем анализа освобождения LDH (как описано выше). % цитотоксичности наблюдали в каждой лунке в зависимости от концентрации тестируемой конструкции, используя Prism (Graph Pad). Из этих кривых доза-эффект значение ЕС50 были определено (ЕС50 определяли концентрацией слияния TCR, что вызывало 50% максимального ответа).
Тестируемая конструкция 1 ЕС50
С-концевое слияние
(SEQ ID No: 1 и SEQ ID No: 14)
1.2es
N-концевое слияние
(SEQ ID No: 1 и SEQ ID No: 15)
3.2e"
Эти результаты показывают, что N-концевое слияние, включающее альфа цепь SEQ ID No: 1 TCR и бета цепь- анти-CD3 scFv слияния SEQ ID No: 15 TCR по меньшей мере в 2 раза более сильное в своей способности перенаправления цитотоксических Т лимфоцитов для уничтожения клеток-мишеней, чем С-концевое слияние конструкции, содержащей альфа цепь SEQ ID No: 1 TCR и бета цепь-анти-CD3 scFv слияния SEQ ID No: 14 TCR.
Б2. Растворимый химерный TCR с цитокинами как эффекторными полипептидами.
а. Мышиный цитокин IL-4 как эффекторный полипептид.
Следующий анализ использовали для тестирования биологической активности цитокинов в части мышиного IL-3-TCR слияния конструкций на фиг. 12-13. В этом биотесте используют мышиную клеточную линию CTLL-2, которая зависит от мышиного IL-4 для роста, и используют демонстрацию биологической активности цитокинов в части мышиного IL-4-TCR слияния.
Материалы.
Клетки CTLL-2, Promega CellTiter-Glo(r) люминисцентный анализ жизнеспособности клеток (Cat# G7572), включая CellTiter-Glo(r) Буфер и CellTiter-Glo(r) Субстрат (лиофилизированный).
Испытательная среда: RPMI дополненная 10% термоинактивированной фетальной бычей сывороткой (Gibco, cat# 10108-165), 88% RPMI 1640 (Gibco, cat# 42401-018), 1% глютамин (Gibco, cat# 25030024), 1% пеницилин/стрептомицин (Gibco, cat#15070-063)
CTLL-2 клетки собирают, один раз промывают в испытательной среде (центрифугируют при 1200 об/мин в течение 5 мин), подсчитывают и оценивают жизнеспособность, используя раствор триптанового синего. Если жизнеспособность менее чем 80%, осуществляли градиет фиколла для удаления умерших клеток (800х г в течение 15 мин с растормаживанием). Клетки промывают еще два раза и доводят объем до конечного 1 х 105 клеток/мл. Клетки CTLL-2 добавляют в Nunc белые плоскодонные 96-луночные планшеты (5000 клеток/лунка), затем 50 мкл титруют концентрированные стандартный IL-4 мыши (Peprotech) или мышиный IL-4-химерный TCR слияние конструкции на фиг. 12 и 13 (7 точек 1 в 10 раз
ведениях, от 10-8 до 10-14 М). Контроли включают только клетки, только испытательную среду и клетки с 200 ед/мл Proleukin (Chiron). Планшеты инкубировали при 37°С, 5% СО2 всю ночь. Далее, по инструкции производителя, реагент CellTiter-Glo размораживали и добавляли в планшет (100 мкл на лунку). Планшет инкубировали в течение 10 мин для стабилизации люминесцентного сигнала и затем записывали, используя люминисцентный считыватель. Фоновый сигнал (только клеток) вычитывают из показаний и наносятся на график в Prism (Graph Pad) так, что ЕС50 мышиного IL-4-TCR слияния конструкции на фиг. 12 и 13 можно сравнить с "свободным" рекомбинантным мышиным IL-4.
Эти результаты показывают, что N-слияние конструкции на фиг. 12 по крайней мере в 2 раза сильнее в способности активировать клеточную пролиферацию, чем С-слияние конструкции на фиг. 13. б. Цитокин IL-13 мыши как эффекторный полипептид.
Следующее исследование было использовано для тестирования биологической активности цитоки-на в части мышиного IL-13-TCR слияния конструкции на фиг. 14, 15.
Этот анализ проводили для демонстрации активности цитокинов части из цитокин-TCR слияния, т.е. ингибирование продукции IL-1 р моноцитами человека. Этот анализ можно использовать для тестирования цитокин-TCR слияния, где цитокин это IL-13 мыши.
Материалы
Моноциты, полученные из моноцитарной пленки (лейкоцитарная пленка из NBS Bristol Transfusion Service) Dynal Dynabeads MyPure Моноцитарный набор 2 для нетронутых клеток человека (113.35).
Испытательная среда: 10% эмбриональной телячьей сыворотки (термоинактивированная, Gibco, cat# 10108-165), 88% RPMI 1640 (Gibco, cat# 42401-018), 1% глютамина (Gibco, cat# 25030-024), 1% пе-ницилин/стрептомицин (Gibco, cat# 15070-063).
Промывочный буфер: 0.01 M PBS/0.05% Tween 20 (1 пакетик фосфатно-буферного солевого раствора с Tween 20, рН7.4 из Sigma, cat# P-3563 растворенный в литре дистиллированной воды до конечного состава 0.01 М PBS, 0.138М NaCl, 0.0027M KCl, 0.05% Tween 20).
PBS (Gibco, cat# 10010-015).
HBSS Ca2+ и Mg2+ свободный (Gibco, cat# 1018-165).
Cytokine Eli-pair ИФА набор: IL-1P (Diaclone cat# DC-851.610.020) этот набор содержит все остальные необходимые реагенты, т.е. иммобилизированные антитела, определяемые биотинилированием антитела, стрептавидин-HRP, стандарты IL-1P, готовый к использованию ТМВ. Следующий метод основан на инструкциях, прилагаемых в каждом комплекте.
Nunc-иммуно пластины Maxisorb (Nunc, cat# 442404).
Nunc микролуночные круглым дном 96 лунок для культуры ткани планшеты (Nunc, cat# 163320). BSA (Sigma, cat#A3059). H2SO4 (Sigma cat # S1526). Триптановый синий (Sigma cat # T8154).
Липополисхариды (LPS), полученные из E.coli 0111:B4 (Sigma, cat# L4391).
Рекомбинантный IL-13 мыши (Peprotech, cat# 210-13) стандарт, используемый, когда мышиные IL-13-TCR реагенты слияния тестируются.
Выделение моноцитов
РВМС выделяли из лейкоцитарной пленки: лейкоцитарную пленку разводили 1 к 2 в HBSS (Са2+ и Mg2+ свободный), разведенную кровь наслаивали на лифопреп (до 35 мл крови на 15 мл лимфопрела) и центрифугировали 15 мин при 800х г (комнатная температура) с затормаживанием; клетки на границе удаляли и промывали четыре раза с HBSS и центрифугировали при 1200 об/мин в течение 10 мин. После последнего промывания клетки ресуспендировали в 50 мл испытательной среды и жизнеспособность оценивали с помощью раствора триптанового синего. Dynal Dynabeads MyPure Моноцитарный набор 2 использовали для выделения моноцитов. РВМС ресуспендировали в PBS/0.1% BSA в 100 мкл буфера на 107 клеток, 20 мкл стоп-реагента на 107 клеток и 20 мкл смеси антител на 107 клеток добавляли и клетки инкубировали в течение 20 мин при 4°С. Клетки промывали и ресуспендировали в 0.9 мл PBS/0.1% BSA в среднем на 107 клеток. Предварительно вымытые гранулы добавляли (100 мкл на 107 клеток), смешивали и инкубировали в течение еще 15 мин при 20°С с легким вращением. Rosettes тщательно ресуспеди
ровали пипеткой и добавляли 1 мл PBS/0.1% BSA на 107 клеток. Пробирку помещали на магнит Dynal на 2 мин. Супернатант, содержащий негативные выделенные клетки, переносили в чистую пробирку и подсчитывали. Клетки использовали сразу или замораживали в 90% FCS/10% DMSO для дальнейшего использования.
Подготовка клеточного анализа
Планшеты ИФА покрывали с 100 мкл/лунку иммобилизированными антителами IL-1P в PBS и оставляли на всю ночь при 4°С. Моноциты оттаивали, промывали дважды в испытательной среде и ресус-пендировали в 5х105 клеток/мл. Моноциты высеивали в 96-луночный планшет с плоским дном (100 мкл на лунку, т.е. 5х104 на лунку). LPS, рекомбинантные цитиконы Peprotech и тестируемое цитокин-TCR белков слияние получали путем разведения в испытательной среде до получения конечной концентрации 4Х. LPS доваляли в каждую лунку (10нг/мл конечная), затем 50 мкп титровали концентрированные (6 точек от 1 до 10 серий разведений) рекомбинантный IL-13 Peprotech (10-8 до 10-13 М конечная) или тестируемый цитокин-TCR белка слияния (10-7 до 10-13 М конечная) в трех экземплярах лунок. Планшеты инкубировали при 37°С, 5% СО2 всю ночь.
ИФА 1L-1P.
Покрытые антителами IL-1 р ИФА планшеты промывали трижды промывочным буфером и блокировали с 250 мкл PBS/5% BSA/лунка в течение не менее 2 ч при комнатной температуре (или всю ночь при 4°С). ИФА планшеты промывали трижды в промывочном буфере и постукиванием высушивали. Стандартный IL-1P разводили в PBS/1% BSA. Планшеты, содержащие клетки, центрифугировали при 1200 об/мин в течение 5 мин. Супернатант из каждой лунки переносили в предварительно покрытые IL-1P ИФА планшеты. 100 мкл клеточного супернатанта (разведенного 1 к 3 с PBS/1% BSA) или стандарта добавляли в соответствующие лунки и добавляли 50 мкл идентифицирующего антитела/лунка (разведенные, согласно инструкциям набора). Планшет инкубировали в течение 2 ч при комнатной температуре. Планшеты промывали трижды в промывочном буфере. 100 мкл стрептавидин-HRP добавляли в каждую лунку (разведенные, согласно инструкциям набора) и планшеты инкубировали при комнатной температуре в течение 20 мин. Планшеты промывали трижды в промывочном буфере. 100 мкл готового ТМВ добавляли в каждую лунку и планшеты оставляли проявляться на 5-20 мин (в зависимости от уровня сигнала) в темноте (под пленкой). Реакцию останавливали добавлением 100 мкл/лунка 1М H2SO4.
Поглощение планшетов считывали на микропланшетном ридере при 450 нм и эталонном фильтре, установленном на 650 нм. Количество ингибирования в каждой точке титрования пересчитывали как процент образца, содержащего моноциты и LPS без цитокин-TCR белка слияния, который дает максимальный сигнал, таким образом производя кривую дозу-эффекта.
Эти результаты показывают, что N-слияние конструкции на фиг. 14, по меньшей мере, способно в 2 раза сильнее ингибровать продукцию IL-1 P моноцитами человека, чем С-слияние конструкции на фиг.
15.
ФОРМУЛА ИЗОБРЕТЕНИЯ
1. Бифункциональная молекула, содержащая полипептидный партнер связывания, специфический для данного эпитопа рМНС, и полипептид иммунного эффектора, при этом N-конец рМНС партнера связывания связывается с С-концом полипептида иммунного эффектора, при условии, что вышеуказанный полипептидный партнер связывания не является Т-клеточным рецептором, содержащим альфа цепь SEQ ID No:7 и бета цепь SEQ ID No:9.
2. Бифункциональная молекула по п.1, отличающаяся тем, что рМНС партнер связывания представляет собой гетеродимерную ар полипептидную пару TCR, или одноцепочечный ар полипептид TCR, и N-конец а или р цепей гетеродимерной полипептидной пары TCR, или N-конец scTCR полипептида, связывается с С-концом аминокислоты иммунного эффекторного полипептида.
3. Бифункциональная молекула по п.2, отличающаяся тем, что рМНС партнер связывания представляет собой гетеродимерную ар полипептидную пару TCR, в которой а и р каждого полипептида имеют вариабельную и константную области TCR, но не имеют трансмембранной и цитоплазматической областей TCR.
1.
4. Бифункциональная молекула по п.3, отличающаяся тем, что константные области а и р полипептидов связаны дисульфидными мостиками между остатками цистеина, заменяющего Trh 48 экзона 1 TRAC1 и Ser 57 экзона 1 TRAC1 или TRAC2, или нативными дисульфидными связями между Cys4 экзона 2 TRAC1 и Cys2 экзона 2 TRAC1 или TRAC2.
5. Бифункциональная молекула по п.1, отличающаяся тем, что рМНС партнер связывания представляет собой одноцепочечный ар полипептид TCR.
6. Бифункциональная молекула по любому из предшествующих пунктов, отличающаяся тем, что иммунный эффекторный полипептид представляет собой антитело, которое специфически связывается с антигеном, презентированным Т-клеткой.
7. Бифункциональная молекула по п.6, отличающаяся тем, что антитело представляет собой scFv антитело.
8. Бифункциональная молекула по п.6 или 7, отличающаяся тем, что антитело представляет собой анти-CD3 антитело.
9. Бифункциональная молекула по п.8, отличающаяся тем, что антитело представляет собой ОКТ3.
10. Бифункциональная молекула по п.8, отличающаяся тем, что антитело представляет собой UCHT-1.
11. Бифункциональная молекула по п.8, отличающаяся тем, что антитело представляет собой ВМА031.
12. Бифункциональная молекула по п.8, отличающаяся тем, что антитело представляет собой 12F6.
13. Бифункциональная молекула по любому из предшествующих пунктов, отличающаяся тем, что эффекторный полипептид представляет собой цитокин, который модулирует иммуносупрессорную или иммуностимулирующую активность лимфоцитов.
SEQ ID No: 1 - NY-ESO аминокислотная последовательность альфа цепи TCR
10 20 30 40
KQEVTQIPAALSVPEGENLVLNCSFTDSAIYNLQWFRQDP
50 60 70 80
GKGLTSLLLITPWQREQTSGRLNASLDKSSGRSTLYIAAS
90 100 110 120
QPGDSATYLCAVRPLLDGTYIPTFGRGTSUVHPYIQNPD
130 140 150 160
PAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITO
170 180 190 200
KCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDT
FFPSPESS
Фиг. 1
SEQ ID No: 2 - NY-ESO аминокислотная последовательность бета цепи:
10 20 30
NAGVTQTPKFQVLKTGQSMTLQCAQDMNHEYMSWYRQD
40 50 60 70
PGMGLRLIHYSVAIQTTDQGEVPNGYNVSRSTIEDFPLRL
80 90 100 110
LSAAPSQTSVYFCASSYLGNTGELFFGEGSRLTVLEDLKN
120 130 140 150
VFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSW
160 170 180 190
WVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSA
200 210 220 230
TFWQDPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSA 240
EAWGRAD
Фиг. 2
SEQ ID NO: 3 - UCKM scFv аминокислотная последовательность (с подчеркнутой последоватепьностью ВНУТРИ линкера):
DIQMTQSPSSLSASVGDRVTITCRASQDIRNYLNWYQQKP
50 60 70 80
GKAPKLLIYYTSRLESGVPSRFSGSGSGTDYTLTISSLQPE
90 100 110 120
DFATYYCQQGNTLPWTFOQGTKVEI KRTSGPGDGGKGGP
130 140 150
GKGPGGEGTKSTGPGGEVQLVESGGGLVO.PGGSLRLSC
160 170 180 190
AASGYSFTG YTMNWVRQAPGKGLEWVALINPYKGVSTYN
200 210 220 230
QKFKDRFTISVDKSKNTAYLQMNSLRAEDTAVYYCARSGY 240 250
YGDSDWYFDVWGQGTLVTVSS
SEQ ID No: 9 - аминокислотная последовательность бета цепи химерного TCR
GGIITQTPKFLIGQEGQKLTLKCQQNFNHDTMYWYRQDSG
50 60 70 80
* * * к
KGLRLIYYSLLAGHLOKGDLSEGYDASREKKSSFSLTVTS
90 100 110 120
TQKNEMAVFLCASSKRKNGAETLYFGSGTRLTVLEDLKNV
130 140 150 160
FPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWW
170 180 1S0
* * *
VNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSAT
200 210 220 230
FWQDPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAE 240
AWGRAD
Фиг. 9
SEQ ID No: 10 - аминокислотная последовательность IL-4 мыши:
HIHGCDKNHLREIIGILNEVTGEGTPCTEMOVPNVLTATKNTTESELVCRASKVLRIF YLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIM QMDYS
Фиг. 10
SEQ ID No: 11 - аминокислотная последовательность IL-13 мыши:
GPVPRSVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNIS NCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGPF
Фиг. 11
SEQ IP No: 14 - Аминокислотная последовательность слияния бета цепи NY-ESO TCR с anti-СРЗ scFv, antl-СРЗ scFv слиты с С-концом бета цепи TCR посредством пептида линкера:
NAGVTQTPKFQVLKTGaSMTLQCAQDMNHEYMSWYRQDPGMGLRLIHYSVAIQTT
DQGEVPNGYNVSRSTIEDFPLRLLSMPSQTSVYFCASSYLGNTGELFFGEGSRLT
VLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWVVVNGKEVHS
GVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQDPRNHFRCQVQFYGLSENDE
VvTQDRAKPVTQIVSAEAWGRADGGGGSAIQMTQSPSSLSASVGDRVTITCRASQD
IRNYLNWYQQKPGKAPKLLIYYTSRLESGVPSRFSGSGSGTDYTLTISSLQPEDFAT
YYCQQGNTLPWTFGQGTKVEIKGGGGSGGGGSGGGGSGGGGSGGGSEVQLVE
SGGGLVQPGGSLRLSCAASGYSFTGYTMNWVRQAPGKGLEWVALINPYKGVSTY
NQKFKDRFTISVDKSKNTAYLQMNSLRAEDTAVYYCARSGYYGDSOWYFDVWGQ
GTLVTVSS
Фиг. 16
SEQ ID No: 15 - Аминокислотная, последовательность слияния бета цепи NY-ESO TCR с antl-СРЗ scFv. anti-СРЗ scFv слиты с N-KOHUOM бета цепи TCR посредством пептида линкера:
AIQMTQSPSSLSASVGDRVTITCRASQOIRNYLNWYQQKPGKAPKLLIYYTSRLESG
VPSRFSGSGSGTDYTLTISSLQPEDFATYYCQQGNTLPvVTFGQGTKVEIKGGGGS
GGGGSGGGGSGGGGSGGGSEVQLVESGGGLVQPGGSLRLSCAASGYSFTGYTM
NWVRQAPGKGLEVWALINPYKGVSTYNQKFKDRFTISVDKSKNTAYLQMNSLRAE
DTAWYCARSGYYGDSDWYFDVWGQGTLVTVSSgGGSSNAGVTQTPKFaVLKTG
QSMTLOCAQDMNHEYMSWYRQDPGMGLRLIHYSVAIQTTDQGEVPNGYNVSRSTI
EDFPLRLLSAAPSQTSVYFCASSYLGNTGELFFGEGSRLTVLEDLKNVFPPEVAVFE
PSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALN
DSRYALSSRLRVSATFWQDPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEA
WGRAD
Фиг. 17
перечень последовательностей
<110> иммунокор Лтд,
<120> бифункциональные полипептиды
<130> 113
<1S0> GB0908613.3 <151> 2009-OS-20
<160> 15
<170> patentln version 3.5
<210> 1 <211> 208 <212> БЕЛОК
<213> искусственная последовательность
<220>
<223> Альфа цепь синтетического т клеточного рецептора <400> 1
Lys Gin Glu Val Thr Gin He Pro Ala Ala Leu ser val pro Glu Gly
15 10 15
Glu Asn Leu val Leu Asn Cys Ser Phe Thr Asp ser Ala lie туг Asn
20 25 30
Leu Gin Trp Phe Arg Gin Asp Pro Gly Lys Gly Leu Thr Ser Leu Leu
35 40 45
Leu He Thr Pro Trp Gin Arg Glu Gin Thr ser Gly Arg Leu Asn Ala
50 55 60
Ser Leu Asp Lys ser ser Gly Arg ser Thr Leu Tyr lie Ala Ala Ser
65 70 75 80
Gin Pro Gly Asp Ser Ala Thr Tyr Leu Cys Ala Val Arg Pro Leu Leu
85 90 95
Asp Gly Thr Tyr lie Pro Thr phe Gly Arg Gly Thr Ser Leu lie val
100 105 110
His Pro Tyr lie Gin Asn Pro Asp Pro Ala val Tyr Gin Leu Arg Asp
115 120 125
ser Lys ser ser Asp Lys ser val cys Leu Phe Thr Asp Phe Asp Ser
130 135 140
Gin Thr Asn val ser Gin ser Lys Asp ser Asp val Tyr lie Thr Asp
145 150 155 160
Lys Cys val Leu Asp Met Arg ser Met Asp Phe Lys ser Asn Ser Ala
165 170 175
Val Ala Trp ser Asn Lys ser Asp Phe Ala cys Ala Asn Ala Phe Asn
180
185
190
Asn Ser lie lie Pro Glu Asp Thr Phe Phe Pro Ser Pro Glu ser ser
195 200 205
<210> 2 <211> 243 <212> БЕЛОК
<213> искусственная последовательность <220>
<223> бета цепь синтетического клеточного рецептора <400> 2
Asn Ala Gly Val Thr Gin Thr Pro Lys Phe Gin Val Leu Lys Thr Gly
15 10 15
Gin Ser Met Thr Leu Gin cys Ala Gin Asp Met Asn His Glu Tyr Met
20 25 30
Ser тгр туг Arg Gin Asp Pro Gly Met Gly Leu Arg Leu lie His Tyr
35 40 45
Ser Val Ala lie Gin Thr Thr Asp Gin Gly Glu Val Pro Asn Gly туг
50 55 60
Asn val ser Arg ser Thr Пе Glu Asp Phe Pro Leu Arg Leu Leu ser
65 70 75 80
Ala Ala Pro ser Gin Thr ser val туг Phe cys Ala ser ser туг Leu
85 90 95
Gly Asn Thr Gly Glu Leu Phe Phe Gly Glu Gly Ser Arg Leu Thr val
100 105 110
Leu Glu Asp Leu Lys Asn val Phe Pro Pro Glu val Ala val Phe Glu
115 120 125
Pro 5er Glu Ala Glu lie ser His Thr Gin Lys Ala Thr Leu Val Cys
130 135 140
Leu Ala Thr Gly Phe Tyr Pro Asp His val Glu Leu ser Trp Trp Val
145 150 155 160
165
175
Asn Gly Lys Glu Val His Ser Gly Val Cys Thr Asp Pro Gin Pro Leu
170
Lys Glu Gin Pro Ala Leu Asn Asp Ser Arg Tyr Ala Leu Ser Ser Arg
180 185 190
Leu Arg val Ser Ala Thr phe Trp Gin Asp Pro Arg Asn His Phe Arg
195 200 205
Cys Gin Val Gin Phe Tyr Gly Leu Ser Glu Asn Asp Glu Trp Thr Gin
40S
410
415
Arg Gin Ala Pro Gly Lys Gly Leu Glu Trp Val Ala Leu lie Asn Pro
420 425 430
Tyr Lys Gly Val Ser Thr Tyr Asn Gin Lys Phe Lys Asp Arg Phe Thr
435 440 445
lie ser val Asp Lys Ser Lys Asn Thr Ala Tyr Leu Gin Met Asn Ser
450 455 460
Leu Arg Ala Glu Asp Thr Ala val туг туг Cys Ala Arg ser Gly туг
465 470 475 480
Tyr Gly Asp ser Asp тгр туг Phe Asp val Trp Gly Gin Gly Thr Leu
485 490 495
val Thr val ser ser 500
<210> 15 <211> 501 <212> БЕЛОК
<213> Синтетическая последовательность <220>
<223> Бета цепь т клеточного рецептора-антитело слияние <400> 15
Ala lie Gin Met Thr Gin ser Pro ser Ser Leu ser Ala Ser Val Gly
15 10 15
Asp Arg val Thr lie Thr cys Arg Ala ser Gin Asp lie Arg Asn туг
20 25 30
Leu Asn Trp Tyr Gin Gin Lys Pro Gly Lys Ala Pro Lys Leu Leu lie
35 40 45
туг Tyr Thr ser Arg Leu Glu ser Gly val Pro ser Arg Phe ser Gly
50 55 60
ser Gly Ser Gly Thr Asp Tyr Thr Leu Thr lie Ser ser Leu Gin Pro
65 70 75 80
Glu Asp Phe Ala Thr Tyr Tyr Cys Gin Gin Gly Asn Thr Leu Pro тгр
85 90 95
Thr Phe Gly Gin Gly Thr Lys val Glu lie Lys Gly Gly Gly Gly Ser
100 105 110
Gly Gly Gly Gly ser Gly Gly Gly Gly ser Gly Gly Gly Gly ser Gly
115 120 125
Gly Gly Ser Glu val Gin Leu val Glu ser Gly Gly Gly Leu val Gin
130
135
140
Pro Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala ser Gly Tyr Ser Phe
145 150 155 160
Thr Gly туг Thr Met Asn Trp val Arg Gin Ala Pro Gly Lys Gly Leu
165 170 175
Glu Trp Val Ala Leu lie Asn pro Tyr Lys Gly Val ser Thr Tyr Asn
180 185 190
Gin Lys Phe Lys Asp Arg Phe Thr lie Ser Val Asp Lys Ser Lys Asn
19S 200 205
Thr Ala Tyr Leu Gin Met Asn Ser Leu Arg Ala Glu Asp Thr Ala val
210 215 220
Tyr Tyr cys Ala Arg Ser Gly Tyr Tyr Gly Asp ser Asp Trp Tyr phe
225 230 235 240
ASP val тгр Gly Gin Gly Thr Leu val Thr val ser ser Gly Gly Gly
245 250 255
Gly Ser Asn Ala Gly val Thr Gin Thr Pro Lys Phe Gin val Leu Lys
260 265 270
Thr Gly Gin ser Met Thr Leu Gin cys Ala Gin Asp Met Asn His Glu
275 280 285
Tyr wet ser Trp туг Arg Gin Asp Pro Gly Met Gly Leu Arg Leu lie
290 295 300
His Tyr ser val Ala lie Gin Thr Thr Asp Gin Gly Glu Val Pro Asn
305 310 315 320
Gly Tyr Asn val Ser Arg Ser Thr lie Glu Asp Phe Pro Leu Arg Leu
325 330 335
Leu ser Ala Ala Pro Ser Gin Thr ser Val Tyr Phe Cys Ala Ser Ser
340 345 350
Tyr Leu Gly Asn Thr Gly Glu Leu Phe Phe Gly Glu Gly ser Arg Leu
355 360 365
Thr val Leu Glu Asp Leu Lys Asn val Phe Pro Pro Glu val Ala val
370 375 380
phe Glu Pro ser Glu Ala Glu lie Ser His Thr Gin Lys Ala Thr Leu
385 390 395 400
val Cys Leu Ala Thr Gly Phe туг pro Asp His val Glu Leu Ser Trp
405 410 415
Trp val Asn Gly Lys Glu val His ser Gly val cys Thr Asp Pro Gin
420 425 430
pro Leu Lys Glu Gin Pro Ala Leu Asn Asp Ser Arg Tyr Ala Leu Ser
435 440 445
Ser Arg Leu Arg val ser Ala Thr Phe тгр Gin Asp Pro Arg Asn His
450 455 460
phe Arg Cys Gin Val Gin phe Tyr Gly Leu Ser Glu Asn Asp Glu тгр
465 470 475 480
Thr Gin Asp Arg Ala Lys Pro Val Thr Gin lie Val Ser Ala Glu Ala
485 490 495
Trp Gly Arg Ala Asp 500
Евразийская патентная организация, ЕАПВ Россия, 109012, Москва, Малый Черкасский пер., 2
020841
- 1 -
(19)
020841
- 1 -
(19)
020841
- 1 -
(19)
020841
- 4 -
(19)
020841
- 13 -
020841
- 14 -
020841
- 14 -
020841
- 14 -
020841
- 21 -
020841
- 25 -
020841
- 25 -
020841
- 26 -
020841
- 26 -